F442077

General Info

Members Datasets Scaffolds Average Seq Length
430 213 860 258

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100038912|Ga0070669_1000389122
Length 278
Sequence MTHRSSNGRVRTAFTVVLTMGCLAAVPSSLRAQNAPPAQTGPAPTAPPLGALAPANRAKPRPPAPFDVTGVWLHANSATSNFRFSPPDGFKLTPQAQVHYDAARKAQAEGNVYRDDIGQCWPAGLPLIMTRVWPIAMMQYPTAIYMVSEFMNSLRVVYLDRSHSDPDVVVRSHNGESIGRWEGDTLVIDTQFFIGHHHWIDSGIPASDAMHVVERVRMVNEGRTLEIAYTISDPKTFEGDWKWTKRWNRVDDRDIAEVSCYPDLNDHMPSTRSKENVR

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
153 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
168 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
175 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
176 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
190 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
196 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
197 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.47
Rhizosphere 98.6
Stem 0
Stem Tuber 0
Unclassified 19.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100038912 3300005353 Unclassified 3454
2 Ga0058860_11926141 3300004801 Bacteria 1189
3 Ga0070658_10089005 3300005327 Unclassified 2542
4 Ga0070676_10213245 3300005328 Unclassified 1272
5 Ga0070676_10281774 3300005328 Unclassified 1120
6 Ga0070683_100001747 3300005329 Bacteria 16931
7 Ga0070683_100078358 3300005329 Bacteria 3091
8 Ga0070683_100128654 3300005329 Bacteria 2395
9 Ga0070690_100000736 3300005330 Bacteria 16722
10 Ga0070690_100093198 3300005330 Unclassified 1987
11 Ga0070670_100002240 3300005331 Bacteria 15898
12 Ga0070670_100040168 3300005331 Unclassified 4023
13 Ga0070670_100143923 3300005331 Bacteria 2062
14 Ga0070666_10023186 3300005335 Bacteria 4038
15 Ga0070666_10032350 3300005335 Bacteria 3455
16 Ga0070680_100018542 3300005336 Bacteria 5500
17 Ga0068868_100007793 3300005338 Bacteria 7644
18 Ga0068868_100127252 3300005338 Bacteria 2082
19 Ga0070660_100050352 3300005339 Bacteria 3205
20 Ga0070689_100018080 3300005340 Bacteria 5186
21 Ga0070689_100158166 3300005340 Bacteria 1830
22 Ga0070689_100275885 3300005340 Bacteria 1393
23 Ga0070687_100024771 3300005343 Bacteria 2871
24 Ga0070661_100058951 3300005344 Bacteria 2814
25 Ga0070661_100099681 3300005344 Bacteria 2159
26 Ga0070661_100159254 3300005344 Bacteria 1709
27 Ga0070661_100336157 3300005344 Bacteria 1182
28 Ga0070675_100000185 3300005354 Bacteria 38683
29 Ga0070675_100000567 3300005354 Bacteria 25438
30 Ga0070675_100010245 3300005354 Bacteria 7313
31 Ga0070675_100044754 3300005354 Bacteria 3620
32 Ga0070675_100101377 3300005354 Bacteria 2425
33 Ga0070671_100010828 3300005355 Bacteria 7318
34 Ga0070671_100034789 3300005355 Bacteria 4172
35 Ga0070674_100001662 3300005356 Bacteria 12006
36 Ga0070674_100104417 3300005356 Unclassified 2070
37 Ga0070673_100002822 3300005364 Bacteria 10684
38 Ga0070673_100005158 3300005364 Bacteria 8337
39 Ga0070673_100087772 3300005364 Bacteria 2536
40 Ga0070673_100131695 3300005364 Unclassified 2099
41 Ga0070673_100175983 3300005364 Bacteria 1829
42 Ga0070673_100177940 3300005364 Bacteria 1819
43 Ga0070688_100048558 3300005365 Unclassified 2638
44 Ga0070688_100112072 3300005365 Unclassified 1815
45 Ga0070688_100128019 3300005365 Unclassified 1709
46 Ga0070688_100134625 3300005365 Bacteria 1671
47 Ga0070667_100000673 3300005367 Bacteria 33152
48 Ga0070667_100017889 3300005367 Bacteria 5874
49 Ga0070667_100605551 3300005367 Bacteria 1010
50 Ga0070709_10059817 3300005434 Bacteria 2420
51 Ga0070709_10173396 3300005434 Bacteria 1509
52 Ga0070714_100261973 3300005435 Bacteria 1601
53 Ga0070713_100003153 3300005436 Bacteria 10855
54 Ga0070713_100068183 3300005436 Unclassified 2997
55 Ga0070713_100881365 3300005436 Bacteria 860
56 Ga0070705_100285105 3300005440 Bacteria 1176
57 Ga0070694_100455066 3300005444 Unclassified 1011
58 Ga0070678_100041311 3300005456 Bacteria 3268
59 Ga0070662_100042994 3300005457 Bacteria 3230
60 Ga0070662_100078616 3300005457 Bacteria 2451
61 Ga0070662_100331384 3300005457 Bacteria 1244
62 Ga0070681_10004773 3300005458 Bacteria 12989
63 Ga0068867_100147525 3300005459 Unclassified 1845
64 Ga0070685_10054554 3300005466 Bacteria 2319
65 Ga0070685_10207397 3300005466 Bacteria 1277
66 Ga0070685_10379718 3300005466 Unclassified 973
67 Ga0070679_100002792 3300005530 Bacteria 15870
68 Ga0070684_100000613 3300005535 Bacteria 24605
69 Ga0070684_100012249 3300005535 Bacteria 6866
70 Ga0070684_100021656 3300005535 Bacteria 5354
71 Ga0070684_100046997 3300005535 Unclassified 3741
72 Ga0070684_100058886 3300005535 Bacteria 3358
73 Ga0068853_100845147 3300005539 Unclassified 878
74 Ga0070672_100021753 3300005543 Unclassified 4697
75 Ga0070686_100019410 3300005544 Bacteria 4005
76 Ga0070686_100035903 3300005544 Bacteria 3064
77 Ga0070686_100115722 3300005544 Bacteria 1834
78 Ga0070693_100105316 3300005547 Unclassified 1725
79 Ga0070704_100052318 3300005549 Bacteria 2881
80 Ga0068855_100002398 3300005563 Bacteria 23127
81 Ga0068855_100042894 3300005563 Bacteria 5360
82 Ga0070664_100000537 3300005564 Bacteria 28906
83 Ga0070664_100008098 3300005564 Bacteria 8494
84 Ga0070664_100101688 3300005564 Unclassified 2500
85 Ga0068857_100002614 3300005577 Bacteria 14785
86 Ga0068856_100002896 3300005614 Bacteria 17567
87 Ga0068856_100190497 3300005614 Bacteria 2064
88 Ga0068856_100224043 3300005614 Bacteria 1896
89 Ga0068852_100016230 3300005616 Bacteria 5801
90 Ga0068852_100170611 3300005616 Bacteria 2039
91 Ga0068859_100000877 3300005617 Bacteria 30669
92 Ga0068859_100005572 3300005617 Bacteria 12827
93 Ga0068859_100029966 3300005617 Bacteria 5459
94 Ga0068859_100365244 3300005617 Bacteria 1539
95 Ga0068859_100427917 3300005617 Unclassified 1420
96 Ga0068864_100013357 3300005618 Bacteria 6805
97 Ga0068864_100119898 3300005618 Bacteria 2351
98 Ga0068866_10029142 3300005718 Bacteria 2637
99 Ga0068851_10010930 3300005834 Bacteria 4246
100 Ga0068870_10048805 3300005840 Bacteria 2230
101 Ga0068863_100002689 3300005841 Bacteria 17573
102 Ga0068858_100002453 3300005842 Bacteria 18721
103 Ga0068858_100012739 3300005842 Bacteria 7925
104 Ga0068858_100035139 3300005842 Bacteria 4648
105 Ga0068858_100169416 3300005842 Unclassified 2059
106 Ga0068858_100210743 3300005842 Unclassified 1839
107 Ga0068858_100470942 3300005842 Bacteria 1212
108 Ga0068860_100001451 3300005843 Bacteria 25672
109 Ga0068860_100071791 3300005843 Bacteria 3289
110 Ga0081455_10110775 3300005937 Bacteria 2182
111 Ga0081539_10000228 3300005985 Bacteria 131823
112 Ga0097621_100012686 3300006237 Bacteria 6258
113 Ga0097621_100037065 3300006237 Bacteria 3904
114 Ga0097621_100041387 3300006237 Bacteria 3709
115 Ga0097621_100213188 3300006237 Bacteria 1680
116 Ga0068871_100008155 3300006358 Bacteria 7523
117 Ga0068871_100100832 3300006358 Bacteria 2419
118 Ga0068871_100128316 3300006358 Bacteria 2148
119 Ga0068871_100234710 3300006358 Bacteria 1593
120 Ga0068871_100662382 3300006358 Bacteria 954
121 Ga0075428_100025968 3300006844 Bacteria 6486
122 Ga0075428_100069313 3300006844 Bacteria 3856
123 Ga0075428_100222170 3300006844 Bacteria 2039
124 Ga0075428_100241364 3300006844 Bacteria 1949
125 Ga0075430_100094106 3300006846 Bacteria 2505
126 Ga0075431_100010392 3300006847 Bacteria 9356
127 Ga0075431_100543795 3300006847 Bacteria 1149
128 Ga0075433_10003164 3300006852 Bacteria 12682
129 Ga0075434_100090758 3300006871 Unclassified 3056
130 Ga0075429_100003680 3300006880 Bacteria 13063
131 Ga0068865_100058234 3300006881 Bacteria 2698
132 Ga0068865_100099271 3300006881 Unclassified 2128
133 Ga0097620_100000877 3300006931 Bacteria 30669
134 Ga0097620_100005572 3300006931 Bacteria 12827
135 Ga0097620_100029966 3300006931 Bacteria 5459
136 Ga0097620_100365255 3300006931 Bacteria 1539
137 Ga0097620_100427882 3300006931 Unclassified 1420
138 Ga0075435_100225771 3300007076 Unclassified 1591
139 Ga0105240_10004307 3300009093 Bacteria 21738
140 Ga0105240_10011132 3300009093 Bacteria 12569
141 Ga0111539_10001874 3300009094 Bacteria 27921
142 Ga0111539_10021789 3300009094 Bacteria 7878
143 Ga0111539_10303534 3300009094 Unclassified 1858
144 Ga0111539_10518085 3300009094 Bacteria 1389
145 Ga0105245_10003760 3300009098 Bacteria 13511
146 Ga0105245_10236707 3300009098 Bacteria 1768
147 Ga0105247_10201922 3300009101 Bacteria 1336
148 Ga0114129_10000412 3300009147 Bacteria 50533
149 Ga0114129_10065628 3300009147 Bacteria 5065
150 Ga0114129_10065880 3300009147 Bacteria 5053
151 Ga0114129_10126169 3300009147 Bacteria 3518
152 Ga0105243_10043542 3300009148 Bacteria 3518
153 Ga0105241_10001909 3300009174 Bacteria 15778
154 Ga0105242_10043054 3300009176 Unclassified 3650
155 Ga0105248_10000625 3300009177 Bacteria 40199
156 Ga0105248_10002617 3300009177 Bacteria 20020
157 Ga0105248_10009279 3300009177 Bacteria 10832
158 Ga0105248_10043908 3300009177 Bacteria 5013
159 Ga0105248_10063042 3300009177 Unclassified 4160
160 Ga0105248_11629532 3300009177 Bacteria 731
161 Ga0105237_10008995 3300009545 Bacteria 10742
162 Ga0105237_10030796 3300009545 Bacteria 5446
163 Ga0105238_10008155 3300009551 Bacteria 10480
164 Ga0105238_10017183 3300009551 Bacteria 7348
165 Ga0105238_10048517 3300009551 Bacteria 4279
166 Ga0105238_10051735 3300009551 Bacteria 4130
167 Ga0105238_10098580 3300009551 Bacteria 2906
168 Ga0105249_10019330 3300009553 Bacteria 6076
169 Ga0105239_10003289 3300010375 Bacteria 19927
170 Ga0105239_10004635 3300010375 Bacteria 16340
171 Ga0105239_10052405 3300010375 Bacteria 4475
172 Ga0105239_10302742 3300010375 Unclassified 1800
173 Ga0105246_10035566 3300011119 Bacteria 3330
174 Ga0105246_10035618 3300011119 Bacteria 3328
175 Ga0105246_10089694 3300011119 Bacteria 2212
176 Ga0157370_10004062 3300013104 Bacteria 16964
177 Ga0157370_10010437 3300013104 Bacteria 9790
178 Ga0157369_10006556 3300013105 Bacteria 13475
179 Ga0157369_10011059 3300013105 Bacteria 10267
180 Ga0157369_10197836 3300013105 Unclassified 2110
181 Ga0157374_10086473 3300013296 Unclassified 2983
182 Ga0157378_10016114 3300013297 Bacteria 6545
183 Ga0157378_10118998 3300013297 Bacteria 2432
184 Ga0163162_10022192 3300013306 Bacteria 6257
185 Ga0163162_10097480 3300013306 Bacteria 3029
186 Ga0163162_10134018 3300013306 Bacteria 2587
187 Ga0163162_10203837 3300013306 Unclassified 2107
188 Ga0157372_10004450 3300013307 Bacteria 14945
189 Ga0157372_10153933 3300013307 Bacteria 2655
190 Ga0157372_10183300 3300013307 Bacteria 2424
191 Ga0157375_10000384 3300013308 Bacteria 40355
192 Ga0157375_10022243 3300013308 Bacteria 5833
193 Ga0157375_10115190 3300013308 Bacteria 2791
194 Ga0163163_10002113 3300014325 Bacteria 16766
195 Ga0163163_10032552 3300014325 Bacteria 5036
196 Ga0163163_10076151 3300014325 Bacteria 3350
197 Ga0163163_10086034 3300014325 Unclassified 3152
198 Ga0163163_10138276 3300014325 Bacteria 2477
199 Ga0163163_10285514 3300014325 Bacteria 1702
200 Ga0157380_10221997 3300014326 Bacteria 1691
201 Ga0157377_10358069 3300014745 Unclassified 981
202 Ga0157379_10000674 3300014968 Bacteria 27648
203 Ga0157379_10146048 3300014968 Bacteria 2133
204 Ga0157376_10038807 3300014969 Bacteria 3877
205 Ga0157376_10048347 3300014969 Bacteria 3517
206 Ga0157376_10057576 3300014969 Bacteria 3252
207 Ga0157376_10241544 3300014969 Bacteria 1683
208 Ga0163161_10055213 3300017792 Bacteria 2883
209 Ga0163161_10171068 3300017792 Bacteria 1661
210 Ga0206356_11596471 3300020070 Bacteria 1609
211 Ga0213875_10020144 3300021388 Bacteria 3200
212 Ga0207656_10040147 3300025321 Bacteria 1983
213 Ga0207682_10054336 3300025893 Bacteria 1664
214 Ga0207682_10089536 3300025893 Unclassified 1332
215 Ga0207680_10006550 3300025903 Bacteria 5642
216 Ga0207680_10016463 3300025903 Bacteria 3882
217 Ga0207680_10020396 3300025903 Unclassified 3567
218 Ga0207680_10154760 3300025903 Bacteria 1532
219 Ga0207685_10045035 3300025905 Bacteria 1671
220 Ga0207699_10064469 3300025906 Bacteria 2217
221 Ga0207645_10037786 3300025907 Bacteria 3098
222 Ga0207645_10119384 3300025907 Bacteria 1711
223 Ga0207643_10034427 3300025908 Unclassified 2838
224 Ga0207654_10002731 3300025911 Bacteria 8960
225 Ga0207654_10005087 3300025911 Bacteria 6632
226 Ga0207707_10000890 3300025912 Bacteria 29183
227 Ga0207695_10000504 3300025913 Bacteria 83019
228 Ga0207695_10011467 3300025913 Bacteria 10731
229 Ga0207695_10332748 3300025913 Bacteria 1407
230 Ga0207671_10014853 3300025914 Bacteria 6129
231 Ga0207671_10052786 3300025914 Bacteria 3012
232 Ga0207693_10364595 3300025915 Bacteria 1130
233 Ga0207660_10019893 3300025917 Bacteria 4496
234 Ga0207657_10031064 3300025919 Bacteria 4842
235 Ga0207649_10094800 3300025920 Bacteria 1962
236 Ga0207649_10120046 3300025920 Bacteria 1771
237 Ga0207652_10024635 3300025921 Bacteria 4993
238 Ga0207652_10072063 3300025921 Bacteria 3003
239 Ga0207681_10044959 3300025923 Unclassified 2962
240 Ga0207694_10003653 3300025924 Bacteria 12182
241 Ga0207694_10018374 3300025924 Bacteria 5285
242 Ga0207694_10063385 3300025924 Unclassified 2880
243 Ga0207694_10105158 3300025924 Bacteria 2240
244 Ga0207694_10112834 3300025924 Unclassified 2163
245 Ga0207650_10018668 3300025925 Unclassified 4868
246 Ga0207659_10000944 3300025926 Bacteria 17370
247 Ga0207659_10007423 3300025926 Bacteria 6740
248 Ga0207659_10019194 3300025926 Bacteria 4495
249 Ga0207659_10126714 3300025926 Bacteria 1964
250 Ga0207659_10171641 3300025926 Unclassified 1711
251 Ga0207659_10324284 3300025926 Bacteria 1271
252 Ga0207687_10000549 3300025927 Bacteria 25211
253 Ga0207687_10078455 3300025927 Bacteria 2378
254 Ga0207687_10312853 3300025927 Unclassified 1269
255 Ga0207700_10127467 3300025928 Unclassified 2073
256 Ga0207664_10063797 3300025929 Bacteria 2945
257 Ga0207644_10039556 3300025931 Bacteria 3329
258 Ga0207644_10068914 3300025931 Bacteria 2582
259 Ga0207690_10094799 3300025932 Unclassified 2118
260 Ga0207706_10139537 3300025933 Bacteria 2132
261 Ga0207706_10235687 3300025933 Bacteria 1600
262 Ga0207686_10042048 3300025934 Bacteria 2791
263 Ga0207686_10318656 3300025934 Unclassified 1161
264 Ga0207686_10500819 3300025934 Bacteria 942
265 Ga0207709_10045326 3300025935 Unclassified 2662
266 Ga0207670_10102938 3300025936 Bacteria 2042
267 Ga0207670_10366095 3300025936 Unclassified 1145
268 Ga0207669_10001894 3300025937 Bacteria 8869
269 Ga0207669_10430647 3300025937 Bacteria 1040
270 Ga0207704_10004068 3300025938 Bacteria 6665
271 Ga0207691_10016466 3300025940 Bacteria 7018
272 Ga0207691_10060346 3300025940 Bacteria 3446
273 Ga0207691_10143644 3300025940 Unclassified 2102
274 Ga0207691_10270608 3300025940 Bacteria 1463
275 Ga0207711_10000454 3300025941 Bacteria 42713
276 Ga0207711_10004923 3300025941 Bacteria 11341
277 Ga0207711_10021544 3300025941 Bacteria 5384
278 Ga0207711_10531261 3300025941 Unclassified 1097
279 Ga0207689_10040952 3300025942 Bacteria 3833
280 Ga0207661_10002830 3300025944 Bacteria 11984
281 Ga0207661_10016407 3300025944 Bacteria 5464
282 Ga0207661_10029404 3300025944 Bacteria 4220
283 Ga0207661_10802642 3300025944 Unclassified 866
284 Ga0207679_10036684 3300025945 Bacteria 3478
285 Ga0207667_10000179 3300025949 Bacteria 92219
286 Ga0207667_10056401 3300025949 Bacteria 4127
287 Ga0207651_10012744 3300025960 Bacteria 4775
288 Ga0207651_10040388 3300025960 Bacteria 3086
289 Ga0207651_10055320 3300025960 Bacteria 2725
290 Ga0207651_10118862 3300025960 Unclassified 2000
291 Ga0207651_10253820 3300025960 Bacteria 1440
292 Ga0207712_10019429 3300025961 Bacteria 4437
293 Ga0207658_10014503 3300025986 Bacteria 5396
294 Ga0207677_10003895 3300026023 Bacteria 7946
295 Ga0207703_10044271 3300026035 Bacteria 3577
296 Ga0207703_10233497 3300026035 Bacteria 1650
297 Ga0207703_10285481 3300026035 Bacteria 1500
298 Ga0207639_10492703 3300026041 Bacteria 1118
299 Ga0207702_10002077 3300026078 Bacteria 19363
300 Ga0207702_10016807 3300026078 Bacteria 6056
301 Ga0207702_10254905 3300026078 Unclassified 1649
302 Ga0207702_10283259 3300026078 Bacteria 1568
303 Ga0207641_10001922 3300026088 Bacteria 19931
304 Ga0207641_10366110 3300026088 Bacteria 1377
305 Ga0207648_10026101 3300026089 Bacteria 5194
306 Ga0207648_10089008 3300026089 Unclassified 2696
307 Ga0207648_10156037 3300026089 Unclassified 2015
308 Ga0207648_10182070 3300026089 Bacteria 1860
309 Ga0207648_10322196 3300026089 Bacteria 1389
310 Ga0207674_10002628 3300026116 Bacteria 22485
311 Ga0207674_10004547 3300026116 Bacteria 16663
312 Ga0207674_10176123 3300026116 Unclassified 2091
313 Ga0207674_10211207 3300026116 Unclassified 1890
314 Ga0207683_10026840 3300026121 Bacteria 4974
315 Ga0207698_10048774 3300026142 Bacteria 3217
316 Ga0209996_1008944 3300027395 Bacteria 1316
317 Ga0207428_10012491 3300027907 Bacteria 7460
318 Ga0207428_10120369 3300027907 Bacteria 2013
319 Ga0268264_10001920 3300028381 Bacteria 18759
320 Ga0268264_10075454 3300028381 Bacteria 2867
321 Ga0268264_10372449 3300028381 Bacteria 1365
322 Ga0265313_10048762 3300031595 Bacteria 2041
323 Ga0265314_10000658 3300031711 Bacteria 42283
324 Ga0307405_10279419 3300031731 Bacteria 1256
325 Ga0307406_10303888 3300031901 Bacteria 1227
326 Ga0307407_10096745 3300031903 Bacteria 1823
327 Ga0307412_10187341 3300031911 Bacteria 1562
328 Ga0307412_10254338 3300031911 Bacteria 1366
329 Ga0307416_100472435 3300032002 Bacteria 1312
330 Ga0373934_0002610 3300035086 Bacteria 6637
331 Ga0373934_0044285 3300035086 Bacteria 1759
332 Ga0373923_0156549 3300035111 Bacteria 1037
333 Ga0373936_0041207 3300035113 Bacteria 1852
334 Ga0373945_0127511 3300035116 Bacteria 1017
335 Ga0373953_0043046 3300035117 Bacteria 1801
336 Ga0373954_0005147 3300035118 Bacteria 5648
337 Ga0373954_0022048 3300035118 Bacteria 2887
338 Ga0373957_0048267 3300035120 Bacteria 1622
339 Ga0373957_0120917 3300035120 Unclassified 1060
340 Ga0373957_0134281 3300035120 Unclassified 1009
341 Ga0373943_0054866 3300035170 Bacteria 1972
342 Ga0373946_0144739 3300035171 Bacteria 1104
343 Ga0373955_0016762 3300035172 Bacteria 3611
344 Ga0373955_0102231 3300035172 Bacteria 1647
345 Ga0373924_0122853 3300035410 Bacteria 1127
346 Ga0373947_0044217 3300035725 Bacteria 2661
347 Ga0373947_0302375 3300035725 Unclassified 1067
348 Ga0373937_0019719 3300036401 Bacteria 6039
349 Ga0373937_0090179 3300036401 Bacteria 2839
350 Ga0373937_0110261 3300036401 Unclassified 2559
351 Ga0373937_0215170 3300036401 Unclassified 1808
352 Ga0373937_0495208 3300036401 Unclassified 1161
353 Ga0373925_0007546 3300037068 Bacteria 7925
354 Ga0373925_0030874 3300037068 Bacteria 3935
355 Ga0436364_0599252 3300037853 Bacteria 4641
356 Ga0451853_0198449 3300041512 Unclassified 1915
357 Ga0439435_0017426 3300042436 Bacteria 1816
358 Ga0451576_0337824 3300045051 Bacteria 1577
359 Ga0495592_0215184 3300046454 Unclassified 1288
360 Ga0495629_0096425 3300046459 Bacteria 2063
361 Ga0495651_0056108 3300046462 Unclassified 3026
362 Ga0495651_0156115 3300046462 Unclassified 1640
363 Ga0495580_0042603 3300046472 Bacteria 3233
364 Ga0495580_0087857 3300046472 Bacteria 2165
365 Ga0495580_0186171 3300046472 Bacteria 1433
366 Ga0495580_0237653 3300046472 Bacteria 1250
367 Ga0495582_0003549 3300046473 Bacteria 8792
368 Ga0495582_0048868 3300046473 Bacteria 2330
369 Ga0495662_0036302 3300046476 Bacteria 2379
370 Ga0495664_0081930 3300046477 Unclassified 1935
371 Ga0495594_0024353 3300046499 Bacteria 3251
372 Ga0495608_0071540 3300046511 Bacteria 2263
373 Ga0495618_0066704 3300046514 Bacteria 2288
374 Ga0495643_0002153 3300046522 Bacteria 16186
375 Ga0495586_0063546 3300046535 Bacteria 2011
376 Ga0495587_0024968 3300046536 Bacteria 3657
377 Ga0495587_0063777 3300046536 Bacteria 2154
378 Ga0495598_0032310 3300046537 Bacteria 1478
379 Ga0495645_0016905 3300046543 Bacteria 5221
380 Ga0495667_0001946 3300046559 Bacteria 13660
381 Ga0495635_0164473 3300046663 Bacteria 1510
382 Ga0495635_0396942 3300046663 Unclassified 916
383 Ga0495657_0005970 3300046675 Bacteria 9568
384 Ga0495599_0016853 3300046678 Bacteria 4538
385 Ga0495599_0261709 3300046678 Bacteria 1051
386 Ga0495623_0052826 3300046679 Bacteria 2567
387 Ga0495623_0279156 3300046679 Bacteria 930
388 Ga0495647_0067488 3300046681 Bacteria 1425
389 Ga0495658_0010820 3300046683 Bacteria 4571
390 Ga0495658_0011495 3300046683 Bacteria 4454
391 Ga0495658_0472792 3300046683 Unclassified 801
392 Ga0495613_0001120 3300046689 Bacteria 20390
393 Ga0495613_0013237 3300046689 Bacteria 6131
394 Ga0495613_0015164 3300046689 Bacteria 5726
395 Ga0495613_0159001 3300046689 Bacteria 1608
396 Ga0495613_0268363 3300046689 Unclassified 1187
397 Ga0495600_0144156 3300046809 Bacteria 1544
398 Ga0495604_0024827 3300047317 Bacteria 4781
399 Ga0495636_0059363 3300047318 Bacteria 1614
400 Ga0495636_0081131 3300047318 Unclassified 1397
401 Ga0495674_0009054 3300047319 Bacteria 9456
402 Ga0495674_0009548 3300047319 Bacteria 9215
403 Ga0495674_0783899 3300047319 Bacteria 743
404 Ga0495680_0164229 3300047322 Unclassified 1611
405 Ga0495684_0000815 3300047471 Bacteria 25228
406 Ga0495684_0340086 3300047471 Unclassified 1068
407 Ga0495593_0178705 3300047673 Bacteria 1069
408 Ga0495602_0000399 3300048088 Bacteria 40598
409 Ga0496100_0288708 3300048903 Unclassified 1225
410 Ga0496113_0512447 3300048916 Bacteria 963
411 Ga0501042_0205520 3300049578 Bacteria 1420
412 nmdc:mga05p37_118936_c2 3300050507 Bacteria 2844
413 nmdc:mga05p37_77630_c1 3300050507 Bacteria 4089
414 nmdc:mga05p37_8330_c1 3300050507 Bacteria 12263
415 nmdc:mga09592_47453_c1 3300050508 Unclassified 3619
416 nmdc:mga09592_926_c1 3300050508 Bacteria 16455
417 nmdc:mga06r32_1355_c1 3300050510 Bacteria 22096
418 nmdc:mga06r32_349223_c1 3300050510 Unclassified 1464
419 nmdc:mga08y16_24069_c1 3300050511 Bacteria 6430
420 nmdc:mga08y16_34916_c1 3300050511 Bacteria 5283
421 nmdc:mga0n895_100127_c1 3300050512 Unclassified 2907
422 nmdc:mga0n895_61800_c1 3300050512 Unclassified 3699
423 nmdc:mga0rr50_310158_c1 3300050513 Bacteria 1321
424 nmdc:mga08x19_305521_c1 3300050514 Bacteria 1105
425 nmdc:mga0a205_19431_c1 3300050515 Bacteria 6404
426 nmdc:mga0a205_70905_c1 3300050515 Unclassified 3365
427 Ga0495601_0312079 3300053077 Unclassified 1024
428 Ga0495601_0355864 3300053077 Unclassified 952
429 Ga0495619_0006578 3300053085 Bacteria 7351
430 Ga0495619_0026153 3300053085 Bacteria 3753
431 Ga0070669_100038912
432 Ga0058860_11926141
433 Ga0070658_10089005
434 Ga0070676_10213245
435 Ga0070676_10281774
436 Ga0070683_100001747
437 Ga0070683_100078358
438 Ga0070683_100128654
439 Ga0070690_100000736
440 Ga0070690_100093198
441 Ga0070670_100002240
442 Ga0070670_100040168
443 Ga0070670_100143923
444 Ga0070666_10023186
445 Ga0070666_10032350
446 Ga0070680_100018542
447 Ga0068868_100007793
448 Ga0068868_100127252
449 Ga0070660_100050352
450 Ga0070689_100018080
451 Ga0070689_100158166
452 Ga0070689_100275885
453 Ga0070687_100024771
454 Ga0070661_100058951
455 Ga0070661_100099681
456 Ga0070661_100159254
457 Ga0070661_100336157
458 Ga0070675_100000185
459 Ga0070675_100000567
460 Ga0070675_100010245
461 Ga0070675_100044754
462 Ga0070675_100101377
463 Ga0070671_100010828
464 Ga0070671_100034789
465 Ga0070674_100001662
466 Ga0070674_100104417
467 Ga0070673_100002822
468 Ga0070673_100005158
469 Ga0070673_100087772
470 Ga0070673_100131695
471 Ga0070673_100175983
472 Ga0070673_100177940
473 Ga0070688_100048558
474 Ga0070688_100112072
475 Ga0070688_100128019
476 Ga0070688_100134625
477 Ga0070667_100000673
478 Ga0070667_100017889
479 Ga0070667_100605551
480 Ga0070709_10059817
481 Ga0070709_10173396
482 Ga0070714_100261973
483 Ga0070713_100003153
484 Ga0070713_100068183
485 Ga0070713_100881365
486 Ga0070705_100285105
487 Ga0070694_100455066
488 Ga0070678_100041311
489 Ga0070662_100042994
490 Ga0070662_100078616
491 Ga0070662_100331384
492 Ga0070681_10004773
493 Ga0068867_100147525
494 Ga0070685_10054554
495 Ga0070685_10207397
496 Ga0070685_10379718
497 Ga0070679_100002792
498 Ga0070684_100000613
499 Ga0070684_100012249
500 Ga0070684_100021656
501 Ga0070684_100046997
502 Ga0070684_100058886
503 Ga0068853_100845147
504 Ga0070672_100021753
505 Ga0070686_100019410
506 Ga0070686_100035903
507 Ga0070686_100115722
508 Ga0070693_100105316
509 Ga0070704_100052318
510 Ga0068855_100002398
511 Ga0068855_100042894
512 Ga0070664_100000537
513 Ga0070664_100008098
514 Ga0070664_100101688
515 Ga0068857_100002614
516 Ga0068856_100002896
517 Ga0068856_100190497
518 Ga0068856_100224043
519 Ga0068852_100016230
520 Ga0068852_100170611
521 Ga0068859_100000877
522 Ga0068859_100005572
523 Ga0068859_100029966
524 Ga0068859_100365244
525 Ga0068859_100427917
526 Ga0068864_100013357
527 Ga0068864_100119898
528 Ga0068866_10029142
529 Ga0068851_10010930
530 Ga0068870_10048805
531 Ga0068863_100002689
532 Ga0068858_100002453
533 Ga0068858_100012739
534 Ga0068858_100035139
535 Ga0068858_100169416
536 Ga0068858_100210743
537 Ga0068858_100470942
538 Ga0068860_100001451
539 Ga0068860_100071791
540 Ga0081455_10110775
541 Ga0081539_10000228
542 Ga0097621_100012686
543 Ga0097621_100037065
544 Ga0097621_100041387
545 Ga0097621_100213188
546 Ga0068871_100008155
547 Ga0068871_100100832
548 Ga0068871_100128316
549 Ga0068871_100234710
550 Ga0068871_100662382
551 Ga0075428_100025968
552 Ga0075428_100069313
553 Ga0075428_100222170
554 Ga0075428_100241364
555 Ga0075430_100094106
556 Ga0075431_100010392
557 Ga0075431_100543795
558 Ga0075433_10003164
559 Ga0075434_100090758
560 Ga0075429_100003680
561 Ga0068865_100058234
562 Ga0068865_100099271
563 Ga0097620_100000877
564 Ga0097620_100005572
565 Ga0097620_100029966
566 Ga0097620_100365255
567 Ga0097620_100427882
568 Ga0075435_100225771
569 Ga0105240_10004307
570 Ga0105240_10011132
571 Ga0111539_10001874
572 Ga0111539_10021789
573 Ga0111539_10303534
574 Ga0111539_10518085
575 Ga0105245_10003760
576 Ga0105245_10236707
577 Ga0105247_10201922
578 Ga0114129_10000412
579 Ga0114129_10065628
580 Ga0114129_10065880
581 Ga0114129_10126169
582 Ga0105243_10043542
583 Ga0105241_10001909
584 Ga0105242_10043054
585 Ga0105248_10000625
586 Ga0105248_10002617
587 Ga0105248_10009279
588 Ga0105248_10043908
589 Ga0105248_10063042
590 Ga0105248_11629532
591 Ga0105237_10008995
592 Ga0105237_10030796
593 Ga0105238_10008155
594 Ga0105238_10017183
595 Ga0105238_10048517
596 Ga0105238_10051735
597 Ga0105238_10098580
598 Ga0105249_10019330
599 Ga0105239_10003289
600 Ga0105239_10004635
601 Ga0105239_10052405
602 Ga0105239_10302742
603 Ga0105246_10035566
604 Ga0105246_10035618
605 Ga0105246_10089694
606 Ga0157370_10004062
607 Ga0157370_10010437
608 Ga0157369_10006556
609 Ga0157369_10011059
610 Ga0157369_10197836
611 Ga0157374_10086473
612 Ga0157378_10016114
613 Ga0157378_10118998
614 Ga0163162_10022192
615 Ga0163162_10097480
616 Ga0163162_10134018
617 Ga0163162_10203837
618 Ga0157372_10004450
619 Ga0157372_10153933
620 Ga0157372_10183300
621 Ga0157375_10000384
622 Ga0157375_10022243
623 Ga0157375_10115190
624 Ga0163163_10002113
625 Ga0163163_10032552
626 Ga0163163_10076151
627 Ga0163163_10086034
628 Ga0163163_10138276
629 Ga0163163_10285514
630 Ga0157380_10221997
631 Ga0157377_10358069
632 Ga0157379_10000674
633 Ga0157379_10146048
634 Ga0157376_10038807
635 Ga0157376_10048347
636 Ga0157376_10057576
637 Ga0157376_10241544
638 Ga0163161_10055213
639 Ga0163161_10171068
640 Ga0206356_11596471
641 Ga0213875_10020144
642 Ga0207656_10040147
643 Ga0207682_10054336
644 Ga0207682_10089536
645 Ga0207680_10006550
646 Ga0207680_10016463
647 Ga0207680_10020396
648 Ga0207680_10154760
649 Ga0207685_10045035
650 Ga0207699_10064469
651 Ga0207645_10037786
652 Ga0207645_10119384
653 Ga0207643_10034427
654 Ga0207654_10002731
655 Ga0207654_10005087
656 Ga0207707_10000890
657 Ga0207695_10000504
658 Ga0207695_10011467
659 Ga0207695_10332748
660 Ga0207671_10014853
661 Ga0207671_10052786
662 Ga0207693_10364595
663 Ga0207660_10019893
664 Ga0207657_10031064
665 Ga0207649_10094800
666 Ga0207649_10120046
667 Ga0207652_10024635
668 Ga0207652_10072063
669 Ga0207681_10044959
670 Ga0207694_10003653
671 Ga0207694_10018374
672 Ga0207694_10063385
673 Ga0207694_10105158
674 Ga0207694_10112834
675 Ga0207650_10018668
676 Ga0207659_10000944
677 Ga0207659_10007423
678 Ga0207659_10019194
679 Ga0207659_10126714
680 Ga0207659_10171641
681 Ga0207659_10324284
682 Ga0207687_10000549
683 Ga0207687_10078455
684 Ga0207687_10312853
685 Ga0207700_10127467
686 Ga0207664_10063797
687 Ga0207644_10039556
688 Ga0207644_10068914
689 Ga0207690_10094799
690 Ga0207706_10139537
691 Ga0207706_10235687
692 Ga0207686_10042048
693 Ga0207686_10318656
694 Ga0207686_10500819
695 Ga0207709_10045326
696 Ga0207670_10102938
697 Ga0207670_10366095
698 Ga0207669_10001894
699 Ga0207669_10430647
700 Ga0207704_10004068
701 Ga0207691_10016466
702 Ga0207691_10060346
703 Ga0207691_10143644
704 Ga0207691_10270608
705 Ga0207711_10000454
706 Ga0207711_10004923
707 Ga0207711_10021544
708 Ga0207711_10531261
709 Ga0207689_10040952
710 Ga0207661_10002830
711 Ga0207661_10016407
712 Ga0207661_10029404
713 Ga0207661_10802642
714 Ga0207679_10036684
715 Ga0207667_10000179
716 Ga0207667_10056401
717 Ga0207651_10012744
718 Ga0207651_10040388
719 Ga0207651_10055320
720 Ga0207651_10118862
721 Ga0207651_10253820
722 Ga0207712_10019429
723 Ga0207658_10014503
724 Ga0207677_10003895
725 Ga0207703_10044271
726 Ga0207703_10233497
727 Ga0207703_10285481
728 Ga0207639_10492703
729 Ga0207702_10002077
730 Ga0207702_10016807
731 Ga0207702_10254905
732 Ga0207702_10283259
733 Ga0207641_10001922
734 Ga0207641_10366110
735 Ga0207648_10026101
736 Ga0207648_10089008
737 Ga0207648_10156037
738 Ga0207648_10182070
739 Ga0207648_10322196
740 Ga0207674_10002628
741 Ga0207674_10004547
742 Ga0207674_10176123
743 Ga0207674_10211207
744 Ga0207683_10026840
745 Ga0207698_10048774
746 Ga0209996_1008944
747 Ga0207428_10012491
748 Ga0207428_10120369
749 Ga0268264_10001920
750 Ga0268264_10075454
751 Ga0268264_10372449
752 Ga0265313_10048762
753 Ga0265314_10000658
754 Ga0307405_10279419
755 Ga0307406_10303888
756 Ga0307407_10096745
757 Ga0307412_10187341
758 Ga0307412_10254338
759 Ga0307416_100472435
760 Ga0373934_0002610
761 Ga0373934_0044285
762 Ga0373923_0156549
763 Ga0373936_0041207
764 Ga0373945_0127511
765 Ga0373953_0043046
766 Ga0373954_0005147
767 Ga0373954_0022048
768 Ga0373957_0048267
769 Ga0373957_0120917
770 Ga0373957_0134281
771 Ga0373943_0054866
772 Ga0373946_0144739
773 Ga0373955_0016762
774 Ga0373955_0102231
775 Ga0373924_0122853
776 Ga0373947_0044217
777 Ga0373947_0302375
778 Ga0373937_0019719
779 Ga0373937_0090179
780 Ga0373937_0110261
781 Ga0373937_0215170
782 Ga0373937_0495208
783 Ga0373925_0007546
784 Ga0373925_0030874
785 Ga0436364_0599252
786 Ga0451853_0198449
787 Ga0439435_0017426
788 Ga0451576_0337824
789 Ga0495592_0215184
790 Ga0495629_0096425
791 Ga0495651_0056108
792 Ga0495651_0156115
793 Ga0495580_0042603
794 Ga0495580_0087857
795 Ga0495580_0186171
796 Ga0495580_0237653
797 Ga0495582_0003549
798 Ga0495582_0048868
799 Ga0495662_0036302
800 Ga0495664_0081930
801 Ga0495594_0024353
802 Ga0495608_0071540
803 Ga0495618_0066704
804 Ga0495643_0002153
805 Ga0495586_0063546
806 Ga0495587_0024968
807 Ga0495587_0063777
808 Ga0495598_0032310
809 Ga0495645_0016905
810 Ga0495667_0001946
811 Ga0495635_0164473
812 Ga0495635_0396942
813 Ga0495657_0005970
814 Ga0495599_0016853
815 Ga0495599_0261709
816 Ga0495623_0052826
817 Ga0495623_0279156
818 Ga0495647_0067488
819 Ga0495658_0010820
820 Ga0495658_0011495
821 Ga0495658_0472792
822 Ga0495613_0001120
823 Ga0495613_0013237
824 Ga0495613_0015164
825 Ga0495613_0159001
826 Ga0495613_0268363
827 Ga0495600_0144156
828 Ga0495604_0024827
829 Ga0495636_0059363
830 Ga0495636_0081131
831 Ga0495674_0009054
832 Ga0495674_0009548
833 Ga0495674_0783899
834 Ga0495680_0164229
835 Ga0495684_0000815
836 Ga0495684_0340086
837 Ga0495593_0178705
838 Ga0495602_0000399
839 Ga0496100_0288708
840 Ga0496113_0512447
841 Ga0501042_0205520
842 nmdc:mga05p37_118936_c2
843 nmdc:mga05p37_77630_c1
844 nmdc:mga05p37_8330_c1
845 nmdc:mga09592_47453_c1
846 nmdc:mga09592_926_c1
847 nmdc:mga06r32_1355_c1
848 nmdc:mga06r32_349223_c1
849 nmdc:mga08y16_24069_c1
850 nmdc:mga08y16_34916_c1
851 nmdc:mga0n895_100127_c1
852 nmdc:mga0n895_61800_c1
853 nmdc:mga0rr50_310158_c1
854 nmdc:mga08x19_305521_c1
855 nmdc:mga0a205_19431_c1
856 nmdc:mga0a205_70905_c1
857 Ga0495601_0312079
858 Ga0495601_0355864
859 Ga0495619_0006578
860 Ga0495619_0026153

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iw9-assembly1.cif.gz_B structure of bacteriophage t4 gp25, sheath polymerization initiator 0.7728 200 238
6hb8-assembly1.cif.gz_D crystal structure of oxa-517 beta-lactamase 0.7263 194 236
1xa1-assembly3.cif.gz_C crystal structure of the sensor domain of blar1 from staphylococcus aureus in its apo form 0.7036 198 239
4wmc-assembly4.cif.gz_G oxa-48 covalent complex with avibactam inhibitor 0.6914 194 240
6n6w-assembly1.cif.gz_A oxa-23 mutant f110a/m221a neutral ph form 0.6724 198 242
ID Description Score Start End Superfamily
5iw9B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7728 200 238 3.10.450.40
af_Q0IU89_388_485_2.60.40.1230 Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain 0.7276 198 242 2.60.40.1230
4hgzD02 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.7145 195 238 2.20.25.570
af_Q8MYN1_1050_1343_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.6887 198 232 3.90.190.10
3pagA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.6786 198 243 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A2E9ZHT1-F1-model_v4 Uncharacterized protein 0.9312 120 248
AF-A0A2V8MDV3-F1-model_v4 Uncharacterized protein 0.9256 53 259
AF-A0A2V8IWV6-F1-model_v4 Uncharacterized protein 0.9251 109 249
AF-A0A349KRC5-F1-model_v4 Uncharacterized protein 0.9206 122 248
AF-A0A2V8N442-F1-model_v4 Uncharacterized protein 0.9175 124 249

Map