F441983

General Info

Members Datasets Scaffolds Average Seq Length
429 171 399 311

Family's Representative Sequence

Representative Sequence 3300046492|Ga0495585_0028540|Ga0495585_0028540_1622_2692
Length 356
Sequence MLSVQYQGHYKYYIVIIGSRVRGSDGFTDGGTVSANVQNKLSDHKEEHKVQAQTVYAIGECMIELQRNGAGMDYRFGGDTLNAAVYMARLLDPAQVKVAYVTGLGVDGMSDEMCASWREEGIATCCVLRLPDRLPGIYMIETDPTGERRFHYWRRDSAARHWLEAPDAGKVLLKLSRASMVYLSGISLAILSPADRELLISALARCRAAGGSVVFDNNYRPRLWESAADAAAVYARVLGHCDIALLTLDDEEALYGPHDVMAAIERTRARGVKEVVVKRGAEPCVVWDGGQAVEVAAAPVADVVDTTAAGDSFGGAYLAARLSGATPEEAARAGHRLAGTVIRHRGAIIPRDAMPA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
4 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
5 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
6 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
7 2643221556 Massilia sp. Root1485 Isolate Unclassified
8 2643221684 Massilia sp. Root133 Isolate Unclassified
9 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
10 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
11 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
12 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
13 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
14 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
15 2904699407
16 2906610324
17 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
18 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
19 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
20 2922425934
21 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
22 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
23 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
24 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
25 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
26 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
27 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
28 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
29 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
30 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
54 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
55 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
56 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
57 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
58 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
59 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
60 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
61 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
62 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
63 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
64 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
65 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
66 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
67 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
68 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
69 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
70 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
71 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
72 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
73 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
74 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
75 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
76 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
77 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
78 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
79 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
80 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
81 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
82 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
83 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
84 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
85 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
86 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
87 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
88 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
89 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
90 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
91 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
92 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
93 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
94 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
95 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
96 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
97 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
98 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
99 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
100 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
101 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
102 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
103 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
104 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
105 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
106 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
107 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
108 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
109 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
110 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
111 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
112 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
115 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
116 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
117 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
118 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
119 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
120 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
121 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
122 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
123 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
124 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
125 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
126 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
127 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
128 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
129 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
130 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
131 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
134 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
135 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
136 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
137 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
138 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
139 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
142 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
143 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
144 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
156 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
157 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
158 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
159 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
160 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
161 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
169 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
170 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
171 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.66
Metatranscriptomes 0
Isolates 6.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 3.96
Rhizoplane 3.73
Rhizosphere 85.55
Stem 0
Stem Tuber 0
Unclassified 6.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_987987 2162886007 Bacteria 1592
2 rootH2_10092768 3300003320 Bacteria 2490
3 rootL2_10022850 3300003322 Bacteria 5912
4 rootH1_10009614 3300003323 Bacteria 4865
5 rootH1_10105594 3300003323 Bacteria 5238
6 Ga0070658_10136990 3300005327 Bacteria 2043
7 Ga0070658_10220618 3300005327 Bacteria 1603
8 Ga0070680_100036016 3300005336 Bacteria 3997
9 Ga0070660_100007896 3300005339 Bacteria 7425
10 Ga0070661_100003703 3300005344 Bacteria 10533
11 Ga0070659_100015833 3300005366 Bacteria 5654
12 Ga0070659_100019882 3300005366 Bacteria 5096
13 Ga0070659_100034790 3300005366 Bacteria 3920
14 Ga0070709_10022469 3300005434 Bacteria 3690
15 Ga0070662_100044540 3300005457 Bacteria 3179
16 Ga0070664_100027983 3300005564 Bacteria 4688
17 Ga0068856_100368122 3300005614 Bacteria 1456
18 Ga0105240_10422396 3300009093 Bacteria 1497
19 Ga0105238_10184024 3300009551 Bacteria 2066
20 Ga0105239_10375387 3300010375 Bacteria 1607
21 Ga0157369_10469536 3300013105 Bacteria 1302
22 Ga0209563_100003 3300025230 Bacteria 1932942
23 Ga0209148_1000859 3300025254 Bacteria 21262
24 Ga0207705_10002033 3300025909 Bacteria 15750
25 Ga0207657_10009858 3300025919 Bacteria 9567
26 Ga0207657_10018842 3300025919 Bacteria 6572
27 Ga0207657_10197950 3300025919 Bacteria 1617
28 Ga0207706_10037433 3300025933 Bacteria 4308
29 Ga0207709_10105316 3300025935 Bacteria 1874
30 Ga0207667_10049102 3300025949 Bacteria 4459
31 Ga0207667_10177156 3300025949 Bacteria 2190
32 Ga0207702_10483949 3300026078 Bacteria 1205
33 Ga0207698_10220466 3300026142 Bacteria 1714
34 Ga0209281_1001126 3300027111 Bacteria 19167
35 Ga0307408_100000493 3300031548 Bacteria 34421
36 Ga0307408_100503970 3300031548 Bacteria 1060
37 Ga0307406_10017568 3300031901 Bacteria 4167
38 Ga0315911_1000006 3300033442 Bacteria 414563
39 Ga0395899_0000012 3300037312 Bacteria 517561
40 Ga0395899_0011733 3300037312 Bacteria 6707
41 Ga0395899_0040278 3300037312 Bacteria 3494
42 Ga0395900_0000164 3300037418 Bacteria 108590
43 Ga0395900_0000177 3300037418 Bacteria 102548
44 Ga0395900_0003029 3300037418 Bacteria 18287
45 Ga0395900_0009624 3300037418 Bacteria 9910
46 Ga0395900_0015848 3300037418 Bacteria 7680
47 Ga0395900_0039749 3300037418 Bacteria 4846
48 Ga0395900_0118555 3300037418 Bacteria 2716
49 Ga0395900_0238699 3300037418 Bacteria 1824
50 Ga0395900_0480065 3300037418 Bacteria 1196
51 Ga0395898_0035402 3300037466 Bacteria 4964
52 Ga0395898_0039749 3300037466 Bacteria 4654
53 Ga0395898_0098783 3300037466 Bacteria 2803
54 Ga0395898_0101520 3300037466 Bacteria 2762
55 Ga0395898_0188220 3300037466 Bacteria 1972
56 Ga0395898_0412481 3300037466 Bacteria 1287
57 Ga0395905_0021984 3300037471 Bacteria 6034
58 Ga0395905_0035307 3300037471 Bacteria 4694
59 Ga0395905_0037497 3300037471 Bacteria 4550
60 Ga0395901_0000226 3300038443 Bacteria 70810
61 Ga0395901_0000263 3300038443 Bacteria 65735
62 Ga0395901_0023316 3300038443 Bacteria 6343
63 Ga0395901_0065308 3300038443 Bacteria 3789
64 Ga0395901_0135977 3300038443 Bacteria 2583
65 Ga0395901_0182157 3300038443 Bacteria 2203
66 Ga0439448_0025013 3300042005 Bacteria 1870
67 Ga0439448_0028023 3300042005 Bacteria 1777
68 Ga0439455_0042858 3300042012 Bacteria 1163
69 Ga0450891_001733 3300042129 Bacteria 2245
70 Ga0439458_0006760 3300042157 Bacteria 2554
71 Ga0466969_0029666 3300044656 Bacteria 2792
72 Ga0466965_0000437 3300044683 Bacteria 14508
73 Ga0466965_0018971 3300044683 Bacteria 3300
74 Ga0466966_0012849 3300044684 Bacteria 5544
75 Ga0466966_0087622 3300044684 Bacteria 1934
76 Ga0466961_0045293 3300044693 Bacteria 2814
77 Ga0466961_0156225 3300044693 Bacteria 1423
78 Ga0466963_0180371 3300044694 Bacteria 1474
79 Ga0466964_0021743 3300044706 Bacteria 2482
80 Ga0466964_0025109 3300044706 Bacteria 2325
81 Ga0466968_0001513 3300044735 Bacteria 8331
82 Ga0466970_0133864 3300044765 Bacteria 1363
83 Ga0466957_0000103 3300044842 Bacteria 34469
84 Ga0466957_0008628 3300044842 Bacteria 5801
85 Ga0466957_0053036 3300044842 Bacteria 2471
86 Ga0466957_0066224 3300044842 Bacteria 2226
87 Ga0466957_0089255 3300044842 Bacteria 1929
88 Ga0466959_0037845 3300045049 Bacteria 3565
89 Ga0466959_0112149 3300045049 Bacteria 1945
90 Ga0466958_0007110 3300045836 Bacteria 6130
91 Ga0466958_0024471 3300045836 Bacteria 3553
92 Ga0466967_0014585 3300045976 Bacteria 6128
93 Ga0495617_000001 3300046452 Bacteria 877032
94 Ga0495617_000080 3300046452 Bacteria 74677
95 Ga0495617_019547 3300046452 Bacteria 2291
96 Ga0495627_000213 3300046453 Bacteria 62885
97 Ga0495627_051350 3300046453 Bacteria 1239
98 Ga0495590_0000015 3300046457 Bacteria 241989
99 Ga0495590_0000597 3300046457 Bacteria 16992
100 Ga0495591_000033 3300046458 Bacteria 171402
101 Ga0495638_0004206 3300046460 Bacteria 10956
102 Ga0495653_0006375 3300046463 Bacteria 9673
103 Ga0495653_0040437 3300046463 Bacteria 3644
104 Ga0495650_0004541 3300046471 Bacteria 9480
105 Ga0495580_0035823 3300046472 Bacteria 3567
106 Ga0495582_0149092 3300046473 Bacteria 1327
107 Ga0495605_0000058 3300046474 Bacteria 150303
108 Ga0495605_0000227 3300046474 Bacteria 69646
109 Ga0495605_0005216 3300046474 Bacteria 7575
110 Ga0495605_0008371 3300046474 Bacteria 5850
111 Ga0495605_0017780 3300046474 Bacteria 3821
112 Ga0495605_0025304 3300046474 Bacteria 3094
113 Ga0495584_0000002 3300046491 Bacteria 512179
114 Ga0495584_0000090 3300046491 Bacteria 62655
115 Ga0495584_0000175 3300046491 Bacteria 45105
116 Ga0495584_0000287 3300046491 Bacteria 35639
117 Ga0495584_0001763 3300046491 Bacteria 12604
118 Ga0495584_0004952 3300046491 Bacteria 7099
119 Ga0495584_0006967 3300046491 Bacteria 5904
120 Ga0495584_0033889 3300046491 Bacteria 2584
121 Ga0495584_0037495 3300046491 Bacteria 2450
122 Ga0495584_0051260 3300046491 Bacteria 2078
123 Ga0495585_0000003 3300046492 Bacteria 406344
124 Ga0495585_0000039 3300046492 Bacteria 131202
125 Ga0495585_0000438 3300046492 Bacteria 39870
126 Ga0495585_0002941 3300046492 Bacteria 11784
127 Ga0495585_0003513 3300046492 Bacteria 10571
128 Ga0495585_0007899 3300046492 Bacteria 6469
129 Ga0495585_0014306 3300046492 Bacteria 4625
130 Ga0495585_0020197 3300046492 Bacteria 3832
131 Ga0495585_0028540 3300046492 Bacteria 3182
132 Ga0495585_0106292 3300046492 Bacteria 1496
133 Ga0495594_0022661 3300046499 Bacteria 3359
134 Ga0495594_0045118 3300046499 Bacteria 2419
135 Ga0495594_0090403 3300046499 Bacteria 1715
136 Ga0495594_0096111 3300046499 Bacteria 1664
137 Ga0495596_0000044 3300046500 Bacteria 90299
138 Ga0495596_0002370 3300046500 Bacteria 10186
139 Ga0495596_0005140 3300046500 Bacteria 6230
140 Ga0495596_0009204 3300046500 Bacteria 4354
141 Ga0495596_0010664 3300046500 Bacteria 3993
142 Ga0495596_0011425 3300046500 Bacteria 3833
143 Ga0495596_0011658 3300046500 Bacteria 3783
144 Ga0495607_0000880 3300046501 Bacteria 28001
145 Ga0495607_0003837 3300046501 Bacteria 11339
146 Ga0495607_0005716 3300046501 Bacteria 8856
147 Ga0495607_0015817 3300046501 Bacteria 4881
148 Ga0495607_0031906 3300046501 Bacteria 3221
149 Ga0495607_0053335 3300046501 Bacteria 2337
150 Ga0495583_0000394 3300046506 Bacteria 66597
151 Ga0495583_0000617 3300046506 Bacteria 47939
152 Ga0495583_0000782 3300046506 Bacteria 39742
153 Ga0495583_0002294 3300046506 Bacteria 16694
154 Ga0495583_0011991 3300046506 Bacteria 4938
155 Ga0495583_0027855 3300046506 Bacteria 2784
156 Ga0495583_0027999 3300046506 Bacteria 2776
157 Ga0495583_0053201 3300046506 Bacteria 1838
158 Ga0495583_0133666 3300046506 Bacteria 1036
159 Ga0495606_0010621 3300046507 Bacteria 7619
160 Ga0495606_0010984 3300046507 Bacteria 7439
161 Ga0495606_0015433 3300046507 Bacteria 5884
162 Ga0495606_0018284 3300046507 Bacteria 5263
163 Ga0495606_0025105 3300046507 Bacteria 4276
164 Ga0495606_0046351 3300046507 Bacteria 2874
165 Ga0495606_0066187 3300046507 Bacteria 2293
166 Ga0495606_0173307 3300046507 Bacteria 1250
167 Ga0495606_0241149 3300046507 Bacteria 1008
168 Ga0495610_0016905 3300046512 Bacteria 4179
169 Ga0495616_0000123 3300046513 Bacteria 67114
170 Ga0495616_0000228 3300046513 Bacteria 46105
171 Ga0495616_0000604 3300046513 Bacteria 27112
172 Ga0495616_0003387 3300046513 Bacteria 10222
173 Ga0495616_0006006 3300046513 Bacteria 7401
174 Ga0495616_0006628 3300046513 Bacteria 6994
175 Ga0495616_0040322 3300046513 Bacteria 2386
176 Ga0495616_0129202 3300046513 Bacteria 1159
177 Ga0495620_0009735 3300046515 Bacteria 5101
178 Ga0495630_0018404 3300046517 Bacteria 5132
179 Ga0495631_0003746 3300046518 Bacteria 8280
180 Ga0495631_0004259 3300046518 Bacteria 7649
181 Ga0495631_0005736 3300046518 Bacteria 6476
182 Ga0495631_0006852 3300046518 Bacteria 5846
183 Ga0495631_0013763 3300046518 Bacteria 3920
184 Ga0495631_0082299 3300046518 Bacteria 1388
185 Ga0495631_0086546 3300046518 Bacteria 1349
186 Ga0495632_0000084 3300046519 Bacteria 96469
187 Ga0495632_0000221 3300046519 Bacteria 57926
188 Ga0495632_0000439 3300046519 Bacteria 39649
189 Ga0495632_0004935 3300046519 Bacteria 8940
190 Ga0495632_0031458 3300046519 Bacteria 2743
191 Ga0495637_0000002 3300046520 Bacteria 629280
192 Ga0495637_0026051 3300046520 Bacteria 2630
193 Ga0495643_0006329 3300046522 Bacteria 7823
194 Ga0495643_0011711 3300046522 Bacteria 5325
195 Ga0495643_0011790 3300046522 Bacteria 5302
196 Ga0495643_0030684 3300046522 Bacteria 2999
197 Ga0495644_0005448 3300046523 Bacteria 4972
198 Ga0495644_0013598 3300046523 Bacteria 3122
199 Ga0495644_0037122 3300046523 Bacteria 1838
200 Ga0495648_0000171 3300046524 Bacteria 74494
201 Ga0495648_0000753 3300046524 Bacteria 34596
202 Ga0495648_0010222 3300046524 Bacteria 7168
203 Ga0495648_0025615 3300046524 Bacteria 3989
204 Ga0495648_0059233 3300046524 Bacteria 2286
205 Ga0495648_0083842 3300046524 Bacteria 1805
206 Ga0495663_0031505 3300046525 Bacteria 1576
207 Ga0495666_0006726 3300046526 Bacteria 5781
208 Ga0495642_0000072 3300046528 Bacteria 59857
209 Ga0495642_0001034 3300046528 Bacteria 12922
210 Ga0495642_0001443 3300046528 Bacteria 10641
211 Ga0495642_0002405 3300046528 Bacteria 7621
212 Ga0495642_0002669 3300046528 Bacteria 7171
213 Ga0495642_0002851 3300046528 Bacteria 6897
214 Ga0495642_0017181 3300046528 Bacteria 2825
215 Ga0495642_0093354 3300046528 Bacteria 1275
216 Ga0495654_0059609 3300046530 Bacteria 1837
217 Ga0495640_0193811 3300046533 Bacteria 1291
218 Ga0495587_0002125 3300046536 Bacteria 13244
219 Ga0495587_0075060 3300046536 Bacteria 1963
220 Ga0495609_0000001 3300046538 Bacteria 1060094
221 Ga0495609_0000485 3300046538 Bacteria 31885
222 Ga0495609_0007145 3300046538 Bacteria 5612
223 Ga0495609_0008276 3300046538 Bacteria 5100
224 Ga0495609_0008325 3300046538 Bacteria 5084
225 Ga0495609_0023209 3300046538 Bacteria 2852
226 Ga0495609_0024042 3300046538 Bacteria 2797
227 Ga0495609_0027128 3300046538 Bacteria 2619
228 Ga0495609_0077677 3300046538 Bacteria 1453
229 Ga0495597_0000255 3300046542 Bacteria 48539
230 Ga0495597_0001063 3300046542 Bacteria 20950
231 Ga0495597_0001273 3300046542 Bacteria 18580
232 Ga0495597_0003193 3300046542 Bacteria 9773
233 Ga0495597_0025117 3300046542 Bacteria 2744
234 Ga0495597_0027175 3300046542 Bacteria 2624
235 Ga0495597_0038704 3300046542 Bacteria 2137
236 Ga0495645_0276361 3300046543 Bacteria 1106
237 Ga0495622_0007401 3300046557 Bacteria 5094
238 Ga0495633_0001846 3300046558 Bacteria 15571
239 Ga0495633_0006128 3300046558 Bacteria 7198
240 Ga0495633_0016337 3300046558 Bacteria 3829
241 Ga0495633_0058399 3300046558 Bacteria 1811
242 Ga0495633_0096072 3300046558 Bacteria 1376
243 Ga0495656_0143964 3300046615 Bacteria 1145
244 Ga0495668_0000052 3300046616 Bacteria 212864
245 Ga0495668_0003481 3300046616 Bacteria 11751
246 Ga0495668_0004328 3300046616 Bacteria 10148
247 Ga0495668_0005023 3300046616 Bacteria 9122
248 Ga0495668_0017689 3300046616 Bacteria 4129
249 Ga0495668_0028070 3300046616 Bacteria 3184
250 Ga0495668_0131185 3300046616 Bacteria 1371
251 Ga0495634_0070365 3300046642 Bacteria 2307
252 Ga0495634_0099853 3300046642 Bacteria 1876
253 Ga0495611_0002096 3300046648 Bacteria 9370
254 Ga0495611_0009129 3300046648 Bacteria 4191
255 Ga0495611_0011522 3300046648 Bacteria 3749
256 Ga0495611_0032904 3300046648 Bacteria 2286
257 Ga0495611_0040204 3300046648 Bacteria 2084
258 Ga0495625_0035360 3300046660 Bacteria 3683
259 Ga0495625_0145029 3300046660 Bacteria 1599
260 Ga0495661_0000175 3300046665 Bacteria 73957
261 Ga0495661_0000260 3300046665 Bacteria 60822
262 Ga0495661_0001113 3300046665 Bacteria 23589
263 Ga0495661_0001774 3300046665 Bacteria 17351
264 Ga0495661_0003975 3300046665 Bacteria 10781
265 Ga0495661_0028935 3300046665 Bacteria 3540
266 Ga0495661_0038258 3300046665 Bacteria 2990
267 Ga0495661_0046854 3300046665 Bacteria 2636
268 Ga0495661_0063805 3300046665 Bacteria 2176
269 Ga0495661_0092576 3300046665 Bacteria 1717
270 Ga0495661_0093060 3300046665 Bacteria 1711
271 Ga0495661_0116664 3300046665 Bacteria 1480
272 Ga0495588_0000095 3300046674 Bacteria 175627
273 Ga0495588_0014468 3300046674 Bacteria 3777
274 Ga0495588_0029143 3300046674 Bacteria 2767
275 Ga0495588_0052814 3300046674 Bacteria 2095
276 Ga0495588_0067540 3300046674 Bacteria 1856
277 Ga0495588_0097592 3300046674 Bacteria 1542
278 Ga0495623_0005036 3300046679 Bacteria 8667
279 Ga0495623_0021425 3300046679 Bacteria 4172
280 Ga0495623_0045948 3300046679 Bacteria 2772
281 Ga0495669_0005439 3300046684 Bacteria 5316
282 Ga0495669_0006316 3300046684 Bacteria 4949
283 Ga0495669_0033259 3300046684 Bacteria 2269
284 Ga0495670_0011199 3300046691 Bacteria 4409
285 Ga0495670_0016275 3300046691 Bacteria 3654
286 Ga0495670_0052480 3300046691 Bacteria 2041
287 Ga0495671_0001183 3300046692 Bacteria 17854
288 Ga0495671_0008493 3300046692 Bacteria 5775
289 Ga0495671_0177716 3300046692 Bacteria 1034
290 Ga0495649_0000024 3300046694 Bacteria 175713
291 Ga0495649_0199769 3300046694 Bacteria 1038
292 Ga0495589_0000029 3300046794 Bacteria 173640
293 Ga0495589_0000412 3300046794 Bacteria 32186
294 Ga0495589_0010261 3300046794 Bacteria 4868
295 Ga0495589_0015247 3300046794 Bacteria 3955
296 Ga0495589_0032159 3300046794 Bacteria 2638
297 Ga0495600_0007481 3300046809 Bacteria 6685
298 Ga0495660_0000033 3300046810 Bacteria 212425
299 Ga0495660_0001865 3300046810 Bacteria 13839
300 Ga0495660_0017664 3300046810 Bacteria 4104
301 Ga0495660_0046101 3300046810 Bacteria 2391
302 Ga0495660_0065410 3300046810 Bacteria 1941
303 Ga0495660_0085437 3300046810 Bacteria 1648
304 Ga0495581_0022805 3300047315 Bacteria 3625
305 Ga0495581_0058038 3300047315 Bacteria 2234
306 Ga0495604_0136700 3300047317 Bacteria 1755
307 Ga0495672_0000179 3300047320 Bacteria 91327
308 Ga0495672_0000195 3300047320 Bacteria 86608
309 Ga0495672_0001941 3300047320 Bacteria 19548
310 Ga0495672_0015802 3300047320 Bacteria 5112
311 Ga0495672_0035733 3300047320 Bacteria 3058
312 Ga0495683_0000007 3300047323 Bacteria 268546
313 Ga0495683_0000017 3300047323 Bacteria 189599
314 Ga0495683_0003971 3300047323 Bacteria 8504
315 Ga0495683_0006253 3300047323 Bacteria 6515
316 Ga0495683_0014237 3300047323 Bacteria 4143
317 Ga0495683_0030479 3300047323 Bacteria 2751
318 Ga0495687_000002 3300047443 Bacteria 1085770
319 Ga0495687_000003 3300047443 Bacteria 859509
320 Ga0495687_000092 3300047443 Bacteria 140313
321 Ga0495687_000647 3300047443 Bacteria 39948
322 Ga0495687_001278 3300047443 Bacteria 23689
323 Ga0495675_0026368 3300047444 Bacteria 3705
324 Ga0495675_0059834 3300047444 Bacteria 2415
325 Ga0495675_0105354 3300047444 Bacteria 1762
326 Ga0495677_0000001 3300047445 Bacteria 715000
327 Ga0495677_0000523 3300047445 Bacteria 16038
328 Ga0495677_0000864 3300047445 Bacteria 12246
329 Ga0495677_0002503 3300047445 Bacteria 7195
330 Ga0495677_0004784 3300047445 Bacteria 5159
331 Ga0495677_0025814 3300047445 Bacteria 2131
332 Ga0495677_0028202 3300047445 Bacteria 2038
333 Ga0495677_0032670 3300047445 Bacteria 1895
334 Ga0495677_0134236 3300047445 Bacteria 948
335 Ga0495679_005080 3300047446 Bacteria 5907
336 Ga0495679_009030 3300047446 Bacteria 4015
337 Ga0495681_0000149 3300047470 Bacteria 59126
338 Ga0495681_0001984 3300047470 Bacteria 14940
339 Ga0495681_0004934 3300047470 Bacteria 9006
340 Ga0495681_0005178 3300047470 Bacteria 8774
341 Ga0495681_0011303 3300047470 Bacteria 5326
342 Ga0495681_0039518 3300047470 Bacteria 2303
343 Ga0495681_0043102 3300047470 Bacteria 2178
344 Ga0495681_0055099 3300047470 Bacteria 1855
345 Ga0495686_0000015 3300047472 Bacteria 471703
346 Ga0495686_0000520 3300047472 Bacteria 55657
347 Ga0495686_0007096 3300047472 Bacteria 8445
348 Ga0495593_0005864 3300047673 Bacteria 7239
349 Ga0495593_0023575 3300047673 Bacteria 3419
350 Ga0495593_0163131 3300047673 Bacteria 1125
351 Ga0495602_0037354 3300048088 Bacteria 4509
352 Ga0495615_0056276 3300048090 Bacteria 1026
353 Ga0495626_0000018 3300048091 Bacteria 230153
354 Ga0495626_0000160 3300048091 Bacteria 83120
355 Ga0495626_0012305 3300048091 Bacteria 4490
356 Ga0495626_0016034 3300048091 Bacteria 3818
357 Ga0495626_0022369 3300048091 Bacteria 3124
358 Ga0495626_0025579 3300048091 Bacteria 2886
359 Ga0495626_0029762 3300048091 Bacteria 2639
360 Ga0495626_0049091 3300048091 Bacteria 1955
361 Ga0495626_0127802 3300048091 Bacteria 1087
362 Ga0496100_0024427 3300048903 Bacteria 3686
363 Ga0496102_0000077 3300048905 Bacteria 142501
364 Ga0496102_0019058 3300048905 Bacteria 6039
365 Ga0496103_0002309 3300048906 Bacteria 12053
366 Ga0496106_0005693 3300048909 Bacteria 9215
367 Ga0496107_0069145 3300048910 Bacteria 2563
368 Ga0496109_0057231 3300048912 Bacteria 3558
369 Ga0496110_0000002 3300048913 Bacteria 166613
370 Ga0496110_0012271 3300048913 Bacteria 7041
371 Ga0496111_0014166 3300048914 Bacteria 5440
372 Ga0496112_0268258 3300048915 Bacteria 1655
373 Ga0496112_0569017 3300048915 Bacteria 1066
374 Ga0496113_0002160 3300048916 Bacteria 11355
375 Ga0496113_0013492 3300048916 Bacteria 5540
376 Ga0496113_0119289 3300048916 Bacteria 2061
377 Ga0496117_0020094 3300048920 Bacteria 5459
378 Ga0496122_0000626 3300048925 Bacteria 72235
379 Ga0496122_0003642 3300048925 Bacteria 20025
380 Ga0496122_0064838 3300048925 Bacteria 2654
381 Ga0496123_0001195 3300048926 Bacteria 38153
382 Ga0496124_0006185 3300048927 Bacteria 13118
383 Ga0496124_0026139 3300048927 Bacteria 5270
384 Ga0496124_0029240 3300048927 Bacteria 4914
385 Ga0496124_0051422 3300048927 Bacteria 3506
386 Ga0496124_0058875 3300048927 Bacteria 3229
387 Ga0496124_0114019 3300048927 Bacteria 2171
388 Ga0496125_0000959 3300048928 Bacteria 45332
389 Ga0496125_0083785 3300048928 Bacteria 2424
390 Ga0495678_000048 3300049459 Bacteria 165744
391 Ga0495682_0000136 3300049460 Bacteria 63989
392 Ga0495682_0014567 3300049460 Bacteria 2981
393 Ga0495682_0021559 3300049460 Bacteria 2413
394 Ga0501034_0289339 3300049571 Bacteria 1577
395 Ga0501036_0095234 3300049572 Bacteria 2517
396 Ga0501047_0146503 3300049581 Bacteria 2238
397 Ga0501241_006955 3300049758 Bacteria 2078
398 Ga0501035_0001065 3300049822 Bacteria 28753
399 Ga0501044_0348876 3300049823 Bacteria 1400

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044656 Ga0466969_0029666 Ga0466969_0029666_31_906 277
2 3300044842 Ga0466957_0066224 Ga0466957_0066224_12_887 277
3 3300045049 Ga0466959_0112149 Ga0466959_0112149_23_883 277
4 3300046500 Ga0495596_0010664 Ga0495596_0010664_35_892 277
5 3300046538 Ga0495609_0027128 Ga0495609_0027128_1741_2598 277
6 3300046543 Ga0495645_0276361 Ga0495645_0276361_236_1096 277
7 3300047445 Ga0495677_0134236 Ga0495677_0134236_73_930 277
8 3300048091 Ga0495626_0127802 Ga0495626_0127802_33_902 277
9 3300046457 Ga0495590_0000597 Ga0495590_0000597_8204_9151 279
10 3300046522 Ga0495643_0011711 Ga0495643_0011711_907_1857 285
11 3300046524 Ga0495648_0083842 Ga0495648_0083842_75_1004 285
12 3300046810 Ga0495660_0001865 Ga0495660_0001865_6539_7468 285
13 3300047320 Ga0495672_0000195 Ga0495672_0000195_31898_32827 285
14 3300048091 Ga0495626_0029762 Ga0495626_0029762_556_1497 285
15 iso_pu_bacteria 2513237096 2513657856 286
16 iso_pu_bacteria 2513237137 2513855556 286
17 iso_pu_bacteria 2513237145 2513920051 286
18 iso_pu_bacteria 2517572143 2517892101 286
19 iso_pu_bacteria 2524023228 2524534186 286
20 iso_pu_bacteria 2667528175 2671121861 286
21 iso_pu_bacteria 2791355197 2793068814 286
22 iso_pu_bacteria 2885374607 2885381706 286
23 iso_pu_bacteria 2903748898 2903753483 286
24 iso_pu_bacteria 2904699407 2904702223 286
25 iso_pu_bacteria 2906610324 2906617232 286
26 iso_pu_bacteria 2906635258 2906643379 286
27 iso_pu_bacteria 2906660503 2906662490 286
28 iso_pu_bacteria 2908739725 2908742381 286
29 iso_pu_bacteria 2922425934 2922430597 286
30 iso_pu_bacteria 2935630451 2935631238 286
31 iso_pu_bacteria 2941507105 2941509979 286
32 iso_pu_bacteria 2941515067 2941518934 286
33 iso_pu_bacteria 2941523033 2941525378 286
34 iso_pu_bacteria 3005474847 3005480507 286
35 iso_pu_bacteria 8006933436 8006940270 286
36 iso_pu_bacteria 8006973647 8006980048 286
37 iso_pu_bacteria 8019555841 8019556252 286
38 3300046491 Ga0495584_0004952 Ga0495584_0004952_6186_7079 287
39 3300046507 Ga0495606_0241149 Ga0495606_0241149_96_989 287
40 3300046525 Ga0495663_0031505 Ga0495663_0031505_663_1556 287
41 3300046674 Ga0495588_0000095 Ga0495588_0000095_140892_141830 287
42 3300047673 Ga0495593_0163131 Ga0495593_0163131_20_925 287
43 3300048905 Ga0496102_0019058 Ga0496102_0019058_3232_4161 287
44 3300048906 Ga0496103_0002309 Ga0496103_0002309_6175_7104 287
45 3300049758 Ga0501241_006955 Ga0501241_006955_1069_2031 287
46 3300033442 Ga0315911_1000006 Ga0315911_1000006316 289
47 3300048915 Ga0496112_0569017 Ga0496112_0569017_70_1026 289
48 iso_pu_bacteria 2738541276 2738714599 289
49 3300005434 Ga0070709_10022469 Ga0070709_100224694 290
50 3300047323 Ga0495683_0030479 Ga0495683_0030479_1612_2619 290
51 3300003320 rootH2_10092768 rootH2_100927683 292
52 3300003323 rootH1_10009614 rootH1_100096145 292
53 3300003323 rootH1_10105594 rootH1_101055942 292
54 3300031548 Ga0307408_100000493 Ga0307408_10000049317 292
55 3300031901 Ga0307406_10017568 Ga0307406_100175682 292
56 3300042129 Ga0450891_001733 Ga0450891_001733_38_979 292
57 3300049823 Ga0501044_0348876 Ga0501044_0348876_33_953 292
58 iso_pu_bacteria 2923525760 2923527704 292
59 3300038443 Ga0395901_0065308 Ga0395901_0065308_1740_2675 295
60 3300046491 Ga0495584_0037495 Ga0495584_0037495_834_1772 295
61 3300046492 Ga0495585_0014306 Ga0495585_0014306_1938_2876 295
62 3300046524 Ga0495648_0059233 Ga0495648_0059233_791_1798 295
63 3300046542 Ga0495597_0025117 Ga0495597_0025117_514_1452 295
64 3300046542 Ga0495597_0027175 Ga0495597_0027175_1377_2315 295
65 3300046558 Ga0495633_0096072 Ga0495633_0096072_86_1024 295
66 3300046615 Ga0495656_0143964 Ga0495656_0143964_181_1119 295
67 3300046616 Ga0495668_0004328 Ga0495668_0004328_7461_8399 295
68 3300046691 Ga0495670_0052480 Ga0495670_0052480_767_1705 295
69 3300046794 Ga0495589_0010261 Ga0495589_0010261_2398_3405 295
70 3300047445 Ga0495677_0028202 Ga0495677_0028202_666_1604 295
71 3300047470 Ga0495681_0055099 Ga0495681_0055099_183_1121 295
72 iso_pu_bacteria 2643221556 2643797486 295
73 iso_pu_bacteria 2643221684 2644473972 295
74 iso_pu_bacteria 2808606418 2809143450 295
75 iso_pu_bacteria 2939568625 2939572125 295
76 iso_pu_bacteria 8047673197 8047679598 295
77 3300046471 Ga0495650_0004541 Ga0495650_0004541_778_1737 296
78 3300046491 Ga0495584_0033889 Ga0495584_0033889_726_1646 296
79 3300048091 Ga0495626_0025579 Ga0495626_0025579_1045_1965 296
80 3300037418 Ga0395900_0015848 Ga0395900_0015848_4266_5201 297
81 3300037466 Ga0395898_0412481 Ga0395898_0412481_63_998 297
82 3300037471 Ga0395905_0035307 Ga0395905_0035307_2283_3218 297
83 3300046452 Ga0495617_000080 Ga0495617_000080_34637_35560 297
84 3300046452 Ga0495617_019547 Ga0495617_019547_782_1708 297
85 3300046457 Ga0495590_0000015 Ga0495590_0000015_50622_51548 297
86 3300046458 Ga0495591_000033 Ga0495591_000033_120452_121378 297
87 3300046460 Ga0495638_0004206 Ga0495638_0004206_1865_2788 297
88 3300046463 Ga0495653_0006375 Ga0495653_0006375_8392_9315 297
89 3300046474 Ga0495605_0005216 Ga0495605_0005216_2464_3390 297
90 3300046491 Ga0495584_0000002 Ga0495584_0000002_386547_387470 297
91 3300046491 Ga0495584_0000090 Ga0495584_0000090_14621_15547 297
92 3300046491 Ga0495584_0000175 Ga0495584_0000175_534_1457 297
93 3300046492 Ga0495585_0000003 Ga0495585_0000003_34197_35120 297
94 3300046492 Ga0495585_0000438 Ga0495585_0000438_38890_39813 297
95 3300046492 Ga0495585_0003513 Ga0495585_0003513_2499_3425 297
96 3300046492 Ga0495585_0007899 Ga0495585_0007899_1276_2199 297
97 3300046492 Ga0495585_0020197 Ga0495585_0020197_2839_3762 297
98 3300046492 Ga0495585_0028540 Ga0495585_0028540_1622_2692 297
99 3300046499 Ga0495594_0090403 Ga0495594_0090403_365_1288 297
100 3300046499 Ga0495594_0096111 Ga0495594_0096111_448_1371 297
101 3300046500 Ga0495596_0000044 Ga0495596_0000044_31826_32749 297
102 3300046500 Ga0495596_0002370 Ga0495596_0002370_7693_8619 297
103 3300046500 Ga0495596_0005140 Ga0495596_0005140_4152_5075 297
104 3300046501 Ga0495607_0005716 Ga0495607_0005716_198_1124 297
105 3300046501 Ga0495607_0015817 Ga0495607_0015817_3756_4679 297
106 3300046506 Ga0495583_0002294 Ga0495583_0002294_14587_15513 297
107 3300046506 Ga0495583_0027855 Ga0495583_0027855_1805_2743 297
108 3300046506 Ga0495583_0027999 Ga0495583_0027999_162_1085 297
109 3300046506 Ga0495583_0053201 Ga0495583_0053201_848_1771 297
110 3300046507 Ga0495606_0010621 Ga0495606_0010621_207_1130 297
111 3300046507 Ga0495606_0010984 Ga0495606_0010984_1446_2384 297
112 3300046507 Ga0495606_0025105 Ga0495606_0025105_3130_4200 297
113 3300046507 Ga0495606_0046351 Ga0495606_0046351_1319_2242 297
114 3300046512 Ga0495610_0016905 Ga0495610_0016905_755_1681 297
115 3300046513 Ga0495616_0000228 Ga0495616_0000228_6351_7274 297
116 3300046513 Ga0495616_0003387 Ga0495616_0003387_6577_7503 297
117 3300046513 Ga0495616_0129202 Ga0495616_0129202_114_1037 297
118 3300046515 Ga0495620_0009735 Ga0495620_0009735_1041_2111 297
119 3300046518 Ga0495631_0004259 Ga0495631_0004259_6341_7267 297
120 3300046518 Ga0495631_0013763 Ga0495631_0013763_1139_2062 297
121 3300046518 Ga0495631_0082299 Ga0495631_0082299_389_1318 297
122 3300046520 Ga0495637_0000002 Ga0495637_0000002_325467_326393 297
123 3300046522 Ga0495643_0030684 Ga0495643_0030684_248_1174 297
124 3300046523 Ga0495644_0013598 Ga0495644_0013598_1986_2909 297
125 3300046524 Ga0495648_0000171 Ga0495648_0000171_34452_35375 297
126 3300046528 Ga0495642_0002851 Ga0495642_0002851_1785_2855 297
127 3300046528 Ga0495642_0093354 Ga0495642_0093354_102_1025 297
128 3300046536 Ga0495587_0002125 Ga0495587_0002125_1005_1928 297
129 3300046538 Ga0495609_0007145 Ga0495609_0007145_302_1228 297
130 3300046538 Ga0495609_0077677 Ga0495609_0077677_288_1211 297
131 3300046542 Ga0495597_0001063 Ga0495597_0001063_8132_9094 297
132 3300046557 Ga0495622_0007401 Ga0495622_0007401_205_1128 297
133 3300046558 Ga0495633_0001846 Ga0495633_0001846_13394_14320 297
134 3300046558 Ga0495633_0006128 Ga0495633_0006128_6155_7078 297
135 3300046558 Ga0495633_0016337 Ga0495633_0016337_112_1035 297
136 3300046558 Ga0495633_0058399 Ga0495633_0058399_569_1492 297
137 3300046616 Ga0495668_0003481 Ga0495668_0003481_10367_11290 297
138 3300046642 Ga0495634_0070365 Ga0495634_0070365_983_1906 297
139 3300046648 Ga0495611_0009129 Ga0495611_0009129_2027_2953 297
140 3300046648 Ga0495611_0032904 Ga0495611_0032904_688_1611 297
141 3300046660 Ga0495625_0035360 Ga0495625_0035360_2651_3574 297
142 3300046665 Ga0495661_0093060 Ga0495661_0093060_323_1252 297
143 3300046665 Ga0495661_0116664 Ga0495661_0116664_223_1149 297
144 3300046674 Ga0495588_0029143 Ga0495588_0029143_93_1028 297
145 3300046674 Ga0495588_0067540 Ga0495588_0067540_25_963 297
146 3300046679 Ga0495623_0021425 Ga0495623_0021425_2486_3409 297
147 3300046692 Ga0495671_0177716 Ga0495671_0177716_34_957 297
148 3300046694 Ga0495649_0000024 Ga0495649_0000024_123371_124297 297
149 3300046810 Ga0495660_0065410 Ga0495660_0065410_681_1751 297
150 3300047315 Ga0495581_0022805 Ga0495581_0022805_807_1730 297
151 3300047315 Ga0495581_0058038 Ga0495581_0058038_659_1600 297
152 3300047317 Ga0495604_0136700 Ga0495604_0136700_757_1680 297
153 3300047320 Ga0495672_0000179 Ga0495672_0000179_43140_44066 297
154 3300047323 Ga0495683_0000007 Ga0495683_0000007_223831_224754 297
155 3300047323 Ga0495683_0000017 Ga0495683_0000017_22814_23740 297
156 3300047323 Ga0495683_0003971 Ga0495683_0003971_4229_5152 297
157 3300047444 Ga0495675_0105354 Ga0495675_0105354_764_1687 297
158 3300047445 Ga0495677_0000523 Ga0495677_0000523_12909_13835 297
159 3300047445 Ga0495677_0032670 Ga0495677_0032670_509_1432 297
160 3300047446 Ga0495679_005080 Ga0495679_005080_3861_4787 297
161 3300047470 Ga0495681_0005178 Ga0495681_0005178_317_1240 297
162 3300047470 Ga0495681_0011303 Ga0495681_0011303_3409_4479 297
163 3300047470 Ga0495681_0043102 Ga0495681_0043102_332_1258 297
164 3300047673 Ga0495593_0005864 Ga0495593_0005864_800_1741 297
165 3300047673 Ga0495593_0023575 Ga0495593_0023575_212_1135 297
166 3300048090 Ga0495615_0056276 Ga0495615_0056276_30_953 297
167 3300048909 Ga0496106_0005693 Ga0496106_0005693_2106_3041 297
168 3300049459 Ga0495678_000048 Ga0495678_000048_140239_141165 297
169 3300049460 Ga0495682_0014567 Ga0495682_0014567_555_1478 297
170 3300049460 Ga0495682_0021559 Ga0495682_0021559_671_1597 297
171 3300003322 rootL2_10022850 rootL2_100228505 298
172 3300005327 Ga0070658_10136990 Ga0070658_101369901 298
173 3300005327 Ga0070658_10220618 Ga0070658_102206181 298
174 3300005336 Ga0070680_100036016 Ga0070680_1000360162 298
175 3300005339 Ga0070660_100007896 Ga0070660_1000078961 298
176 3300005344 Ga0070661_100003703 Ga0070661_1000037034 298
177 3300005366 Ga0070659_100019882 Ga0070659_1000198822 298
178 3300005366 Ga0070659_100034790 Ga0070659_1000347903 298
179 3300005457 Ga0070662_100044540 Ga0070662_1000445401 298
180 3300005564 Ga0070664_100027983 Ga0070664_1000279832 298
181 3300005614 Ga0068856_100368122 Ga0068856_1003681222 298
182 3300009093 Ga0105240_10422396 Ga0105240_104223962 298
183 3300009551 Ga0105238_10184024 Ga0105238_101840242 298
184 3300010375 Ga0105239_10375387 Ga0105239_103753872 298
185 3300013105 Ga0157369_10469536 Ga0157369_104695362 298
186 3300025230 Ga0209563_100003 Ga0209563_1000031347 298
187 3300025254 Ga0209148_1000859 Ga0209148_100085911 298
188 3300025909 Ga0207705_10002033 Ga0207705_100020339 298
189 3300025919 Ga0207657_10009858 Ga0207657_100098585 298
190 3300025919 Ga0207657_10018842 Ga0207657_100188424 298
191 3300025919 Ga0207657_10197950 Ga0207657_101979501 298
192 3300025933 Ga0207706_10037433 Ga0207706_100374335 298
193 3300025935 Ga0207709_10105316 Ga0207709_101053162 298
194 3300025949 Ga0207667_10049102 Ga0207667_100491022 298
195 3300025949 Ga0207667_10177156 Ga0207667_101771562 298
196 3300026078 Ga0207702_10483949 Ga0207702_104839492 298
197 3300026142 Ga0207698_10220466 Ga0207698_102204662 298
198 3300031548 Ga0307408_100503970 Ga0307408_1005039701 298
199 3300037312 Ga0395899_0000012 Ga0395899_0000012_190067_191062 298
200 3300037312 Ga0395899_0011733 Ga0395899_0011733_4580_5518 298
201 3300037312 Ga0395899_0040278 Ga0395899_0040278_2368_3300 298
202 3300037418 Ga0395900_0000164 Ga0395900_0000164_74154_75092 298
203 3300037418 Ga0395900_0000177 Ga0395900_0000177_63390_64322 298
204 3300037418 Ga0395900_0003029 Ga0395900_0003029_14557_15495 298
205 3300037418 Ga0395900_0009624 Ga0395900_0009624_4545_5477 298
206 3300037418 Ga0395900_0039749 Ga0395900_0039749_896_1834 298
207 3300037418 Ga0395900_0118555 Ga0395900_0118555_692_1639 298
208 3300037418 Ga0395900_0238699 Ga0395900_0238699_589_1548 298
209 3300037418 Ga0395900_0480065 Ga0395900_0480065_111_1052 298
210 3300037466 Ga0395898_0035402 Ga0395898_0035402_1825_2757 298
211 3300037466 Ga0395898_0039749 Ga0395898_0039749_361_1293 298
212 3300037466 Ga0395898_0098783 Ga0395898_0098783_962_1900 298
213 3300037466 Ga0395898_0101520 Ga0395898_0101520_1247_2179 298
214 3300037466 Ga0395898_0188220 Ga0395898_0188220_737_1696 298
215 3300037471 Ga0395905_0021984 Ga0395905_0021984_2717_3649 298
216 3300037471 Ga0395905_0037497 Ga0395905_0037497_2138_3097 298
217 3300038443 Ga0395901_0000226 Ga0395901_0000226_39817_40755 298
218 3300038443 Ga0395901_0000263 Ga0395901_0000263_38492_39424 298
219 3300038443 Ga0395901_0023316 Ga0395901_0023316_4985_5917 298
220 3300038443 Ga0395901_0135977 Ga0395901_0135977_1158_2090 298
221 3300038443 Ga0395901_0182157 Ga0395901_0182157_1042_1980 298
222 3300042005 Ga0439448_0025013 Ga0439448_0025013_790_1728 298
223 3300042005 Ga0439448_0028023 Ga0439448_0028023_430_1377 298
224 3300042012 Ga0439455_0042858 Ga0439455_0042858_79_1017 298
225 3300042157 Ga0439458_0006760 Ga0439458_0006760_184_1116 298
226 3300044683 Ga0466965_0000437 Ga0466965_0000437_3304_4236 298
227 3300044683 Ga0466965_0018971 Ga0466965_0018971_1476_2423 298
228 3300044684 Ga0466966_0012849 Ga0466966_0012849_622_1554 298
229 3300044684 Ga0466966_0087622 Ga0466966_0087622_92_1030 298
230 3300044693 Ga0466961_0045293 Ga0466961_0045293_1559_2497 298
231 3300044693 Ga0466961_0156225 Ga0466961_0156225_63_1004 298
232 3300044694 Ga0466963_0180371 Ga0466963_0180371_317_1255 298
233 3300044706 Ga0466964_0021743 Ga0466964_0021743_1383_2315 298
234 3300044706 Ga0466964_0025109 Ga0466964_0025109_1133_2071 298
235 3300044735 Ga0466968_0001513 Ga0466968_0001513_1545_2477 298
236 3300044765 Ga0466970_0133864 Ga0466970_0133864_66_1013 298
237 3300044842 Ga0466957_0000103 Ga0466957_0000103_1636_2577 298
238 3300044842 Ga0466957_0008628 Ga0466957_0008628_635_1588 298
239 3300044842 Ga0466957_0053036 Ga0466957_0053036_986_1918 298
240 3300044842 Ga0466957_0089255 Ga0466957_0089255_826_1758 298
241 3300045049 Ga0466959_0037845 Ga0466959_0037845_2374_3312 298
242 3300045836 Ga0466958_0007110 Ga0466958_0007110_3984_4916 298
243 3300045836 Ga0466958_0024471 Ga0466958_0024471_783_1730 298
244 3300045976 Ga0466967_0014585 Ga0466967_0014585_4346_5281 298
245 3300046452 Ga0495617_000001 Ga0495617_000001_202113_203042 298
246 3300046453 Ga0495627_000213 Ga0495627_000213_11033_11962 298
247 3300046453 Ga0495627_051350 Ga0495627_051350_118_1047 298
248 3300046463 Ga0495653_0040437 Ga0495653_0040437_460_1401 298
249 3300046472 Ga0495580_0035823 Ga0495580_0035823_237_1184 298
250 3300046473 Ga0495582_0149092 Ga0495582_0149092_52_999 298
251 3300046474 Ga0495605_0000058 Ga0495605_0000058_147214_148143 298
252 3300046474 Ga0495605_0000227 Ga0495605_0000227_31024_31971 298
253 3300046474 Ga0495605_0008371 Ga0495605_0008371_4809_5738 298
254 3300046474 Ga0495605_0017780 Ga0495605_0017780_1876_2823 298
255 3300046474 Ga0495605_0025304 Ga0495605_0025304_1679_2638 298
256 3300046491 Ga0495584_0000287 Ga0495584_0000287_6110_7048 298
257 3300046491 Ga0495584_0001763 Ga0495584_0001763_4719_5660 298
258 3300046491 Ga0495584_0006967 Ga0495584_0006967_775_1704 298
259 3300046491 Ga0495584_0051260 Ga0495584_0051260_1106_2053 298
260 3300046492 Ga0495585_0000039 Ga0495585_0000039_103615_104658 298
261 3300046492 Ga0495585_0002941 Ga0495585_0002941_4885_5814 298
262 3300046492 Ga0495585_0106292 Ga0495585_0106292_26_973 298
263 3300046499 Ga0495594_0022661 Ga0495594_0022661_2333_3262 298
264 3300046499 Ga0495594_0045118 Ga0495594_0045118_1444_2403 298
265 3300046500 Ga0495596_0009204 Ga0495596_0009204_2388_3317 298
266 3300046500 Ga0495596_0011425 Ga0495596_0011425_1180_2109 298
267 3300046500 Ga0495596_0011658 Ga0495596_0011658_253_1182 298
268 3300046501 Ga0495607_0000880 Ga0495607_0000880_23645_24583 298
269 3300046501 Ga0495607_0003837 Ga0495607_0003837_223_1170 298
270 3300046501 Ga0495607_0031906 Ga0495607_0031906_2051_2998 298
271 3300046501 Ga0495607_0053335 Ga0495607_0053335_1116_2045 298
272 3300046506 Ga0495583_0000394 Ga0495583_0000394_22476_23405 298
273 3300046506 Ga0495583_0000617 Ga0495583_0000617_4006_4935 298
274 3300046506 Ga0495583_0000782 Ga0495583_0000782_8596_9543 298
275 3300046506 Ga0495583_0011991 Ga0495583_0011991_1344_2273 298
276 3300046506 Ga0495583_0133666 Ga0495583_0133666_67_996 298
277 3300046507 Ga0495606_0015433 Ga0495606_0015433_2581_3519 298
278 3300046507 Ga0495606_0018284 Ga0495606_0018284_3323_4270 298
279 3300046507 Ga0495606_0066187 Ga0495606_0066187_334_1263 298
280 3300046507 Ga0495606_0173307 Ga0495606_0173307_291_1238 298
281 3300046513 Ga0495616_0000123 Ga0495616_0000123_42279_43238 298
282 3300046513 Ga0495616_0000604 Ga0495616_0000604_19386_20324 298
283 3300046513 Ga0495616_0006006 Ga0495616_0006006_5928_6881 298
284 3300046513 Ga0495616_0006628 Ga0495616_0006628_445_1374 298
285 3300046513 Ga0495616_0040322 Ga0495616_0040322_1207_2136 298
286 3300046517 Ga0495630_0018404 Ga0495630_0018404_4117_5064 298
287 3300046518 Ga0495631_0003746 Ga0495631_0003746_1199_2146 298
288 3300046518 Ga0495631_0005736 Ga0495631_0005736_1232_2191 298
289 3300046518 Ga0495631_0006852 Ga0495631_0006852_3474_4403 298
290 3300046518 Ga0495631_0086546 Ga0495631_0086546_208_1137 298
291 3300046519 Ga0495632_0000084 Ga0495632_0000084_57357_58286 298
292 3300046519 Ga0495632_0000221 Ga0495632_0000221_42385_43311 298
293 3300046519 Ga0495632_0000439 Ga0495632_0000439_16873_17832 298
294 3300046519 Ga0495632_0004935 Ga0495632_0004935_7298_8251 298
295 3300046519 Ga0495632_0031458 Ga0495632_0031458_778_1725 298
296 3300046520 Ga0495637_0026051 Ga0495637_0026051_488_1429 298
297 3300046522 Ga0495643_0006329 Ga0495643_0006329_4491_5438 298
298 3300046522 Ga0495643_0011790 Ga0495643_0011790_3717_4658 298
299 3300046523 Ga0495644_0005448 Ga0495644_0005448_2756_3697 298
300 3300046523 Ga0495644_0037122 Ga0495644_0037122_251_1198 298
301 3300046524 Ga0495648_0000753 Ga0495648_0000753_12507_13436 298
302 3300046524 Ga0495648_0010222 Ga0495648_0010222_1687_2616 298
303 3300046524 Ga0495648_0025615 Ga0495648_0025615_1280_2221 298
304 3300046526 Ga0495666_0006726 Ga0495666_0006726_3782_4729 298
305 3300046528 Ga0495642_0000072 Ga0495642_0000072_22478_23416 298
306 3300046528 Ga0495642_0001034 Ga0495642_0001034_1342_2271 298
307 3300046528 Ga0495642_0001443 Ga0495642_0001443_1172_2131 298
308 3300046528 Ga0495642_0002405 Ga0495642_0002405_5858_6787 298
309 3300046528 Ga0495642_0002669 Ga0495642_0002669_3629_4567 298
310 3300046528 Ga0495642_0017181 Ga0495642_0017181_1041_1988 298
311 3300046530 Ga0495654_0059609 Ga0495654_0059609_372_1301 298
312 3300046533 Ga0495640_0193811 Ga0495640_0193811_98_1045 298
313 3300046536 Ga0495587_0075060 Ga0495587_0075060_64_1011 298
314 3300046538 Ga0495609_0000001 Ga0495609_0000001_782990_783928 298
315 3300046538 Ga0495609_0000485 Ga0495609_0000485_28182_29177 298
316 3300046538 Ga0495609_0008276 Ga0495609_0008276_3210_4139 298
317 3300046538 Ga0495609_0008325 Ga0495609_0008325_3429_4358 298
318 3300046538 Ga0495609_0023209 Ga0495609_0023209_97_1038 298
319 3300046538 Ga0495609_0024042 Ga0495609_0024042_1242_2201 298
320 3300046542 Ga0495597_0000255 Ga0495597_0000255_21376_22305 298
321 3300046542 Ga0495597_0001273 Ga0495597_0001273_4268_5200 298
322 3300046542 Ga0495597_0003193 Ga0495597_0003193_4836_5765 298
323 3300046542 Ga0495597_0038704 Ga0495597_0038704_192_1139 298
324 3300046616 Ga0495668_0000052 Ga0495668_0000052_4512_5441 298
325 3300046616 Ga0495668_0005023 Ga0495668_0005023_5399_6328 298
326 3300046616 Ga0495668_0017689 Ga0495668_0017689_2242_3183 298
327 3300046616 Ga0495668_0028070 Ga0495668_0028070_912_1841 298
328 3300046616 Ga0495668_0131185 Ga0495668_0131185_125_1054 298
329 3300046642 Ga0495634_0099853 Ga0495634_0099853_162_1109 298
330 3300046648 Ga0495611_0002096 Ga0495611_0002096_1545_2474 298
331 3300046648 Ga0495611_0011522 Ga0495611_0011522_75_1022 298
332 3300046648 Ga0495611_0040204 Ga0495611_0040204_160_1089 298
333 3300046660 Ga0495625_0145029 Ga0495625_0145029_456_1385 298
334 3300046665 Ga0495661_0000175 Ga0495661_0000175_31331_32260 298
335 3300046665 Ga0495661_0000260 Ga0495661_0000260_27504_28442 298
336 3300046665 Ga0495661_0001113 Ga0495661_0001113_3070_4017 298
337 3300046665 Ga0495661_0001774 Ga0495661_0001774_1832_2785 298
338 3300046665 Ga0495661_0003975 Ga0495661_0003975_267_1196 298
339 3300046665 Ga0495661_0028935 Ga0495661_0028935_208_1155 298
340 3300046665 Ga0495661_0038258 Ga0495661_0038258_1981_2907 298
341 3300046665 Ga0495661_0046854 Ga0495661_0046854_116_1045 298
342 3300046665 Ga0495661_0063805 Ga0495661_0063805_26_973 298
343 3300046665 Ga0495661_0092576 Ga0495661_0092576_260_1189 298
344 3300046674 Ga0495588_0014468 Ga0495588_0014468_1133_2092 298
345 3300046674 Ga0495588_0052814 Ga0495588_0052814_746_1675 298
346 3300046674 Ga0495588_0097592 Ga0495588_0097592_566_1495 298
347 3300046679 Ga0495623_0005036 Ga0495623_0005036_1894_2841 298
348 3300046679 Ga0495623_0045948 Ga0495623_0045948_147_1091 298
349 3300046684 Ga0495669_0005439 Ga0495669_0005439_2405_3334 298
350 3300046684 Ga0495669_0006316 Ga0495669_0006316_2910_3869 298
351 3300046684 Ga0495669_0033259 Ga0495669_0033259_357_1298 298
352 3300046691 Ga0495670_0011199 Ga0495670_0011199_2281_3210 298
353 3300046691 Ga0495670_0016275 Ga0495670_0016275_42_989 298
354 3300046692 Ga0495671_0001183 Ga0495671_0001183_11020_11949 298
355 3300046692 Ga0495671_0008493 Ga0495671_0008493_2593_3522 298
356 3300046694 Ga0495649_0199769 Ga0495649_0199769_72_1004 298
357 3300046794 Ga0495589_0000029 Ga0495589_0000029_33281_34219 298
358 3300046794 Ga0495589_0000412 Ga0495589_0000412_14888_15835 298
359 3300046794 Ga0495589_0015247 Ga0495589_0015247_1140_2138 298
360 3300046794 Ga0495589_0032159 Ga0495589_0032159_1104_2045 298
361 3300046809 Ga0495600_0007481 Ga0495600_0007481_1597_2544 298
362 3300046810 Ga0495660_0000033 Ga0495660_0000033_195098_196045 298
363 3300046810 Ga0495660_0017664 Ga0495660_0017664_1154_2083 298
364 3300046810 Ga0495660_0046101 Ga0495660_0046101_1414_2343 298
365 3300046810 Ga0495660_0085437 Ga0495660_0085437_86_1033 298
366 3300047320 Ga0495672_0001941 Ga0495672_0001941_3994_4989 298
367 3300047320 Ga0495672_0015802 Ga0495672_0015802_1292_2233 298
368 3300047320 Ga0495672_0035733 Ga0495672_0035733_1390_2319 298
369 3300047323 Ga0495683_0006253 Ga0495683_0006253_328_1275 298
370 3300047323 Ga0495683_0014237 Ga0495683_0014237_2948_3877 298
371 3300047443 Ga0495687_000002 Ga0495687_000002_78929_79858 298
372 3300047443 Ga0495687_000003 Ga0495687_000003_716873_717811 298
373 3300047443 Ga0495687_000092 Ga0495687_000092_3940_4878 298
374 3300047443 Ga0495687_000647 Ga0495687_000647_3058_4005 298
375 3300047443 Ga0495687_001278 Ga0495687_001278_15056_15985 298
376 3300047444 Ga0495675_0026368 Ga0495675_0026368_2715_3662 298
377 3300047444 Ga0495675_0059834 Ga0495675_0059834_665_1606 298
378 3300047445 Ga0495677_0000001 Ga0495677_0000001_441343_442281 298
379 3300047445 Ga0495677_0000864 Ga0495677_0000864_8180_9127 298
380 3300047445 Ga0495677_0002503 Ga0495677_0002503_4992_5939 298
381 3300047445 Ga0495677_0004784 Ga0495677_0004784_2478_3416 298
382 3300047445 Ga0495677_0025814 Ga0495677_0025814_655_1584 298
383 3300047446 Ga0495679_009030 Ga0495679_009030_1088_2035 298
384 3300047470 Ga0495681_0000149 Ga0495681_0000149_33059_33988 298
385 3300047470 Ga0495681_0001984 Ga0495681_0001984_19_948 298
386 3300047470 Ga0495681_0004934 Ga0495681_0004934_7991_8938 298
387 3300047470 Ga0495681_0039518 Ga0495681_0039518_523_1452 298
388 3300047472 Ga0495686_0000015 Ga0495686_0000015_382515_383447 298
389 3300047472 Ga0495686_0000520 Ga0495686_0000520_32693_33646 298
390 3300047472 Ga0495686_0007096 Ga0495686_0007096_6588_7517 298
391 3300048088 Ga0495602_0037354 Ga0495602_0037354_2394_3341 298
392 3300048091 Ga0495626_0000018 Ga0495626_0000018_31209_32159 298
393 3300048091 Ga0495626_0000160 Ga0495626_0000160_65956_66903 298
394 3300048091 Ga0495626_0012305 Ga0495626_0012305_850_1782 298
395 3300048091 Ga0495626_0016034 Ga0495626_0016034_2299_3228 298
396 3300048091 Ga0495626_0022369 Ga0495626_0022369_155_1084 298
397 3300048091 Ga0495626_0049091 Ga0495626_0049091_391_1338 298
398 3300048903 Ga0496100_0024427 Ga0496100_0024427_200_1129 298
399 3300048905 Ga0496102_0000077 Ga0496102_0000077_26190_27119 298
400 3300048910 Ga0496107_0069145 Ga0496107_0069145_546_1475 298
401 3300048912 Ga0496109_0057231 Ga0496109_0057231_2166_3095 298
402 3300048913 Ga0496110_0000002 Ga0496110_0000002_129656_130585 298
403 3300048913 Ga0496110_0012271 Ga0496110_0012271_1139_2068 298
404 3300048914 Ga0496111_0014166 Ga0496111_0014166_16_945 298
405 3300048915 Ga0496112_0268258 Ga0496112_0268258_474_1403 298
406 3300048916 Ga0496113_0002160 Ga0496113_0002160_8346_9275 298
407 3300048916 Ga0496113_0013492 Ga0496113_0013492_3350_4288 298
408 3300048916 Ga0496113_0119289 Ga0496113_0119289_435_1385 298
409 3300048925 Ga0496122_0000626 Ga0496122_0000626_32847_33776 298
410 3300048925 Ga0496122_0003642 Ga0496122_0003642_2408_3346 298
411 3300048925 Ga0496122_0064838 Ga0496122_0064838_1276_2223 298
412 3300048926 Ga0496123_0001195 Ga0496123_0001195_4603_5532 298
413 3300048927 Ga0496124_0006185 Ga0496124_0006185_9347_10285 298
414 3300048927 Ga0496124_0026139 Ga0496124_0026139_841_1788 298
415 3300048927 Ga0496124_0029240 Ga0496124_0029240_2427_3356 298
416 3300048927 Ga0496124_0051422 Ga0496124_0051422_2308_3258 298
417 3300048927 Ga0496124_0058875 Ga0496124_0058875_373_1305 298
418 3300048927 Ga0496124_0114019 Ga0496124_0114019_34_972 298
419 3300048928 Ga0496125_0000959 Ga0496125_0000959_42225_43154 298
420 3300048928 Ga0496125_0083785 Ga0496125_0083785_416_1354 298
421 3300049460 Ga0495682_0000136 Ga0495682_0000136_52531_53460 298
422 3300049571 Ga0501034_0289339 Ga0501034_0289339_528_1475 298
423 3300049572 Ga0501036_0095234 Ga0501036_0095234_774_1724 298
424 3300049581 Ga0501047_0146503 Ga0501047_0146503_1253_2191 298
425 3300049822 Ga0501035_0001065 Ga0501035_0001065_16116_17054 298
426 2162886007 SwRhRL2b_contig_987987 SwRhRL2b_0624.00003490 299
427 3300005366 Ga0070659_100015833 Ga0070659_1000158332 299
428 3300027111 Ga0209281_1001126 Ga0209281_10011262 299
429 3300048920 Ga0496117_0020094 Ga0496117_0020094_2709_3644 299

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00294

PfkB

pfkB family carbohydrate kinase

52

354

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8iwl-assembly1.cif.gz_B a.baumannii uncharacterized sugar kinase ydjh 0.9701 3 299
8iwl-assembly1.cif.gz_A a.baumannii uncharacterized sugar kinase ydjh 0.9682 6 298
3lhx-assembly1.cif.gz_A crystal structure of a ketodeoxygluconokinase (kdgk) from shigella flexneri 0.9656 2 298
8iwl-assembly1.cif.gz_B a.baumannii uncharacterized sugar kinase ydjh 0.9605 3 299
3lhx-assembly1.cif.gz_A crystal structure of a ketodeoxygluconokinase (kdgk) from shigella flexneri 0.956 2 298
ID Description Score Start End Superfamily
3lhxB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9435 2 296 3.40.1190.20
3lhxB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9371 2 296 3.40.1190.20
4eumA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.904 2 286 3.40.1190.20
4du5C00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8678 1 295 3.40.1190.20
4eumA00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8627 2 286 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A659S5G4-F1-model_v4 Ketodeoxygluconokinase 0.9976 1 212 GO:0005829
GO:0006974
GO:0008673
GO:0019698
GO:0042840
AF-A0A447N253-F1-model_v4 2-dehydro-3-deoxygluconokinase (EC 2.7.1.92) 0.9974 80 228 GO:0005829
GO:0006974
GO:0008673
GO:0019698
GO:0042840
GO:0047590
AF-A0A358L9A9-F1-model_v4 Ketodeoxygluconokinase 0.9953 2 133 GO:0016301
AF-A0A659S5G4-F1-model_v4 Ketodeoxygluconokinase 0.9882 1 212 GO:0005829
GO:0006974
GO:0008673
GO:0019698
GO:0042840
AF-A0A4Q3KCD4-F1-model_v4 deleted 0.9852 2 238

Feature Viewer

pLDDT pTM Quality
94.29 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map