F441684

General Info

Members Datasets Scaffolds Average Seq Length
428 214 424 356

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10068437|Ga0157379_100684373
Length 415
Sequence LLDESAFRFLARSTYRPLAAPNHSLVIYLFPMAENSHEKTLAALGVTQSEQVAPLFAQLLAQAASDLQAVHSADAFEKFRVQWLGRKAGVLTLVGDNWLKPASKELKPSVGQELNKFKAQLEAQIEAGRASIESGAEEAVSAKDRVDLSLPGVVRPIGSRHLIRQVFQEIEDIFVSIGFSVVEGPEIETPYYNFEALNIPEFHPVRDDMDTFYVEAHLGATTGSGVKTPPGSLLLRTHTSPVQIRTMEKQKPPVRVIVPGKVYRRDNPDATHSFMFHQIEGLAVDTDITFCDFTGTIEYFVKQYFGPSVKTRFRPSYFPFTEPSVEFDVSCIFCDGSGVVANGATCGKCKGSQWIELFGAGMVDPAVYGFVNYDAKKLSGFAFGMGMDRLAMLKYGIDDIQAFFQNDVRFLRQFP

Samples

Sample ID Description Type Environment
1 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
2 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
3 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
4 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
5 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
70 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
108 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
109 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
113 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
114 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
115 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
117 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
118 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
119 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
133 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
147 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
162 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
167 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
175 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
190 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
209 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
210 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
213 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.66
Metatranscriptomes 1.4
Isolates 0.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0.93
Rhizoplane 10.28
Rhizosphere 88.08
Stem 0
Stem Tuber 0
Unclassified 0.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1001670 3300001977 Bacteria 3553
2 JGI25406J46586_10027571 3300003203 Bacteria 2176
3 Ga0070680_100051908 3300005336 Bacteria 3347
4 Ga0070680_100072963 3300005336 Bacteria 2822
5 Ga0070682_100000030 3300005337 Bacteria 182768
6 Ga0070682_100095133 3300005337 Bacteria 1955
7 Ga0068868_100000445 3300005338 Bacteria 27750
8 Ga0070691_10000007 3300005341 Bacteria 64190
9 Ga0070674_100000004 3300005356 Bacteria 169446
10 Ga0070673_100001047 3300005364 Bacteria 15704
11 Ga0070659_100247717 3300005366 Bacteria 1476
12 Ga0070703_10000381 3300005406 Bacteria 18826
13 Ga0070709_10000044 3300005434 Bacteria 101838
14 Ga0070709_10026299 3300005434 Unclassified 3448
15 Ga0070713_100267256 3300005436 Unclassified 1565
16 Ga0070711_100000002 3300005439 Bacteria 263148
17 Ga0070711_100005455 3300005439 Bacteria 7607
18 Ga0070711_100010196 3300005439 Bacteria 5809
19 Ga0070711_100011904 3300005439 Bacteria 5413
20 Ga0070705_100000223 3300005440 Bacteria 33633
21 Ga0070705_100044312 3300005440 Bacteria 2555
22 Ga0070694_100000592 3300005444 Bacteria 19999
23 Ga0070708_100013070 3300005445 Bacteria 6788
24 Ga0070708_100016691 3300005445 Bacteria 6100
25 Ga0070708_100196315 3300005445 Bacteria 1888
26 Ga0070708_100211664 3300005445 Bacteria 1816
27 Ga0070662_100000006 3300005457 Bacteria 169366
28 Ga0070681_10068664 3300005458 Bacteria 3511
29 Ga0068867_100009392 3300005459 Bacteria 6900
30 Ga0070706_100001341 3300005467 Bacteria 26184
31 Ga0070706_100009017 3300005467 Bacteria 9288
32 Ga0070706_100037688 3300005467 Bacteria 4464
33 Ga0070706_100248337 3300005467 Bacteria 1661
34 Ga0070707_100001601 3300005468 Bacteria 21935
35 Ga0070707_100016320 3300005468 Bacteria 6970
36 Ga0070707_100172452 3300005468 Bacteria 2108
37 Ga0070707_100464182 3300005468 Bacteria 1227
38 Ga0070698_100017439 3300005471 Bacteria 7568
39 Ga0070698_100029091 3300005471 Bacteria 5733
40 Ga0070698_100045345 3300005471 Bacteria 4500
41 Ga0070698_100097308 3300005471 Bacteria 2919
42 Ga0070699_100000065 3300005518 Bacteria 99352
43 Ga0070699_100034806 3300005518 Bacteria 4352
44 Ga0070699_100050957 3300005518 Bacteria 3584
45 Ga0070699_100058694 3300005518 Bacteria 3333
46 Ga0070699_100248019 3300005518 Unclassified 1590
47 Ga0070679_100000225 3300005530 Bacteria 46317
48 Ga0070679_100009748 3300005530 Bacteria 9085
49 Ga0070697_100001398 3300005536 Bacteria 18286
50 Ga0070697_100013189 3300005536 Bacteria 6480
51 Ga0070697_100014109 3300005536 Bacteria 6275
52 Ga0070697_100130121 3300005536 Bacteria 2110
53 Ga0070696_100005726 3300005546 Bacteria 8296
54 Ga0070696_100008340 3300005546 Bacteria 6930
55 Ga0070693_100001103 3300005547 Bacteria 12122
56 Ga0070693_100002189 3300005547 Bacteria 8956
57 Ga0070665_100060784 3300005548 Bacteria 3787
58 Ga0070665_100292043 3300005548 Bacteria 1632
59 Ga0070704_100000639 3300005549 Bacteria 16924
60 Ga0070704_100031868 3300005549 Unclassified 3550
61 Ga0070704_100241171 3300005549 Bacteria 1479
62 Ga0068864_100288673 3300005618 Bacteria 1533
63 Ga0068866_10000004 3300005718 Bacteria 202810
64 Ga0068863_100000107 3300005841 Bacteria 88879
65 Ga0068863_100043020 3300005841 Bacteria 4289
66 Ga0068858_100052062 3300005842 Bacteria 3788
67 Ga0068860_100007125 3300005843 Bacteria 11188
68 Ga0068860_100014869 3300005843 Bacteria 7611
69 Ga0068860_100087175 3300005843 Bacteria 2972
70 Ga0081539_10006125 3300005985 Bacteria 11721
71 Ga0070717_10053275 3300006028 Bacteria 3334
72 Ga0070715_10000014 3300006163 Bacteria 154272
73 Ga0070716_100002956 3300006173 Bacteria 7921
74 Ga0070716_100006708 3300006173 Bacteria 5638
75 Ga0070716_100008707 3300006173 Bacteria 5040
76 Ga0070716_100017824 3300006173 Bacteria 3689
77 Ga0070712_100009383 3300006175 Bacteria 6164
78 Ga0070712_100045166 3300006175 Unclassified 3041
79 Ga0070712_100197269 3300006175 Bacteria 1579
80 Ga0097621_100102729 3300006237 Bacteria 2407
81 Ga0097621_100180327 3300006237 Bacteria 1825
82 Ga0068871_100005275 3300006358 Bacteria 9047
83 Ga0075428_100004116 3300006844 Bacteria 16010
84 Ga0075433_10000131 3300006852 Bacteria 38577
85 Ga0075434_100049612 3300006871 Bacteria 4168
86 Ga0075434_100062036 3300006871 Bacteria 3720
87 Ga0075434_100066992 3300006871 Bacteria 3578
88 Ga0075436_100002991 3300006914 Bacteria 11574
89 Ga0075436_100003784 3300006914 Bacteria 10373
90 Ga0075436_100008922 3300006914 Bacteria 6864
91 Ga0075436_100053100 3300006914 Bacteria 2797
92 Ga0075435_100041938 3300007076 Bacteria 3659
93 Ga0075435_100073067 3300007076 Bacteria 2803
94 Ga0099794_10012817 3300007265 Bacteria 3632
95 Ga0099794_10025504 3300007265 Bacteria 2724
96 Ga0099794_10123749 3300007265 Bacteria 1303
97 Ga0105240_10031468 3300009093 Bacteria 6881
98 Ga0111539_10102925 3300009094 Bacteria 3351
99 Ga0105245_10000143 3300009098 Bacteria 67618
100 Ga0105245_10138807 3300009098 Bacteria 2287
101 Ga0105247_10001425 3300009101 Bacteria 17357
102 Ga0114129_10006288 3300009147 Bacteria 16839
103 Ga0105242_10003557 3300009176 Bacteria 12117
104 Ga0105242_10005910 3300009176 Bacteria 9436
105 Ga0105248_10053989 3300009177 Bacteria 4507
106 Ga0105238_10000048 3300009551 Bacteria 146322
107 Ga0105249_10000070 3300009553 Bacteria 147277
108 Ga0157374_10002572 3300013296 Bacteria 15292
109 Ga0157378_10000197 3300013297 Bacteria 58779
110 Ga0157378_10001769 3300013297 Bacteria 19404
111 Ga0157378_10022964 3300013297 Bacteria 5491
112 Ga0157378_10178698 3300013297 Bacteria 1995
113 Ga0163162_10004140 3300013306 Bacteria 13925
114 Ga0163163_10159211 3300014325 Bacteria 2303
115 Ga0157380_10000929 3300014326 Bacteria 18482
116 Ga0157379_10068437 3300014968 Bacteria 3174
117 Ga0157379_10173619 3300014968 Bacteria 1946
118 Ga0157376_10000005 3300014969 Bacteria 443695
119 Ga0157376_10001685 3300014969 Bacteria 14691
120 Ga0163161_10000027 3300017792 Bacteria 197774
121 Ga0228598_1000051 3300024227 Bacteria 16914
122 Ga0207653_10000051 3300025885 Bacteria 88512
123 Ga0207692_10022793 3300025898 Bacteria 2887
124 Ga0207642_10000005 3300025899 Bacteria 401934
125 Ga0207710_10000198 3300025900 Bacteria 56537
126 Ga0207685_10000025 3300025905 Bacteria 110358
127 Ga0207699_10000038 3300025906 Bacteria 125079
128 Ga0207699_10000586 3300025906 Bacteria 17874
129 Ga0207699_10034151 3300025906 Bacteria 2882
130 Ga0207684_10002067 3300025910 Bacteria 20659
131 Ga0207684_10010099 3300025910 Bacteria 8316
132 Ga0207684_10109308 3300025910 Bacteria 2366
133 Ga0207695_10142205 3300025913 Bacteria 2347
134 Ga0207693_10009180 3300025915 Bacteria 8076
135 Ga0207693_10172034 3300025915 Bacteria 1705
136 Ga0207693_10189135 3300025915 Bacteria 1620
137 Ga0207693_10275658 3300025915 Bacteria 1318
138 Ga0207663_10000003 3300025916 Bacteria 458807
139 Ga0207663_10005513 3300025916 Bacteria 6381
140 Ga0207663_10008144 3300025916 Bacteria 5465
141 Ga0207663_10069462 3300025916 Bacteria 2266
142 Ga0207660_10054223 3300025917 Bacteria 2861
143 Ga0207652_10000309 3300025921 Bacteria 50266
144 Ga0207652_10008898 3300025921 Bacteria 8088
145 Ga0207646_10000052 3300025922 Bacteria 167602
146 Ga0207646_10002910 3300025922 Bacteria 19870
147 Ga0207646_10114484 3300025922 Bacteria 2422
148 Ga0207646_10312634 3300025922 Bacteria 1419
149 Ga0207694_10000056 3300025924 Bacteria 146908
150 Ga0207687_10000020 3300025927 Bacteria 228407
151 Ga0207700_10191985 3300025928 Bacteria 1717
152 Ga0207706_10000017 3300025933 Bacteria 169589
153 Ga0207686_10000061 3300025934 Bacteria 97978
154 Ga0207686_10030053 3300025934 Bacteria 3213
155 Ga0207669_10000056 3300025937 Bacteria 56304
156 Ga0207704_10054233 3300025938 Bacteria 2443
157 Ga0207665_10000053 3300025939 Bacteria 73573
158 Ga0207665_10004910 3300025939 Bacteria 8912
159 Ga0207665_10017786 3300025939 Unclassified 4672
160 Ga0207665_10021852 3300025939 Bacteria 4207
161 Ga0207665_10143300 3300025939 Bacteria 1706
162 Ga0207665_10173134 3300025939 Bacteria 1560
163 Ga0207711_10086163 3300025941 Bacteria 2754
164 Ga0207651_10000459 3300025960 Bacteria 17119
165 Ga0207712_10000019 3300025961 Bacteria 317060
166 Ga0207712_10071487 3300025961 Bacteria 2495
167 Ga0207677_10000299 3300026023 Bacteria 37042
168 Ga0207702_10417503 3300026078 Bacteria 1297
169 Ga0207641_10000077 3300026088 Bacteria 144978
170 Ga0207641_10004684 3300026088 Bacteria 11796
171 Ga0207648_10005127 3300026089 Bacteria 13274
172 Ga0207674_10466915 3300026116 Bacteria 1220
173 Ga0209588_1000234 3300027671 Bacteria 14858
174 Ga0209588_1031970 3300027671 Bacteria 1685
175 Ga0265354_1000187 3300028016 Bacteria 11337
176 Ga0265354_1001226 3300028016 Bacteria 3878
177 Ga0268266_10000563 3300028379 Bacteria 51738
178 Ga0268266_10412765 3300028379 Bacteria 1278
179 Ga0268264_10002912 3300028381 Bacteria 14866
180 Ga0268264_10015715 3300028381 Bacteria 6200
181 Ga0268264_10046421 3300028381 Bacteria 3608
182 Ga0265338_10003417 3300028800 Bacteria 22394
183 Ga0265338_10038886 3300028800 Bacteria 4499
184 Ga0265338_10170111 3300028800 Bacteria 1672
185 Ga0265770_1000841 3300030878 Bacteria 4247
186 Ga0265770_1001917 3300030878 Bacteria 2838
187 Ga0265765_1002330 3300030879 Bacteria 1831
188 Ga0265760_10001592 3300031090 Bacteria 6691
189 Ga0265760_10006040 3300031090 Bacteria 3460
190 Ga0265760_10011677 3300031090 Bacteria 2510
191 Ga0265332_10028845 3300031238 Bacteria 2428
192 Ga0265325_10001035 3300031241 Bacteria 20050
193 Ga0265325_10032158 3300031241 Bacteria 2803
194 Ga0265325_10062753 3300031241 Bacteria 1882
195 Ga0265339_10082406 3300031249 Bacteria 1698
196 Ga0265331_10066732 3300031250 Bacteria 1689
197 Ga0265316_10001389 3300031344 Bacteria 26087
198 Ga0307510_10120041 3300033180 Unclassified 2337
199 Ga0373926_0006246 3300035083 Bacteria 3952
200 Ga0373934_0001664 3300035086 Bacteria 8158
201 Ga0373923_0002046 3300035111 Bacteria 6081
202 Ga0373954_0005133 3300035118 Bacteria 5653
203 Ga0373954_0012554 3300035118 Bacteria 3768
204 Ga0373954_0031163 3300035118 Bacteria 2461
205 Ga0373956_0023818 3300035119 Bacteria 2631
206 Ga0373956_0061821 3300035119 Bacteria 1697
207 Ga0373957_0000961 3300035120 Bacteria 7550
208 Ga0373946_0079174 3300035171 Unclassified 1435
209 Ga0373955_0000322 3300035172 Bacteria 19872
210 Ga0373935_0069146 3300035692 Bacteria 2273
211 Ga0373927_0002337 3300035695 Bacteria 13824
212 Ga0373927_0010068 3300035695 Bacteria 6330
213 Ga0373933_0000271 3300035724 Bacteria 33675
214 Ga0373933_0001539 3300035724 Bacteria 13486
215 Ga0373933_0051090 3300035724 Bacteria 2470
216 Ga0373933_0080391 3300035724 Bacteria 1998
217 Ga0373947_0005668 3300035725 Bacteria 7285
218 Ga0373937_0000001 3300036401 Bacteria 478903
219 Ga0373937_0000185 3300036401 Bacteria 61109
220 Ga0373937_0006882 3300036401 Bacteria 9813
221 Ga0373937_0034175 3300036401 Bacteria 4624
222 Ga0373937_0041989 3300036401 Bacteria 4173
223 Ga0373937_0255843 3300036401 Bacteria 1651
224 Ga0373925_0001972 3300037068 Bacteria 16992
225 Ga0436365_0986453 3300039437 Bacteria 1412
226 Ga0451577_0033032 3300042876 Bacteria 4663
227 Ga0451577_0124374 3300042876 Bacteria 2311
228 Ga0453683_0071271 3300044673 Bacteria 2174
229 Ga0453683_0089071 3300044673 Bacteria 1934
230 Ga0453684_0020626 3300044712 Bacteria 9920
231 Ga0453684_0207246 3300044712 Bacteria 2281
232 Ga0451576_0018785 3300045051 Bacteria 7558
233 Ga0495592_0000318 3300046454 Bacteria 40338
234 Ga0495592_0047549 3300046454 Bacteria 3195
235 Ga0495592_0090728 3300046454 Bacteria 2192
236 Ga0495592_0118496 3300046454 Bacteria 1865
237 Ga0495603_0000613 3300046455 Bacteria 20015
238 Ga0495603_0015783 3300046455 Bacteria 4567
239 Ga0495603_0030914 3300046455 Bacteria 3225
240 Ga0495629_0011616 3300046459 Bacteria 6394
241 Ga0495629_0082665 3300046459 Bacteria 2241
242 Ga0495641_0057715 3300046461 Bacteria 1758
243 Ga0495651_0005028 3300046462 Bacteria 10106
244 Ga0495651_0052139 3300046462 Bacteria 3151
245 Ga0495653_0020802 3300046463 Bacteria 5316
246 Ga0495653_0020983 3300046463 Bacteria 5293
247 Ga0495580_0001156 3300046472 Bacteria 23183
248 Ga0495580_0005987 3300046472 Bacteria 9962
249 Ga0495582_0002331 3300046473 Bacteria 10634
250 Ga0495662_0000492 3300046476 Bacteria 18008
251 Ga0495662_0038531 3300046476 Bacteria 2310
252 Ga0495594_0009099 3300046499 Bacteria 5127
253 Ga0495608_0000183 3300046511 Bacteria 44585
254 Ga0495608_0025591 3300046511 Bacteria 4028
255 Ga0495608_0055436 3300046511 Bacteria 2619
256 Ga0495618_0000144 3300046514 Bacteria 50904
257 Ga0495618_0101149 3300046514 Bacteria 1845
258 Ga0495628_0000044 3300046516 Bacteria 99014
259 Ga0495628_0002963 3300046516 Bacteria 15226
260 Ga0495628_0075632 3300046516 Bacteria 2622
261 Ga0495628_0078513 3300046516 Bacteria 2567
262 Ga0495630_0000012 3300046517 Bacteria 223330
263 Ga0495630_0001552 3300046517 Bacteria 15941
264 Ga0495630_0007552 3300046517 Bacteria 7771
265 Ga0495630_0055292 3300046517 Bacteria 2974
266 Ga0495644_0001780 3300046523 Bacteria 8694
267 Ga0495666_0029893 3300046526 Bacteria 2678
268 Ga0495666_0037179 3300046526 Bacteria 2369
269 Ga0495652_0000023 3300046529 Bacteria 168049
270 Ga0495652_0006216 3300046529 Bacteria 11134
271 Ga0495665_0101357 3300046531 Bacteria 1511
272 Ga0495640_0004033 3300046533 Bacteria 11747
273 Ga0495640_0040593 3300046533 Bacteria 3258
274 Ga0495586_0001338 3300046535 Bacteria 13685
275 Ga0495586_0009789 3300046535 Bacteria 5102
276 Ga0495586_0071627 3300046535 Bacteria 1894
277 Ga0495587_0001147 3300046536 Bacteria 17384
278 Ga0495587_0004809 3300046536 Bacteria 8866
279 Ga0495587_0017812 3300046536 Bacteria 4406
280 Ga0495587_0025315 3300046536 Bacteria 3626
281 Ga0495587_0071089 3300046536 Bacteria 2024
282 Ga0495598_0007346 3300046537 Bacteria 2524
283 Ga0495645_0010771 3300046543 Bacteria 6423
284 Ga0495645_0041713 3300046543 Bacteria 3346
285 Ga0495645_0105365 3300046543 Bacteria 2001
286 Ga0495667_0000034 3300046559 Bacteria 141464
287 Ga0495667_0007653 3300046559 Bacteria 7328
288 Ga0495634_0000031 3300046642 Bacteria 110396
289 Ga0495625_0000453 3300046660 Bacteria 61379
290 Ga0495635_0000005 3300046663 Bacteria 302178
291 Ga0495635_0017846 3300046663 Bacteria 4956
292 Ga0495657_0019804 3300046675 Bacteria 4851
293 Ga0495657_0040082 3300046675 Bacteria 3214
294 Ga0495623_0000594 3300046679 Bacteria 24223
295 Ga0495646_0004624 3300046680 Bacteria 8663
296 Ga0495646_0017394 3300046680 Bacteria 4561
297 Ga0495646_0152618 3300046680 Bacteria 1284
298 Ga0495647_0000009 3300046681 Bacteria 94874
299 Ga0495647_0000047 3300046681 Bacteria 35186
300 Ga0495647_0004056 3300046681 Bacteria 4730
301 Ga0495647_0007047 3300046681 Bacteria 3748
302 Ga0495658_0076817 3300046683 Bacteria 1952
303 Ga0495669_0000121 3300046684 Bacteria 50495
304 Ga0495613_0000321 3300046689 Bacteria 43464
305 Ga0495613_0092514 3300046689 Bacteria 2189
306 Ga0495613_0099066 3300046689 Bacteria 2106
307 Ga0495624_0000038 3300046690 Bacteria 83368
308 Ga0495624_0000414 3300046690 Bacteria 33832
309 Ga0495670_0026911 3300046691 Bacteria 2847
310 Ga0495600_0063283 3300046809 Bacteria 2417
311 Ga0495604_0000317 3300047317 Bacteria 43411
312 Ga0495604_0003864 3300047317 Bacteria 11933
313 Ga0495604_0004919 3300047317 Bacteria 10596
314 Ga0495604_0046186 3300047317 Bacteria 3396
315 Ga0495674_0037536 3300047319 Bacteria 4354
316 Ga0495674_0075892 3300047319 Bacteria 2891
317 Ga0495674_0082645 3300047319 Bacteria 2754
318 Ga0495674_0159583 3300047319 Bacteria 1887
319 Ga0495676_0001189 3300047321 Bacteria 22211
320 Ga0495676_0120023 3300047321 Bacteria 1914
321 Ga0495680_0004808 3300047322 Bacteria 12815
322 Ga0495680_0013480 3300047322 Bacteria 7131
323 Ga0495680_0059225 3300047322 Bacteria 2958
324 Ga0495675_0000455 3300047444 Bacteria 27052
325 Ga0495675_0014809 3300047444 Bacteria 4931
326 Ga0495684_0054260 3300047471 Bacteria 3057
327 Ga0495684_0212221 3300047471 Bacteria 1423
328 Ga0495593_0034006 3300047673 Bacteria 2774
329 Ga0495602_0000055 3300048088 Bacteria 110084
330 Ga0495602_0005211 3300048088 Bacteria 13624
331 Ga0495602_0018643 3300048088 Bacteria 6921
332 Ga0495602_0139859 3300048088 Bacteria 1917
333 Ga0496100_0000005 3300048903 Bacteria 312112
334 Ga0496100_0000014 3300048903 Bacteria 174991
335 Ga0496100_0042013 3300048903 Bacteria 2918
336 Ga0496100_0060550 3300048903 Bacteria 2492
337 Ga0496101_0000022 3300048904 Bacteria 216728
338 Ga0496101_0000036 3300048904 Bacteria 175595
339 Ga0496101_0158292 3300048904 Bacteria 1736
340 Ga0496102_0001041 3300048905 Bacteria 25747
341 Ga0496104_0000024 3300048907 Bacteria 229913
342 Ga0496104_0000077 3300048907 Bacteria 100848
343 Ga0496104_0001134 3300048907 Bacteria 22797
344 Ga0496104_0033193 3300048907 Bacteria 4806
345 Ga0496105_0000004 3300048908 Bacteria 475798
346 Ga0496105_0000013 3300048908 Bacteria 229894
347 Ga0496105_0000101 3300048908 Bacteria 58062
348 Ga0496105_0022511 3300048908 Bacteria 5104
349 Ga0496105_0023832 3300048908 Bacteria 4969
350 Ga0496105_0061456 3300048908 Bacteria 3100
351 Ga0496106_0000043 3300048909 Bacteria 105477
352 Ga0496106_0000087 3300048909 Bacteria 73787
353 Ga0496106_0000213 3300048909 Bacteria 40340
354 Ga0496107_0000022 3300048910 Bacteria 128991
355 Ga0496107_0000046 3300048910 Bacteria 67209
356 Ga0496107_0065012 3300048910 Bacteria 2644
357 Ga0496107_0121463 3300048910 Bacteria 1925
358 Ga0496108_0000006 3300048911 Bacteria 469473
359 Ga0496108_0000055 3300048911 Bacteria 125202
360 Ga0496108_0001225 3300048911 Bacteria 20129
361 Ga0496109_0000004 3300048912 Bacteria 404818
362 Ga0496109_0000043 3300048912 Bacteria 134649
363 Ga0496109_0000921 3300048912 Bacteria 24461
364 Ga0496109_0476857 3300048912 Bacteria 1178
365 Ga0496110_0001743 3300048913 Bacteria 16048
366 Ga0496110_0008741 3300048913 Bacteria 8157
367 Ga0496111_0001099 3300048914 Bacteria 14984
368 Ga0496112_0000013 3300048915 Bacteria 237194
369 Ga0496112_0030420 3300048915 Bacteria 5225
370 Ga0496113_0019127 3300048916 Bacteria 4786
371 Ga0496113_0094382 3300048916 Bacteria 2311
372 Ga0496114_0004451 3300048917 Bacteria 10874
373 Ga0496114_0045135 3300048917 Bacteria 3660
374 Ga0496114_0282945 3300048917 Bacteria 1462
375 Ga0496115_0005754 3300048918 Bacteria 9026
376 Ga0496115_0027547 3300048918 Bacteria 4446
377 Ga0501042_0037027 3300049578 Bacteria 3461
378 Ga0501042_0092029 3300049578 Bacteria 2177
379 Ga0501042_0095012 3300049578 Bacteria 2141
380 Ga0501048_0068219 3300049582 Bacteria 2513
381 Ga0501067_0010503 3300049583 Bacteria 5127
382 Ga0501067_0040236 3300049583 Bacteria 2597
383 Ga0501073_0011961 3300049589 Bacteria 6335
384 Ga0501075_0002006 3300049591 Bacteria 13456
385 Ga0501075_0011092 3300049591 Bacteria 6364
386 Ga0501076_0011541 3300049592 Bacteria 6587
387 Ga0501076_0138823 3300049592 Bacteria 1974
388 Ga0501077_0202325 3300049593 Bacteria 1261
389 Ga0501079_0047557 3300049741 Bacteria 3310
390 Ga0501081_0120021 3300049743 Bacteria 1872
391 Ga0501081_0430137 3300049743 Bacteria 979
392 Ga0501083_0079030 3300049744 Bacteria 2181
393 Ga0501045_0018126 3300049824 Bacteria 5003
394 nmdc:mga05p37_177_c1 3300050507 Bacteria 62574
395 nmdc:mga05p37_68281_c1 3300050507 Bacteria 4371
396 nmdc:mga0n895_39961_c1 3300050512 Bacteria 4556
397 nmdc:mga0n895_70762_c1 3300050512 Bacteria 3457
398 nmdc:mga0n895_74834_c1 3300050512 Bacteria 3365
399 nmdc:mga0rr50_36761_c1 3300050513 Bacteria 3529
400 nmdc:mga08x19_125_c1 3300050514 Bacteria 67457
401 nmdc:mga08x19_37007_c1 3300050514 Bacteria 3095
402 nmdc:mga08x19_46_c1 3300050514 Bacteria 145818
403 nmdc:mga08x19_49918_c1 3300050514 Bacteria 2684
404 nmdc:mga08x19_7436_c1 3300050514 Bacteria 6505
405 nmdc:mga0a205_31148_c1 3300050515 Bacteria 5108
406 nmdc:mga0a205_327380_c1 3300050515 Bacteria 1402
407 nmdc:mga0a205_415630_c1 3300050515 Bacteria 1207
408 nmdc:mga0a205_61_c1 3300050515 Bacteria 59479
409 Ga0495601_0000104 3300053077 Bacteria 46045
410 Ga0495601_0005548 3300053077 Bacteria 7359
411 Ga0495601_0066513 3300053077 Bacteria 2294
412 Ga0495612_0002650 3300053078 Bacteria 7384
413 Ga0495612_0008885 3300053078 Bacteria 4070
414 Ga0495612_0018897 3300053078 Bacteria 2759
415 Ga0495595_0000269 3300053084 Bacteria 20561
416 Ga0495595_0003435 3300053084 Bacteria 6282
417 Ga0495619_0001270 3300053085 Bacteria 16564
418 Ga0495619_0007328 3300053085 Bacteria 6990
419 Ga0495619_0068398 3300053085 Bacteria 2372
420 Ga0495619_0185172 3300053085 Bacteria 1441
421 Ga0500562_013395 3300053108 Bacteria 2094
422 Ga0501084_0036969 3300054114 Bacteria 4079
423 Ga0501082_0163755 3300060353 Bacteria 1932
424 Ga0501082_0277676 3300060353 Bacteria 1458

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049743 Ga0501081_0430137 Ga0501081_0430137_19_885 287
2 3300049743 Ga0501081_0120021 Ga0501081_0120021_85_1137 290
3 3300005406 Ga0070703_10000381 Ga0070703_1000038113 292
4 3300005467 Ga0070706_100001341 Ga0070706_10000134116 292
5 3300006844 Ga0075428_100004116 Ga0075428_1000041164 292
6 3300009094 Ga0111539_10102925 Ga0111539_101029252 292
7 3300025885 Ga0207653_10000051 Ga0207653_1000005115 292
8 3300025910 Ga0207684_10002067 Ga0207684_100020676 292
9 3300050507 nmdc:mga05p37_68281_c1 nmdc:mga05p37_68281_c1_1518_2543 292
10 3300050515 nmdc:mga0a205_415630_c1 nmdc:mga0a205_415630_c1_175_1170 294
11 3300044673 Ga0453683_0071271 Ga0453683_0071271_237_1262 295
12 3300049591 Ga0501075_0011092 Ga0501075_0011092_17_970 297
13 3300014325 Ga0163163_10159211 Ga0163163_101592112 298
14 3300006871 Ga0075434_100066992 Ga0075434_1000669923 304
15 3300007076 Ga0075435_100073067 Ga0075435_1000730672 304
16 3300050512 nmdc:mga0n895_70762_c1 nmdc:mga0n895_70762_c1_543_1568 304
17 3300050513 nmdc:mga0rr50_36761_c1 nmdc:mga0rr50_36761_c1_2099_3124 304
18 3300049824 Ga0501045_0018126 Ga0501045_0018126_3460_4509 306
19 3300005549 Ga0070704_100031868 Ga0070704_1000318682 307
20 3300035111 Ga0373923_0002046 Ga0373923_0002046_2555_3664 310
21 3300035119 Ga0373956_0061821 Ga0373956_0061821_18_1127 310
22 3300035692 Ga0373935_0069146 Ga0373935_0069146_295_1404 310
23 3300035695 Ga0373927_0010068 Ga0373927_0010068_4318_5427 310
24 3300035724 Ga0373933_0051090 Ga0373933_0051090_1003_2112 310
25 3300036401 Ga0373937_0041989 Ga0373937_0041989_602_1711 310
26 3300046462 Ga0495651_0052139 Ga0495651_0052139_1545_2654 310
27 3300046463 Ga0495653_0020983 Ga0495653_0020983_4098_5207 310
28 3300046472 Ga0495580_0005987 Ga0495580_0005987_332_1441 310
29 3300046511 Ga0495608_0055436 Ga0495608_0055436_917_2026 310
30 3300046516 Ga0495628_0075632 Ga0495628_0075632_207_1316 310
31 3300046517 Ga0495630_0055292 Ga0495630_0055292_1415_2524 310
32 3300046526 Ga0495666_0037179 Ga0495666_0037179_1162_2271 310
33 3300046529 Ga0495652_0006216 Ga0495652_0006216_6457_7566 310
34 3300046535 Ga0495586_0009789 Ga0495586_0009789_2889_3998 310
35 3300046536 Ga0495587_0025315 Ga0495587_0025315_1544_2653 310
36 3300046543 Ga0495645_0041713 Ga0495645_0041713_1888_2997 310
37 3300046559 Ga0495667_0007653 Ga0495667_0007653_1946_3055 310
38 3300046663 Ga0495635_0017846 Ga0495635_0017846_2539_3648 310
39 3300046675 Ga0495657_0040082 Ga0495657_0040082_2042_3151 310
40 3300046679 Ga0495623_0000594 Ga0495623_0000594_19130_20239 310
41 3300046680 Ga0495646_0004624 Ga0495646_0004624_6927_8036 310
42 3300047319 Ga0495674_0075892 Ga0495674_0075892_1415_2524 310
43 3300047444 Ga0495675_0014809 Ga0495675_0014809_1529_2638 310
44 3300048088 Ga0495602_0139859 Ga0495602_0139859_368_1477 310
45 3300053078 Ga0495612_0002650 Ga0495612_0002650_340_1449 310
46 3300005445 Ga0070708_100211664 Ga0070708_1002116642 311
47 3300005467 Ga0070706_100037688 Ga0070706_1000376885 311
48 3300005468 Ga0070707_100001601 Ga0070707_1000016012 311
49 3300005471 Ga0070698_100029091 Ga0070698_1000290917 311
50 3300005536 Ga0070697_100130121 Ga0070697_1001301212 311
51 3300025922 Ga0207646_10000052 Ga0207646_1000005252 311
52 3300046689 Ga0495613_0099066 Ga0495613_0099066_593_1702 311
53 3300005518 Ga0070699_100058694 Ga0070699_1000586942 312
54 3300047322 Ga0495680_0059225 Ga0495680_0059225_922_2031 313
55 3300005471 Ga0070698_100097308 Ga0070698_1000973084 314
56 3300005518 Ga0070699_100034806 Ga0070699_1000348064 314
57 3300005536 Ga0070697_100013189 Ga0070697_1000131895 314
58 3300013297 Ga0157378_10001769 Ga0157378_1000176911 314
59 3300031238 Ga0265332_10028845 Ga0265332_100288452 315
60 3300031249 Ga0265339_10082406 Ga0265339_100824062 315
61 3300031344 Ga0265316_10001389 Ga0265316_100013899 315
62 3300035118 Ga0373954_0005133 Ga0373954_0005133_1741_2874 315
63 3300036401 Ga0373937_0000185 Ga0373937_0000185_6787_7920 315
64 3300042876 Ga0451577_0124374 Ga0451577_0124374_567_1676 315
65 3300046462 Ga0495651_0005028 Ga0495651_0005028_39_1172 315
66 3300047317 Ga0495604_0003864 Ga0495604_0003864_75_1208 315
67 3300006173 Ga0070716_100017824 Ga0070716_1000178242 316
68 3300025939 Ga0207665_10000053 Ga0207665_1000005359 316
69 3300044712 Ga0453684_0207246 Ga0453684_0207246_862_1971 316
70 3300046514 Ga0495618_0101149 Ga0495618_0101149_542_1651 316
71 3300046533 Ga0495640_0040593 Ga0495640_0040593_2065_3174 316
72 3300046535 Ga0495586_0071627 Ga0495586_0071627_480_1589 316
73 3300047319 Ga0495674_0159583 Ga0495674_0159583_472_1581 316
74 3300035118 Ga0373954_0012554 Ga0373954_0012554_1340_2449 317
75 3300036401 Ga0373937_0255843 Ga0373937_0255843_43_1152 317
76 3300046454 Ga0495592_0090728 Ga0495592_0090728_212_1321 317
77 3300046516 Ga0495628_0002963 Ga0495628_0002963_12040_13149 317
78 3300046680 Ga0495646_0017394 Ga0495646_0017394_37_1146 317
79 3300047317 Ga0495604_0046186 Ga0495604_0046186_477_1586 317
80 3300005434 Ga0070709_10000044 Ga0070709_1000004459 319
81 3300005439 Ga0070711_100000002 Ga0070711_10000000245 319
82 3300005440 Ga0070705_100000223 Ga0070705_1000002239 319
83 3300005468 Ga0070707_100464182 Ga0070707_1004641821 319
84 3300005518 Ga0070699_100000065 Ga0070699_10000006523 319
85 3300005546 Ga0070696_100005726 Ga0070696_1000057267 319
86 3300005618 Ga0068864_100288673 Ga0068864_1002886732 319
87 3300006914 Ga0075436_100002991 Ga0075436_1000029911 319
88 3300009147 Ga0114129_10006288 Ga0114129_100062884 319
89 3300025906 Ga0207699_10000038 Ga0207699_1000003860 319
90 3300025916 Ga0207663_10000003 Ga0207663_1000000371 319
91 3300026116 Ga0207674_10466915 Ga0207674_104669152 319
92 3300044712 Ga0453684_0020626 Ga0453684_0020626_6408_7517 319
93 3300045051 Ga0451576_0018785 Ga0451576_0018785_1772_2881 319
94 3300050507 nmdc:mga05p37_177_c1 nmdc:mga05p37_177_c1_48492_49517 319
95 3300050514 nmdc:mga08x19_37007_c1 nmdc:mga08x19_37007_c1_1570_2595 319
96 3300050514 nmdc:mga08x19_46_c1 nmdc:mga08x19_46_c1_43684_44709 319
97 3300050515 nmdc:mga0a205_327380_c1 nmdc:mga0a205_327380_c1_223_1248 319
98 3300005336 Ga0070680_100051908 Ga0070680_1000519083 320
99 3300033180 Ga0307510_10120041 Ga0307510_101200413 321
100 3300046531 Ga0495665_0101357 Ga0495665_0101357_177_1310 321
101 3300049578 Ga0501042_0095012 Ga0501042_0095012_195_1244 321
102 3300049593 Ga0501077_0202325 Ga0501077_0202325_12_1061 321
103 3300049741 Ga0501079_0047557 Ga0501079_0047557_1685_2734 321
104 iso_pu_bacteria 2979742915 2979747683 321
105 3300035724 Ga0373933_0080391 Ga0373933_0080391_120_1286 322
106 3300007265 Ga0099794_10012817 Ga0099794_100128172 323
107 3300027671 Ga0209588_1031970 Ga0209588_10319702 323
108 3300042876 Ga0451577_0033032 Ga0451577_0033032_2915_4024 324
109 3300005445 Ga0070708_100013070 Ga0070708_1000130703 325
110 3300007265 Ga0099794_10123749 Ga0099794_101237492 325
111 3300025922 Ga0207646_10312634 Ga0207646_103126341 325
112 3300009093 Ga0105240_10031468 Ga0105240_100314682 326
113 3300025913 Ga0207695_10142205 Ga0207695_101422052 326
114 iso_pu_bacteria 2961127735 2961134617 328
115 3300035086 Ga0373934_0001664 Ga0373934_0001664_4916_6049 329
116 3300035120 Ga0373957_0000961 Ga0373957_0000961_1764_2897 329
117 3300035172 Ga0373955_0000322 Ga0373955_0000322_12853_13986 329
118 3300035724 Ga0373933_0001539 Ga0373933_0001539_10139_11272 329
119 3300046511 Ga0495608_0025591 Ga0495608_0025591_1527_2660 329
120 3300047471 Ga0495684_0054260 Ga0495684_0054260_298_1431 329
121 3300044673 Ga0453683_0089071 Ga0453683_0089071_596_1705 330
122 3300049583 Ga0501067_0040236 Ga0501067_0040236_1022_2023 332
123 3300005518 Ga0070699_100248019 Ga0070699_1002480191 333
124 3300009098 Ga0105245_10138807 Ga0105245_101388073 333
125 3300035119 Ga0373956_0023818 Ga0373956_0023818_792_1901 333
126 3300035724 Ga0373933_0000271 Ga0373933_0000271_22506_23615 333
127 3300036401 Ga0373937_0000001 Ga0373937_0000001_410534_411643 333
128 3300046459 Ga0495629_0082665 Ga0495629_0082665_216_1220 333
129 3300046536 Ga0495587_0001147 Ga0495587_0001147_1153_2262 333
130 3300047444 Ga0495675_0000455 Ga0495675_0000455_6657_7766 333
131 3300048088 Ga0495602_0018643 Ga0495602_0018643_515_1624 333
132 3300048903 Ga0496100_0042013 Ga0496100_0042013_429_1433 333
133 3300048904 Ga0496101_0158292 Ga0496101_0158292_211_1215 333
134 3300048907 Ga0496104_0033193 Ga0496104_0033193_843_1847 333
135 3300048908 Ga0496105_0022511 Ga0496105_0022511_2461_3465 333
136 3300048910 Ga0496107_0121463 Ga0496107_0121463_577_1581 333
137 3300048911 Ga0496108_0001225 Ga0496108_0001225_5312_6316 333
138 3300048912 Ga0496109_0000921 Ga0496109_0000921_10786_11790 333
139 3300048912 Ga0496109_0476857 Ga0496109_0476857_129_1133 333
140 3300048913 Ga0496110_0001743 Ga0496110_0001743_12294_13298 333
141 3300048914 Ga0496111_0001099 Ga0496111_0001099_10131_11135 333
142 3300048915 Ga0496112_0030420 Ga0496112_0030420_1449_2453 333
143 3300048916 Ga0496113_0019127 Ga0496113_0019127_2776_3780 333
144 3300048917 Ga0496114_0045135 Ga0496114_0045135_1791_2795 333
145 iso_pu_bacteria 2885350715 2885353313 333
146 3300025934 Ga0207686_10030053 Ga0207686_100300532 334
147 3300025938 Ga0207704_10054233 Ga0207704_100542332 334
148 3300025915 Ga0207693_10275658 Ga0207693_102756582 336
149 3300028800 Ga0265338_10038886 Ga0265338_100388867 336
150 3300006871 Ga0075434_100049612 Ga0075434_1000496122 338
151 3300024227 Ga0228598_1000051 Ga0228598_100005120 338
152 3300031241 Ga0265325_10032158 Ga0265325_100321582 338
153 3300050512 nmdc:mga0n895_74834_c1 nmdc:mga0n895_74834_c1_900_2042 338
154 3300005439 Ga0070711_100005455 Ga0070711_1000054553 339
155 3300005467 Ga0070706_100248337 Ga0070706_1002483372 339
156 3300006175 Ga0070712_100009383 Ga0070712_1000093835 339
157 3300025898 Ga0207692_10022793 Ga0207692_100227933 339
158 3300025906 Ga0207699_10034151 Ga0207699_100341513 339
159 3300025910 Ga0207684_10109308 Ga0207684_101093083 339
160 3300025915 Ga0207693_10009180 Ga0207693_100091807 339
161 3300025916 Ga0207663_10005513 Ga0207663_100055133 339
162 3300031241 Ga0265325_10062753 Ga0265325_100627532 339
163 3300031250 Ga0265331_10066732 Ga0265331_100667322 339
164 3300053108 Ga0500562_013395 Ga0500562_013395_584_1660 339
165 3300035118 Ga0373954_0031163 Ga0373954_0031163_315_1493 340
166 3300036401 Ga0373937_0006882 Ga0373937_0006882_2889_4067 340
167 3300046559 Ga0495667_0000034 Ga0495667_0000034_56591_57649 340
168 3300047322 Ga0495680_0013480 Ga0495680_0013480_3152_4210 340
169 3300049583 Ga0501067_0010503 Ga0501067_0010503_276_1454 340
170 3300049589 Ga0501073_0011961 Ga0501073_0011961_2647_3741 340
171 3300049592 Ga0501076_0138823 Ga0501076_0138823_341_1435 340
172 3300049744 Ga0501083_0079030 Ga0501083_0079030_565_1659 340
173 3300054114 Ga0501084_0036969 Ga0501084_0036969_2081_3175 340
174 3300060353 Ga0501082_0163755 Ga0501082_0163755_153_1247 340
175 3300060353 Ga0501082_0277676 Ga0501082_0277676_93_1190 340
176 3300005548 Ga0070665_100060784 Ga0070665_1000607844 341
177 3300006028 Ga0070717_10053275 Ga0070717_100532752 341
178 3300025961 Ga0207712_10071487 Ga0207712_100714872 341
179 3300028379 Ga0268266_10000563 Ga0268266_1000056332 341
180 3300028800 Ga0265338_10003417 Ga0265338_1000341718 341
181 3300028800 Ga0265338_10170111 Ga0265338_101701112 341
182 3300031090 Ga0265760_10006040 Ga0265760_100060404 341
183 3300031241 Ga0265325_10001035 Ga0265325_1000103515 341
184 iso_pu_bacteria 2888350351 2888353114 341
185 3300005843 Ga0068860_100087175 Ga0068860_1000871755 342
186 3300028381 Ga0268264_10046421 Ga0268264_100464214 342
187 3300013297 Ga0157378_10022964 Ga0157378_100229643 343
188 3300047321 Ga0495676_0001189 Ga0495676_0001189_6421_7479 345
189 3300048903 Ga0496100_0000005 Ga0496100_0000005_75629_76687 345
190 3300048904 Ga0496101_0000022 Ga0496101_0000022_164999_166057 345
191 3300048909 Ga0496106_0000087 Ga0496106_0000087_39514_40572 345
192 3300048910 Ga0496107_0000046 Ga0496107_0000046_33556_34614 345
193 3300039437 Ga0436365_0986453 Ga0436365_0986453_41_1180 346
194 3300006914 Ga0075436_100008922 Ga0075436_1000089228 347
195 3300027671 Ga0209588_1000234 Ga0209588_100023412 347
196 3300046691 Ga0495670_0026911 Ga0495670_0026911_44_1102 347
197 3300050514 nmdc:mga08x19_7436_c1 nmdc:mga08x19_7436_c1_1333_2454 347
198 3300005366 Ga0070659_100247717 Ga0070659_1002477172 348
199 3300005434 Ga0070709_10026299 Ga0070709_100262992 348
200 3300005436 Ga0070713_100267256 Ga0070713_1002672562 348
201 3300005439 Ga0070711_100010196 Ga0070711_1000101965 348
202 3300005440 Ga0070705_100044312 Ga0070705_1000443121 348
203 3300005444 Ga0070694_100000592 Ga0070694_10000059218 348
204 3300005445 Ga0070708_100016691 Ga0070708_1000166917 348
205 3300005445 Ga0070708_100196315 Ga0070708_1001963152 348
206 3300005467 Ga0070706_100009017 Ga0070706_1000090176 348
207 3300005468 Ga0070707_100016320 Ga0070707_1000163204 348
208 3300005468 Ga0070707_100172452 Ga0070707_1001724522 348
209 3300005471 Ga0070698_100017439 Ga0070698_1000174394 348
210 3300005471 Ga0070698_100045345 Ga0070698_1000453455 348
211 3300005518 Ga0070699_100050957 Ga0070699_1000509573 348
212 3300005530 Ga0070679_100009748 Ga0070679_10000974810 348
213 3300005536 Ga0070697_100001398 Ga0070697_1000013983 348
214 3300005536 Ga0070697_100014109 Ga0070697_1000141094 348
215 3300005546 Ga0070696_100008340 Ga0070696_1000083402 348
216 3300005547 Ga0070693_100001103 Ga0070693_1000011031 348
217 3300005549 Ga0070704_100000639 Ga0070704_1000006399 348
218 3300005549 Ga0070704_100241171 Ga0070704_1002411711 348
219 3300005841 Ga0068863_100043020 Ga0068863_1000430205 348
220 3300005842 Ga0068858_100052062 Ga0068858_1000520623 348
221 3300005843 Ga0068860_100007125 Ga0068860_1000071257 348
222 3300006173 Ga0070716_100002956 Ga0070716_1000029567 348
223 3300006173 Ga0070716_100006708 Ga0070716_1000067082 348
224 3300006173 Ga0070716_100008707 Ga0070716_1000087074 348
225 3300006175 Ga0070712_100045166 Ga0070712_1000451663 348
226 3300006175 Ga0070712_100197269 Ga0070712_1001972691 348
227 3300006237 Ga0097621_100180327 Ga0097621_1001803272 348
228 3300006358 Ga0068871_100005275 Ga0068871_1000052755 348
229 3300006871 Ga0075434_100062036 Ga0075434_1000620364 348
230 3300006914 Ga0075436_100003784 Ga0075436_1000037843 348
231 3300006914 Ga0075436_100053100 Ga0075436_1000531002 348
232 3300007076 Ga0075435_100041938 Ga0075435_1000419383 348
233 3300007265 Ga0099794_10025504 Ga0099794_100255042 348
234 3300009177 Ga0105248_10053989 Ga0105248_100539893 348
235 3300013297 Ga0157378_10000197 Ga0157378_1000019713 348
236 3300013297 Ga0157378_10178698 Ga0157378_101786982 348
237 3300013306 Ga0163162_10004140 Ga0163162_100041403 348
238 3300014968 Ga0157379_10068437 Ga0157379_100684373 348
239 3300014969 Ga0157376_10000005 Ga0157376_10000005248 348
240 3300014969 Ga0157376_10001685 Ga0157376_1000168510 348
241 3300025906 Ga0207699_10000586 Ga0207699_1000058614 348
242 3300025910 Ga0207684_10010099 Ga0207684_100100992 348
243 3300025915 Ga0207693_10172034 Ga0207693_101720342 348
244 3300025915 Ga0207693_10189135 Ga0207693_101891352 348
245 3300025916 Ga0207663_10069462 Ga0207663_100694623 348
246 3300025921 Ga0207652_10008898 Ga0207652_100088983 348
247 3300025922 Ga0207646_10002910 Ga0207646_100029107 348
248 3300025922 Ga0207646_10114484 Ga0207646_101144843 348
249 3300025928 Ga0207700_10191985 Ga0207700_101919852 348
250 3300025939 Ga0207665_10004910 Ga0207665_100049108 348
251 3300025939 Ga0207665_10017786 Ga0207665_100177863 348
252 3300025939 Ga0207665_10021852 Ga0207665_100218523 348
253 3300025939 Ga0207665_10143300 Ga0207665_101433002 348
254 3300025939 Ga0207665_10173134 Ga0207665_101731342 348
255 3300025941 Ga0207711_10086163 Ga0207711_100861631 348
256 3300026088 Ga0207641_10004684 Ga0207641_100046848 348
257 3300028016 Ga0265354_1000187 Ga0265354_10001878 348
258 3300028016 Ga0265354_1001226 Ga0265354_10012264 348
259 3300028381 Ga0268264_10015715 Ga0268264_100157155 348
260 3300030878 Ga0265770_1000841 Ga0265770_10008415 348
261 3300030878 Ga0265770_1001917 Ga0265770_10019172 348
262 3300030879 Ga0265765_1002330 Ga0265765_10023302 348
263 3300031090 Ga0265760_10001592 Ga0265760_100015925 348
264 3300031090 Ga0265760_10011677 Ga0265760_100116772 348
265 3300035083 Ga0373926_0006246 Ga0373926_0006246_1268_2401 348
266 3300035171 Ga0373946_0079174 Ga0373946_0079174_258_1391 348
267 3300035695 Ga0373927_0002337 Ga0373927_0002337_8893_10026 348
268 3300035725 Ga0373947_0005668 Ga0373947_0005668_4645_5778 348
269 3300037068 Ga0373925_0001972 Ga0373925_0001972_11975_13108 348
270 3300046455 Ga0495603_0015783 Ga0495603_0015783_3361_4509 348
271 3300046455 Ga0495603_0030914 Ga0495603_0030914_280_1518 348
272 3300046472 Ga0495580_0001156 Ga0495580_0001156_21615_22853 348
273 3300046473 Ga0495582_0002331 Ga0495582_0002331_8339_9577 348
274 3300046476 Ga0495662_0038531 Ga0495662_0038531_963_2111 348
275 3300046499 Ga0495594_0009099 Ga0495594_0009099_261_1508 348
276 3300046516 Ga0495628_0078513 Ga0495628_0078513_981_2114 348
277 3300046517 Ga0495630_0001552 Ga0495630_0001552_3849_4982 348
278 3300046526 Ga0495666_0029893 Ga0495666_0029893_131_1279 348
279 3300046536 Ga0495587_0004809 Ga0495587_0004809_3494_4630 348
280 3300046543 Ga0495645_0010771 Ga0495645_0010771_69_1202 348
281 3300046681 Ga0495647_0007047 Ga0495647_0007047_2208_3356 348
282 3300046683 Ga0495658_0076817 Ga0495658_0076817_356_1504 348
283 3300046689 Ga0495613_0092514 Ga0495613_0092514_484_1731 348
284 3300047319 Ga0495674_0037536 Ga0495674_0037536_919_2067 348
285 3300047319 Ga0495674_0082645 Ga0495674_0082645_909_2042 348
286 3300047321 Ga0495676_0120023 Ga0495676_0120023_471_1718 348
287 3300047673 Ga0495593_0034006 Ga0495593_0034006_659_1906 348
288 3300048903 Ga0496100_0060550 Ga0496100_0060550_975_2222 348
289 3300048905 Ga0496102_0001041 Ga0496102_0001041_13823_14953 348
290 3300048908 Ga0496105_0061456 Ga0496105_0061456_1101_2234 348
291 3300048917 Ga0496114_0282945 Ga0496114_0282945_67_1314 348
292 3300048918 Ga0496115_0005754 Ga0496115_0005754_7006_8148 348
293 3300050512 nmdc:mga0n895_39961_c1 nmdc:mga0n895_39961_c1_1634_2788 348
294 3300050514 nmdc:mga08x19_125_c1 nmdc:mga08x19_125_c1_47266_48399 348
295 3300050514 nmdc:mga08x19_49918_c1 nmdc:mga08x19_49918_c1_640_1773 348
296 3300050515 nmdc:mga0a205_31148_c1 nmdc:mga0a205_31148_c1_1562_2716 348
297 3300053085 Ga0495619_0007328 Ga0495619_0007328_1388_2521 348
298 3300048913 Ga0496110_0008741 Ga0496110_0008741_2068_3132 351
299 3300001977 JGI24746J21847_1001670 JGI24746J21847_10016705 352
300 3300003203 JGI25406J46586_10027571 JGI25406J46586_100275712 352
301 3300005336 Ga0070680_100072963 Ga0070680_1000729632 352
302 3300005337 Ga0070682_100000030 Ga0070682_10000003099 352
303 3300005337 Ga0070682_100095133 Ga0070682_1000951332 352
304 3300005338 Ga0068868_100000445 Ga0068868_1000004453 352
305 3300005341 Ga0070691_10000007 Ga0070691_1000000768 352
306 3300005356 Ga0070674_100000004 Ga0070674_10000000498 352
307 3300005364 Ga0070673_100001047 Ga0070673_10000104712 352
308 3300005439 Ga0070711_100011904 Ga0070711_1000119042 352
309 3300005457 Ga0070662_100000006 Ga0070662_100000006102 352
310 3300005458 Ga0070681_10068664 Ga0070681_100686642 352
311 3300005459 Ga0068867_100009392 Ga0068867_1000093925 352
312 3300005530 Ga0070679_100000225 Ga0070679_10000022544 352
313 3300005547 Ga0070693_100002189 Ga0070693_1000021892 352
314 3300005548 Ga0070665_100292043 Ga0070665_1002920432 352
315 3300005718 Ga0068866_10000004 Ga0068866_10000004135 352
316 3300005841 Ga0068863_100000107 Ga0068863_10000010727 352
317 3300005843 Ga0068860_100014869 Ga0068860_1000148695 352
318 3300005985 Ga0081539_10006125 Ga0081539_100061255 352
319 3300006163 Ga0070715_10000014 Ga0070715_1000001492 352
320 3300006237 Ga0097621_100102729 Ga0097621_1001027292 352
321 3300006852 Ga0075433_10000131 Ga0075433_1000013141 352
322 3300009098 Ga0105245_10000143 Ga0105245_1000014361 352
323 3300009101 Ga0105247_10001425 Ga0105247_100014259 352
324 3300009176 Ga0105242_10003557 Ga0105242_100035571 352
325 3300009176 Ga0105242_10005910 Ga0105242_100059107 352
326 3300009551 Ga0105238_10000048 Ga0105238_1000004870 352
327 3300009553 Ga0105249_10000070 Ga0105249_1000007080 352
328 3300013296 Ga0157374_10002572 Ga0157374_100025726 352
329 3300014326 Ga0157380_10000929 Ga0157380_100009298 352
330 3300014968 Ga0157379_10173619 Ga0157379_101736192 352
331 3300017792 Ga0163161_10000027 Ga0163161_10000027184 352
332 3300025899 Ga0207642_10000005 Ga0207642_1000000573 352
333 3300025900 Ga0207710_10000198 Ga0207710_100001989 352
334 3300025905 Ga0207685_10000025 Ga0207685_1000002573 352
335 3300025916 Ga0207663_10008144 Ga0207663_100081442 352
336 3300025917 Ga0207660_10054223 Ga0207660_100542232 352
337 3300025921 Ga0207652_10000309 Ga0207652_100003099 352
338 3300025924 Ga0207694_10000056 Ga0207694_1000005670 352
339 3300025927 Ga0207687_10000020 Ga0207687_1000002079 352
340 3300025933 Ga0207706_10000017 Ga0207706_10000017102 352
341 3300025934 Ga0207686_10000061 Ga0207686_1000006185 352
342 3300025937 Ga0207669_10000056 Ga0207669_1000005614 352
343 3300025960 Ga0207651_10000459 Ga0207651_1000045912 352
344 3300025961 Ga0207712_10000019 Ga0207712_10000019231 352
345 3300026023 Ga0207677_10000299 Ga0207677_1000029914 352
346 3300026078 Ga0207702_10417503 Ga0207702_104175032 352
347 3300026088 Ga0207641_10000077 Ga0207641_1000007754 352
348 3300026089 Ga0207648_10005127 Ga0207648_100051272 352
349 3300028379 Ga0268266_10412765 Ga0268266_104127651 352
350 3300028381 Ga0268264_10002912 Ga0268264_1000291212 352
351 3300036401 Ga0373937_0034175 Ga0373937_0034175_1257_2315 352
352 3300046454 Ga0495592_0000318 Ga0495592_0000318_34414_35472 352
353 3300046454 Ga0495592_0047549 Ga0495592_0047549_535_1593 352
354 3300046454 Ga0495592_0118496 Ga0495592_0118496_135_1193 352
355 3300046455 Ga0495603_0000613 Ga0495603_0000613_16832_17890 352
356 3300046459 Ga0495629_0011616 Ga0495629_0011616_2272_3330 352
357 3300046461 Ga0495641_0057715 Ga0495641_0057715_272_1330 352
358 3300046463 Ga0495653_0020802 Ga0495653_0020802_1009_2067 352
359 3300046476 Ga0495662_0000492 Ga0495662_0000492_15141_16214 352
360 3300046511 Ga0495608_0000183 Ga0495608_0000183_6429_7487 352
361 3300046514 Ga0495618_0000144 Ga0495618_0000144_26405_27478 352
362 3300046516 Ga0495628_0000044 Ga0495628_0000044_84708_85766 352
363 3300046517 Ga0495630_0000012 Ga0495630_0000012_159872_160930 352
364 3300046517 Ga0495630_0007552 Ga0495630_0007552_4285_5358 352
365 3300046523 Ga0495644_0001780 Ga0495644_0001780_2556_3614 352
366 3300046529 Ga0495652_0000023 Ga0495652_0000023_82172_83230 352
367 3300046533 Ga0495640_0004033 Ga0495640_0004033_3194_4252 352
368 3300046535 Ga0495586_0001338 Ga0495586_0001338_2726_3784 352
369 3300046536 Ga0495587_0017812 Ga0495587_0017812_2022_3080 352
370 3300046536 Ga0495587_0071089 Ga0495587_0071089_227_1285 352
371 3300046537 Ga0495598_0007346 Ga0495598_0007346_255_1322 352
372 3300046543 Ga0495645_0105365 Ga0495645_0105365_712_1779 352
373 3300046642 Ga0495634_0000031 Ga0495634_0000031_27439_28497 352
374 3300046660 Ga0495625_0000453 Ga0495625_0000453_36429_37487 352
375 3300046663 Ga0495635_0000005 Ga0495635_0000005_225560_226618 352
376 3300046675 Ga0495657_0019804 Ga0495657_0019804_3271_4329 352
377 3300046680 Ga0495646_0152618 Ga0495646_0152618_159_1217 352
378 3300046681 Ga0495647_0000009 Ga0495647_0000009_44455_45513 352
379 3300046681 Ga0495647_0000047 Ga0495647_0000047_3026_4084 352
380 3300046681 Ga0495647_0004056 Ga0495647_0004056_2614_3672 352
381 3300046684 Ga0495669_0000121 Ga0495669_0000121_15846_16904 352
382 3300046689 Ga0495613_0000321 Ga0495613_0000321_31709_32782 352
383 3300046690 Ga0495624_0000038 Ga0495624_0000038_47299_48357 352
384 3300046690 Ga0495624_0000414 Ga0495624_0000414_6532_7590 352
385 3300046809 Ga0495600_0063283 Ga0495600_0063283_1309_2382 352
386 3300047317 Ga0495604_0000317 Ga0495604_0000317_15693_16766 352
387 3300047317 Ga0495604_0004919 Ga0495604_0004919_1774_2832 352
388 3300047322 Ga0495680_0004808 Ga0495680_0004808_1330_2403 352
389 3300047471 Ga0495684_0212221 Ga0495684_0212221_100_1158 352
390 3300048088 Ga0495602_0000055 Ga0495602_0000055_92625_93683 352
391 3300048088 Ga0495602_0005211 Ga0495602_0005211_3211_4269 352
392 3300048903 Ga0496100_0000014 Ga0496100_0000014_86724_87782 352
393 3300048904 Ga0496101_0000036 Ga0496101_0000036_87328_88386 352
394 3300048907 Ga0496104_0000024 Ga0496104_0000024_86331_87389 352
395 3300048907 Ga0496104_0000077 Ga0496104_0000077_84141_85199 352
396 3300048907 Ga0496104_0001134 Ga0496104_0001134_20190_21248 352
397 3300048908 Ga0496105_0000004 Ga0496105_0000004_15650_16708 352
398 3300048908 Ga0496105_0000013 Ga0496105_0000013_142525_143583 352
399 3300048908 Ga0496105_0000101 Ga0496105_0000101_45367_46425 352
400 3300048908 Ga0496105_0023832 Ga0496105_0023832_809_1867 352
401 3300048909 Ga0496106_0000043 Ga0496106_0000043_21649_22707 352
402 3300048909 Ga0496106_0000213 Ga0496106_0000213_18085_19143 352
403 3300048910 Ga0496107_0000022 Ga0496107_0000022_40724_41782 352
404 3300048910 Ga0496107_0065012 Ga0496107_0065012_1021_2079 352
405 3300048911 Ga0496108_0000006 Ga0496108_0000006_144656_145714 352
406 3300048911 Ga0496108_0000055 Ga0496108_0000055_102228_103289 352
407 3300048912 Ga0496109_0000004 Ga0496109_0000004_317399_318457 352
408 3300048912 Ga0496109_0000043 Ga0496109_0000043_107603_108664 352
409 3300048915 Ga0496112_0000013 Ga0496112_0000013_15750_16820 352
410 3300048916 Ga0496113_0094382 Ga0496113_0094382_294_1364 352
411 3300048917 Ga0496114_0004451 Ga0496114_0004451_2961_4028 352
412 3300048918 Ga0496115_0027547 Ga0496115_0027547_64_1122 352
413 3300049578 Ga0501042_0037027 Ga0501042_0037027_1081_2139 352
414 3300049578 Ga0501042_0092029 Ga0501042_0092029_985_2043 352
415 3300049582 Ga0501048_0068219 Ga0501048_0068219_1360_2418 352
416 3300049591 Ga0501075_0002006 Ga0501075_0002006_2752_3810 352
417 3300049592 Ga0501076_0011541 Ga0501076_0011541_1035_2093 352
418 3300050515 nmdc:mga0a205_61_c1 nmdc:mga0a205_61_c1_41808_42866 352
419 3300053077 Ga0495601_0000104 Ga0495601_0000104_29225_30292 352
420 3300053077 Ga0495601_0005548 Ga0495601_0005548_4754_5812 352
421 3300053077 Ga0495601_0066513 Ga0495601_0066513_1217_2275 352
422 3300053078 Ga0495612_0008885 Ga0495612_0008885_383_1450 352
423 3300053078 Ga0495612_0018897 Ga0495612_0018897_28_1086 352
424 3300053084 Ga0495595_0000269 Ga0495595_0000269_13206_14264 352
425 3300053084 Ga0495595_0003435 Ga0495595_0003435_4290_5348 352
426 3300053085 Ga0495619_0001270 Ga0495619_0001270_9119_10177 352
427 3300053085 Ga0495619_0068398 Ga0495619_0068398_387_1445 352
428 3300053085 Ga0495619_0185172 Ga0495619_0185172_363_1421 352

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01409

tRNA-synt_2d

tRNA synthetases class II core domain (F)

145

414

0.98

PF02912

Phe_tRNA-synt_N

Aminoacyl tRNA synthetase class II, N-terminal domain

71

141

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p75-assembly1.cif.gz_C phers in complex with compound 4a 0.8683 91 352
4p73-assembly1.cif.gz_C phers in complex with compound 1a 0.8652 91 352
4p75-assembly1.cif.gz_C phers in complex with compound 4a 0.8648 91 352
6p24-assembly1.cif.gz_A escherichia coli trna synthetase 0.863 91 352
4p75-assembly1.cif.gz_D phers in complex with compound 4a 0.8611 89 352
ID Description Score Start End Superfamily
4p73C01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9093 108 352 3.30.930.10
4p73C01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9054 108 352 3.30.930.10
af_Q2QPD4_79_354_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8286 110 346 3.30.930.10
2rhsC00 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8163 81 351 3.30.930.10
af_Q94K73_217_334_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8078 225 352 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A2J0M6H5-F1-model_v4 Phenylalanine--tRNA ligase subunit alpha (EC 6.1.1.20) 0.9855 1 83 GO:0004826
GO:0005524
GO:0005737
GO:0006432
AF-A0A497C9M6-F1-model_v4 Phenylalanine--tRNA ligase subunit alpha 0.9754 1 82 GO:0004826
GO:0005524
GO:0005737
GO:0006432
AF-A0A2V6ZRL8-F1-model_v4 Phenylalanine--tRNA ligase subunit alpha 0.9697 4 85 GO:0004826
GO:0005524
GO:0005737
GO:0006432
AF-A0A2J0M6H5-F1-model_v4 Phenylalanine--tRNA ligase subunit alpha (EC 6.1.1.20) 0.9626 1 83 GO:0004826
GO:0005524
GO:0005737
GO:0006432
AF-A0A0B4EFJ3-F1-model_v4 Phenylalanine-tRNA ligase class II N-terminal domain-containing protein 0.9618 1 86 GO:0004826
GO:0005524
GO:0005737
GO:0006432

Feature Viewer

pLDDT pTM Quality
86.88 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map