F441475

General Info

Members Datasets Scaffolds Average Seq Length
427 247 854 137

Family's Representative Sequence

Representative Sequence 3300031090|Ga0265760_10047259|Ga0265760_100472592
Length 149
Sequence MTQSDLITGLLKTARTIAVVGLSRNPMRASHGVSAYMRSHGYRIIPVNPKIEECLGEKAYPSLLDIPQNDSRGKDASDKNGPLKIDIVNIFRRAEFVEEIVDQAIQLKVPAIWMQEGVIHEKAAEKARQAGIFVVMDLCILKERRARFR

Samples

Sample ID Description Type Environment
1 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
109 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
112 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
113 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
114 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
179 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
180 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
181 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
182 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
185 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
186 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
195 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
196 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
197 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
206 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
207 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
208 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
213 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
214 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
215 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
219 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
240 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
241 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
242 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
245 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
246 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 1.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.45
Rhizosphere 94.61
Stem 0
Stem Tuber 0
Unclassified 29.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265760_10047259 3300031090 Bacteria 1292
2 MRS1b_contig_4190834 2162886011 Unclassified 1817
3 MBSR1b_contig_501161 2162886012 Bacteria 2112
4 MBSR1b_contig_7733866 2162886012 Bacteria 2112
5 JGI24752J21851_1007922 3300001976 Unclassified 1384
6 JGI24747J21853_1003465 3300001978 Unclassified 1366
7 JGI24737J22298_10100184 3300001990 Unclassified 858
8 JGI24738J21930_10041502 3300002075 Unclassified 935
9 JGI24033J26618_1039385 3300002155 Unclassified 656
10 JGI24034J26672_10001340 3300002239 Bacteria 3254
11 JGI24751J29686_10024043 3300002459 Unclassified 1263
12 Ga0065704_10493203 3300005289 Unclassified 673
13 Ga0065712_10101806 3300005290 Bacteria 2024
14 Ga0065715_10151402 3300005293 Unclassified 1725
15 Ga0065707_10174321 3300005295 Unclassified 1462
16 Ga0070658_10154060 3300005327 Unclassified 1926
17 Ga0070676_10001648 3300005328 Bacteria 11366
18 Ga0070676_10935466 3300005328 Unclassified 647
19 Ga0070683_100003077 3300005329 Bacteria 13433
20 Ga0070683_100342689 3300005329 Bacteria 1423
21 Ga0070690_100003425 3300005330 Bacteria 8676
22 Ga0070670_100236002 3300005331 Unclassified 1592
23 Ga0070670_100908266 3300005331 Unclassified 798
24 Ga0070666_10140594 3300005335 Unclassified 1681
25 Ga0070682_100011564 3300005337 Bacteria 5047
26 Ga0068868_100272229 3300005338 Bacteria 1431
27 Ga0070660_100040414 3300005339 Bacteria 3549
28 Ga0070689_100004451 3300005340 Bacteria 9471
29 Ga0070687_100003451 3300005343 Bacteria 6138
30 Ga0070661_100014697 3300005344 Bacteria 5521
31 Ga0070668_100002891 3300005347 Bacteria 12673
32 Ga0070675_100056455 3300005354 Bacteria 3236
33 Ga0070671_100542478 3300005355 Unclassified 1002
34 Ga0070674_100019733 3300005356 Bacteria 4289
35 Ga0070673_100001572 3300005364 Bacteria 13451
36 Ga0070688_100005169 3300005365 Bacteria 6848
37 Ga0070659_100004505 3300005366 Bacteria 9950
38 Ga0070667_100037545 3300005367 Bacteria 4061
39 Ga0070709_10006837 3300005434 Bacteria 6229
40 Ga0070709_10170954 3300005434 Bacteria 1518
41 Ga0070709_10257328 3300005434 Bacteria 1260
42 Ga0070709_10284480 3300005434 Bacteria 1203
43 Ga0070714_100014536 3300005435 Bacteria 6327
44 Ga0070714_100039268 3300005435 Bacteria 3984
45 Ga0070714_100112923 3300005435 Bacteria 2408
46 Ga0070714_100124422 3300005435 Unclassified 2297
47 Ga0070714_100263128 3300005435 Unclassified 1598
48 Ga0070714_100293421 3300005435 Bacteria 1514
49 Ga0070714_100468301 3300005435 Bacteria 1198
50 Ga0070714_101633309 3300005435 Bacteria 630
51 Ga0070714_101662649 3300005435 Unclassified 624
52 Ga0070713_100000113 3300005436 Bacteria 52925
53 Ga0070713_100030892 3300005436 Bacteria 4260
54 Ga0070713_100035893 3300005436 Bacteria 3996
55 Ga0070713_100067699 3300005436 Bacteria 3007
56 Ga0070713_100171906 3300005436 Bacteria 1942
57 Ga0070713_100176592 3300005436 Bacteria 1917
58 Ga0070713_100251022 3300005436 Bacteria 1613
59 Ga0070713_100410355 3300005436 Bacteria 1266
60 Ga0070713_100415495 3300005436 Unclassified 1258
61 Ga0070713_100964038 3300005436 Unclassified 822
62 Ga0070710_10003029 3300005437 Bacteria 7990
63 Ga0070710_10005123 3300005437 Bacteria 6201
64 Ga0070710_10044570 3300005437 Bacteria 2461
65 Ga0070710_10191656 3300005437 Unclassified 1286
66 Ga0070710_10434313 3300005437 Bacteria 887
67 Ga0070710_10605470 3300005437 Unclassified 763
68 Ga0070711_100008427 3300005439 Bacteria 6316
69 Ga0070711_100018979 3300005439 Bacteria 4401
70 Ga0070711_100619370 3300005439 Unclassified 905
71 Ga0070711_101327670 3300005439 Bacteria 624
72 Ga0070708_100012137 3300005445 Bacteria 7023
73 Ga0070708_100245349 3300005445 Bacteria 1682
74 Ga0070708_100861760 3300005445 Bacteria 851
75 Ga0070663_100005372 3300005455 Bacteria 7609
76 Ga0070678_100126716 3300005456 Unclassified 2022
77 Ga0070681_10012701 3300005458 Bacteria 8358
78 Ga0068867_100077613 3300005459 Bacteria 2496
79 Ga0070685_10003177 3300005466 Bacteria 8356
80 Ga0070706_100100847 3300005467 Bacteria 2683
81 Ga0070706_100118327 3300005467 Bacteria 2468
82 Ga0070707_100005562 3300005468 Bacteria 11770
83 Ga0070707_100284897 3300005468 Bacteria 1605
84 Ga0070707_101179000 3300005468 Bacteria 732
85 Ga0070698_100224385 3300005471 Bacteria 1812
86 Ga0070699_100001170 3300005518 Bacteria 24337
87 Ga0070699_101051498 3300005518 Unclassified 747
88 Ga0070679_100753090 3300005530 Bacteria 917
89 Ga0070684_100010728 3300005535 Bacteria 7272
90 Ga0070684_100150580 3300005535 Bacteria 2108
91 Ga0070697_100007958 3300005536 Bacteria 8261
92 Ga0070697_100013390 3300005536 Bacteria 6432
93 Ga0070697_100283569 3300005536 Bacteria 1421
94 Ga0070697_101879849 3300005536 Unclassified 536
95 Ga0068853_100085098 3300005539 Bacteria 2771
96 Ga0070672_100013361 3300005543 Bacteria 5798
97 Ga0070686_100005348 3300005544 Bacteria 7102
98 Ga0070695_100064328 3300005545 Bacteria 2386
99 Ga0070693_100028826 3300005547 Unclassified 3022
100 Ga0070693_100443702 3300005547 Unclassified 909
101 Ga0070665_101144129 3300005548 Unclassified 789
102 Ga0068855_100991996 3300005563 Unclassified 883
103 Ga0068855_101033862 3300005563 Bacteria 862
104 Ga0070664_100026537 3300005564 Unclassified 4806
105 Ga0068857_100009427 3300005577 Bacteria 8472
106 Ga0068854_100076449 3300005578 Unclassified 2461
107 Ga0068856_100112051 3300005614 Bacteria 2726
108 Ga0068856_100233298 3300005614 Unclassified 1855
109 Ga0068856_100371354 3300005614 Bacteria 1449
110 Ga0070702_100082647 3300005615 Unclassified 1927
111 Ga0068852_100009082 3300005616 Bacteria 7360
112 Ga0068859_100022702 3300005617 Bacteria 6291
113 Ga0068864_100008839 3300005618 Bacteria 8305
114 Ga0068861_100026567 3300005719 Bacteria 4210
115 Ga0068851_10012328 3300005834 Bacteria 4027
116 Ga0068870_10004874 3300005840 Bacteria 5806
117 Ga0068863_100015122 3300005841 Bacteria 7413
118 Ga0068863_100397710 3300005841 Unclassified 1347
119 Ga0068858_100017935 3300005842 Bacteria 6629
120 Ga0068858_100457819 3300005842 Bacteria 1230
121 Ga0068860_100142751 3300005843 Bacteria 2302
122 Ga0068860_100146607 3300005843 Bacteria 2271
123 Ga0068862_100022651 3300005844 Bacteria 5256
124 Ga0070717_10009857 3300006028 Bacteria 7195
125 Ga0070717_10013813 3300006028 Bacteria 6200
126 Ga0070717_10015984 3300006028 Bacteria 5810
127 Ga0070717_10017523 3300006028 Bacteria 5575
128 Ga0070717_10102677 3300006028 Bacteria 2429
129 Ga0070717_10112688 3300006028 Bacteria 2322
130 Ga0070717_10145467 3300006028 Unclassified 2047
131 Ga0070717_10235576 3300006028 Bacteria 1613
132 Ga0070717_10252303 3300006028 Bacteria 1559
133 Ga0070717_10374042 3300006028 Bacteria 1277
134 Ga0070717_10843083 3300006028 Unclassified 834
135 Ga0070715_10004001 3300006163 Bacteria 4778
136 Ga0070716_100000245 3300006173 Bacteria 21690
137 Ga0070716_100001153 3300006173 Bacteria 11654
138 Ga0070716_100024938 3300006173 Bacteria 3185
139 Ga0070716_100035493 3300006173 Bacteria 2742
140 Ga0070716_100078053 3300006173 Bacteria 1967
141 Ga0070716_101307488 3300006173 Unclassified 586
142 Ga0070712_100008118 3300006175 Bacteria 6591
143 Ga0070712_100025838 3300006175 Bacteria 3907
144 Ga0070712_100194390 3300006175 Bacteria 1590
145 Ga0070712_100470963 3300006175 Bacteria 1049
146 Ga0097621_100007216 3300006237 Bacteria 7930
147 Ga0097621_100118560 3300006237 Bacteria 2243
148 Ga0097621_100489426 3300006237 Unclassified 1113
149 Ga0068871_100572786 3300006358 Unclassified 1024
150 Ga0068865_100009158 3300006881 Bacteria 6127
151 Ga0075436_101330738 3300006914 Bacteria 544
152 Ga0097620_100022702 3300006931 Bacteria 6291
153 Ga0105250_10017649 3300009092 Bacteria 2900
154 Ga0105240_10078615 3300009093 Bacteria 4062
155 Ga0105240_10588866 3300009093 Bacteria 1226
156 Ga0111539_10609928 3300009094 Unclassified 1271
157 Ga0105245_10098239 3300009098 Bacteria 2705
158 Ga0105245_10102102 3300009098 Unclassified 2655
159 Ga0105247_10004129 3300009101 Bacteria 9322
160 Ga0105241_10022956 3300009174 Bacteria 4625
161 Ga0105241_10113933 3300009174 Bacteria 2168
162 Ga0105242_10079129 3300009176 Unclassified 2745
163 Ga0105242_10511182 3300009176 Unclassified 1144
164 Ga0105248_10176903 3300009177 Bacteria 2404
165 Ga0105237_10051034 3300009545 Bacteria 4157
166 Ga0105237_10413316 3300009545 Bacteria 1354
167 Ga0105237_10517497 3300009545 Unclassified 1200
168 Ga0105237_10606776 3300009545 Bacteria 1101
169 Ga0105249_10009792 3300009553 Bacteria 8397
170 Ga0105239_10044199 3300010375 Bacteria 4883
171 Ga0105246_10010240 3300011119 Bacteria 5791
172 Ga0157373_10021155 3300013100 Bacteria 4722
173 Ga0157371_10009218 3300013102 Bacteria 7787
174 Ga0157369_10028986 3300013105 Bacteria 6122
175 Ga0157369_10048522 3300013105 Bacteria 4607
176 Ga0157374_10006490 3300013296 Bacteria 9930
177 Ga0157374_10019562 3300013296 Bacteria 5994
178 Ga0157374_10167885 3300013296 Unclassified 2140
179 Ga0157378_10407094 3300013297 Unclassified 1342
180 Ga0157378_10541322 3300013297 Bacteria 1168
181 Ga0163162_10022397 3300013306 Bacteria 6225
182 Ga0163162_10054277 3300013306 Bacteria 4031
183 Ga0157372_10005586 3300013307 Bacteria 13369
184 Ga0157372_10015312 3300013307 Bacteria 8216
185 Ga0157372_10016900 3300013307 Bacteria 7833
186 Ga0157375_10018555 3300013308 Bacteria 6311
187 Ga0157375_10272731 3300013308 Unclassified 1854
188 Ga0163163_10025164 3300014325 Bacteria 5673
189 Ga0163163_10521060 3300014325 Bacteria 1251
190 Ga0157380_10911259 3300014326 Bacteria 906
191 Ga0157380_11763780 3300014326 Unclassified 678
192 Ga0157379_10039237 3300014968 Bacteria 4224
193 Ga0157379_10063920 3300014968 Bacteria 3290
194 Ga0157376_10017765 3300014969 Bacteria 5435
195 Ga0157376_11288187 3300014969 Bacteria 761
196 Ga0182007_10267649 3300015262 Unclassified 618
197 Ga0182007_10316336 3300015262 Unclassified 577
198 Ga0182005_1045387 3300015265 Unclassified 1194
199 Ga0182005_1245979 3300015265 Unclassified 552
200 Ga0163161_10008086 3300017792 Bacteria 7274
201 Ga0213874_10035922 3300021377 Bacteria 1458
202 Ga0224569_100255 3300022732 Bacteria 4421
203 Ga0224571_100033 3300022734 Bacteria 4422
204 Ga0224571_100509 3300022734 Bacteria 2166
205 Ga0228598_1000642 3300024227 Bacteria 7357
206 Ga0228598_1011375 3300024227 Unclassified 1770
207 Ga0207697_10014742 3300025315 Unclassified 3238
208 Ga0207692_10010802 3300025898 Bacteria 3863
209 Ga0207692_10045696 3300025898 Bacteria 2192
210 Ga0207692_10197856 3300025898 Unclassified 1180
211 Ga0207692_10270596 3300025898 Unclassified 1024
212 Ga0207642_10020629 3300025899 Unclassified 2577
213 Ga0207710_10003632 3300025900 Bacteria 6840
214 Ga0207688_10009224 3300025901 Bacteria 5375
215 Ga0207680_10021065 3300025903 Unclassified 3521
216 Ga0207647_10005628 3300025904 Bacteria 9149
217 Ga0207685_10003117 3300025905 Bacteria 3964
218 Ga0207699_10002798 3300025906 Bacteria 8245
219 Ga0207699_10013769 3300025906 Bacteria 4150
220 Ga0207699_10077890 3300025906 Bacteria 2047
221 Ga0207699_10084603 3300025906 Unclassified 1976
222 Ga0207699_10342677 3300025906 Unclassified 1053
223 Ga0207645_10000559 3300025907 Bacteria 30910
224 Ga0207643_10001182 3300025908 Bacteria 15496
225 Ga0207705_10287408 3300025909 Unclassified 1260
226 Ga0207684_10113107 3300025910 Bacteria 2324
227 Ga0207684_10431332 3300025910 Bacteria 1132
228 Ga0207654_10023508 3300025911 Bacteria 3302
229 Ga0207654_10318257 3300025911 Bacteria 1063
230 Ga0207707_10091541 3300025912 Bacteria 2658
231 Ga0207695_10026452 3300025913 Bacteria 6476
232 Ga0207695_10056346 3300025913 Bacteria 4090
233 Ga0207671_10703752 3300025914 Bacteria 803
234 Ga0207693_10000015 3300025915 Bacteria 147464
235 Ga0207693_10010759 3300025915 Bacteria 7429
236 Ga0207693_10054774 3300025915 Unclassified 3128
237 Ga0207693_10067694 3300025915 Unclassified 2796
238 Ga0207693_10196529 3300025915 Unclassified 1587
239 Ga0207663_10317788 3300025916 Bacteria 1169
240 Ga0207663_10333305 3300025916 Bacteria 1144
241 Ga0207663_10664144 3300025916 Unclassified 823
242 Ga0207663_11320137 3300025916 Unclassified 581
243 Ga0207662_10000619 3300025918 Bacteria 15920
244 Ga0207657_10001795 3300025919 Bacteria 23148
245 Ga0207649_10000344 3300025920 Bacteria 35179
246 Ga0207652_10035456 3300025921 Bacteria 4211
247 Ga0207646_10027063 3300025922 Bacteria 5229
248 Ga0207646_10109821 3300025922 Bacteria 2475
249 Ga0207646_10289289 3300025922 Bacteria 1481
250 Ga0207646_10796004 3300025922 Unclassified 842
251 Ga0207681_10050296 3300025923 Bacteria 2819
252 Ga0207650_10000058 3300025925 Bacteria 153056
253 Ga0207650_10469778 3300025925 Unclassified 1049
254 Ga0207659_10113571 3300025926 Bacteria 2063
255 Ga0207687_10263497 3300025927 Unclassified 1375
256 Ga0207687_10531488 3300025927 Unclassified 985
257 Ga0207700_10000373 3300025928 Bacteria 26215
258 Ga0207700_10096705 3300025928 Unclassified 2345
259 Ga0207700_10100908 3300025928 Bacteria 2301
260 Ga0207700_10135772 3300025928 Bacteria 2015
261 Ga0207700_10180668 3300025928 Bacteria 1766
262 Ga0207700_10220355 3300025928 Bacteria 1608
263 Ga0207700_10348210 3300025928 Bacteria 1289
264 Ga0207700_10530576 3300025928 Unclassified 1043
265 Ga0207700_10540667 3300025928 Bacteria 1033
266 Ga0207700_10673049 3300025928 Unclassified 923
267 Ga0207700_11144274 3300025928 Bacteria 695
268 Ga0207700_11624145 3300025928 Bacteria 571
269 Ga0207664_10015715 3300025929 Bacteria 5503
270 Ga0207664_10106953 3300025929 Unclassified 2320
271 Ga0207664_10282538 3300025929 Bacteria 1456
272 Ga0207664_10388267 3300025929 Bacteria 1240
273 Ga0207664_11917882 3300025929 Unclassified 515
274 Ga0207644_10007500 3300025931 Bacteria 7114
275 Ga0207690_10028926 3300025932 Bacteria 3517
276 Ga0207706_10000732 3300025933 Bacteria 34191
277 Ga0207670_10055755 3300025936 Bacteria 2672
278 Ga0207669_10006257 3300025937 Bacteria 5426
279 Ga0207704_10012011 3300025938 Bacteria 4285
280 Ga0207665_10000049 3300025939 Bacteria 76350
281 Ga0207665_10012550 3300025939 Bacteria 5566
282 Ga0207665_10029565 3300025939 Unclassified 3622
283 Ga0207665_10032177 3300025939 Bacteria 3473
284 Ga0207665_10046157 3300025939 Bacteria 2919
285 Ga0207691_10003257 3300025940 Bacteria 15809
286 Ga0207711_10008849 3300025941 Bacteria 8417
287 Ga0207689_10003330 3300025942 Bacteria 14717
288 Ga0207661_10000328 3300025944 Bacteria 30179
289 Ga0207679_10000141 3300025945 Bacteria 59703
290 Ga0207679_10190238 3300025945 Bacteria 1706
291 Ga0207667_10307256 3300025949 Unclassified 1620
292 Ga0207651_10001206 3300025960 Bacteria 11571
293 Ga0207712_10252223 3300025961 Unclassified 1427
294 Ga0207668_10195573 3300025972 Unclassified 1606
295 Ga0207640_10483333 3300025981 Unclassified 1028
296 Ga0207658_10023303 3300025986 Bacteria 4320
297 Ga0207677_10020506 3300026023 Bacteria 4014
298 Ga0207677_10815421 3300026023 Bacteria 836
299 Ga0207703_10025153 3300026035 Bacteria 4683
300 Ga0207639_10021194 3300026041 Bacteria 4665
301 Ga0207678_10000143 3300026067 Bacteria 58580
302 Ga0207702_10069485 3300026078 Bacteria 3028
303 Ga0207702_10370868 3300026078 Unclassified 1374
304 Ga0207702_11085493 3300026078 Unclassified 794
305 Ga0207702_11630996 3300026078 Unclassified 638
306 Ga0207641_10000323 3300026088 Bacteria 58693
307 Ga0207641_12403935 3300026088 Unclassified 526
308 Ga0207648_10000870 3300026089 Bacteria 34025
309 Ga0207676_10001926 3300026095 Bacteria 15155
310 Ga0207674_10008508 3300026116 Bacteria 11847
311 Ga0207675_100007145 3300026118 Bacteria 10553
312 Ga0207683_10000493 3300026121 Bacteria 36475
313 Ga0207698_10095658 3300026142 Unclassified 2446
314 Ga0268266_10016009 3300028379 Bacteria 6413
315 Ga0268266_10861358 3300028379 Bacteria 876
316 Ga0268265_10009683 3300028380 Bacteria 6504
317 Ga0268264_10034215 3300028381 Bacteria 4178
318 Ga0265338_10026207 3300028800 Bacteria 5888
319 Ga0265338_10140405 3300028800 Unclassified 1893
320 Ga0265338_10322694 3300028800 Unclassified 1117
321 Ga0265760_10001119 3300031090 Bacteria 7779
322 Ga0265760_10001586 3300031090 Bacteria 6698
323 Ga0265760_10031298 3300031090 Bacteria 1569
324 Ga0265760_10033273 3300031090 Bacteria 1523
325 Ga0265339_10022309 3300031249 Bacteria 3669
326 Ga0265339_10051960 3300031249 Bacteria 2234
327 Ga0265316_10291513 3300031344 Unclassified 1190
328 Ga0373926_0249657 3300035083 Unclassified 688
329 Ga0373923_0008899 3300035111 Bacteria 3602
330 Ga0373923_0304099 3300035111 Unclassified 755
331 Ga0373936_0012578 3300035113 Bacteria 3222
332 Ga0373936_0325482 3300035113 Unclassified 697
333 Ga0373956_0198567 3300035119 Unclassified 950
334 Ga0373943_0467468 3300035170 Unclassified 734
335 Ga0373943_0607455 3300035170 Unclassified 645
336 Ga0373946_0226591 3300035171 Unclassified 904
337 Ga0373935_0064151 3300035692 Bacteria 2355
338 Ga0373935_0248130 3300035692 Bacteria 1245
339 Ga0373935_0677455 3300035692 Bacteria 758
340 Ga0373927_0559979 3300035695 Bacteria 755
341 Ga0373927_0752283 3300035695 Unclassified 644
342 Ga0373933_0144831 3300035724 Unclassified 1502
343 Ga0373933_0446215 3300035724 Bacteria 846
344 Ga0373947_0078960 3300035725 Bacteria 2033
345 Ga0373947_0239594 3300035725 Bacteria 1197
346 Ga0373947_0496184 3300035725 Bacteria 829
347 Ga0373937_0649133 3300036401 Bacteria 1001
348 Ga0373937_1488750 3300036401 Unclassified 624
349 Ga0373925_0004570 3300037068 Bacteria 10457
350 Ga0373925_0166944 3300037068 Bacteria 1736
351 Ga0373925_1148945 3300037068 Unclassified 638
352 Ga0373925_1270236 3300037068 Bacteria 604
353 Ga0395905_0237454 3300037471 Unclassified 1704
354 Ga0436363_0493222 3300039450 Bacteria 1928
355 Ga0436363_0866170 3300039450 Bacteria 4928
356 Ga0451839_0889389 3300041496 Unclassified 600
357 Ga0466963_0007270 3300044694 Bacteria 6603
358 Ga0466963_0188917 3300044694 Bacteria 1439
359 Ga0466963_0819677 3300044694 Bacteria 656
360 Ga0466959_0283390 3300045049 Bacteria 1137
361 Ga0451576_0473365 3300045051 Bacteria 1316
362 Ga0466958_0380570 3300045836 Unclassified 910
363 Ga0466967_0060516 3300045976 Bacteria 3356
364 Ga0466967_0134715 3300045976 Bacteria 2296
365 Ga0466967_1101663 3300045976 Unclassified 791
366 Ga0495592_0217379 3300046454 Bacteria 1280
367 Ga0495629_0243768 3300046459 Bacteria 1237
368 Ga0495580_0001180 3300046472 Bacteria 22962
369 Ga0495580_0002094 3300046472 Bacteria 17511
370 Ga0495580_0003072 3300046472 Bacteria 14295
371 Ga0495580_0006723 3300046472 Bacteria 9336
372 Ga0495580_0140165 3300046472 Bacteria 1676
373 Ga0495580_0203016 3300046472 Bacteria 1365
374 Ga0495580_0482449 3300046472 Bacteria 829
375 Ga0495580_0684559 3300046472 Bacteria 672
376 Ga0495582_0235772 3300046473 Unclassified 1048
377 Ga0495594_0054550 3300046499 Bacteria 2203
378 Ga0495608_0325535 3300046511 Unclassified 949
379 Ga0495618_0711816 3300046514 Unclassified 590
380 Ga0495665_0266656 3300046531 Bacteria 880
381 Ga0495640_0254899 3300046533 Bacteria 1098
382 Ga0495586_0118133 3300046535 Bacteria 1480
383 Ga0495586_0515361 3300046535 Bacteria 690
384 Ga0495645_0049247 3300046543 Bacteria 3069
385 Ga0495635_0103395 3300046663 Unclassified 1947
386 Ga0495657_0570337 3300046675 Unclassified 656
387 Ga0495599_0330519 3300046678 Bacteria 916
388 Ga0495646_0410226 3300046680 Unclassified 703
389 Ga0495669_0206064 3300046684 Unclassified 941
390 Ga0495613_0076953 3300046689 Unclassified 2428
391 Ga0495670_0144233 3300046691 Unclassified 1247
392 Ga0495581_0299657 3300047315 Unclassified 939
393 Ga0495674_0007675 3300047319 Bacteria 10303
394 Ga0495674_0495232 3300047319 Unclassified 978
395 Ga0495674_0645299 3300047319 Unclassified 835
396 Ga0495602_0916688 3300048088 Unclassified 582
397 Ga0496100_0104880 3300048903 Bacteria 1954
398 Ga0496101_0544071 3300048904 Unclassified 918
399 Ga0496102_0014281 3300048905 Bacteria 6902
400 Ga0496102_0176144 3300048905 Bacteria 2014
401 Ga0496102_0605349 3300048905 Bacteria 1019
402 Ga0496104_0088636 3300048907 Bacteria 2956
403 Ga0496104_0957711 3300048907 Unclassified 760
404 Ga0496105_0181381 3300048908 Bacteria 1724
405 Ga0496106_0057951 3300048909 Bacteria 2931
406 Ga0496108_0000444 3300048911 Bacteria 33175
407 Ga0496109_0000177 3300048912 Bacteria 63414
408 Ga0496110_0001872 3300048913 Bacteria 15534
409 Ga0496111_0027587 3300048914 Bacteria 4019
410 Ga0496112_0000060 3300048915 Bacteria 74795
411 Ga0496112_0103875 3300048915 Bacteria 2812
412 Ga0496113_0002914 3300048916 Bacteria 10095
413 Ga0496114_0243816 3300048917 Unclassified 1581
414 Ga0496115_0009256 3300048918 Bacteria 7318
415 Ga0496115_1109330 3300048918 Unclassified 599
416 Ga0501040_0147465 3300049576 Bacteria 1659
417 Ga0501046_0628958 3300049580 Bacteria 760
418 Ga0501048_0173038 3300049582 Bacteria 1530
419 Ga0501075_0255499 3300049591 Bacteria 1336
420 Ga0501081_0612600 3300049743 Bacteria 815
421 Ga0501083_0214936 3300049744 Unclassified 1253
422 Ga0501045_0133452 3300049824 Unclassified 1846
423 nmdc:mga0a205_13197_c1 3300050515 Bacteria 7678
424 Ga0495601_0503406 3300053077 Bacteria 781
425 Ga0495619_1069501 3300053085 Unclassified 538
426 Ga0501084_0068136 3300054114 Bacteria 2980
427 Ga0501082_0184492 3300060353 Bacteria 1815
428 Ga0265760_10047259
429 MRS1b_contig_4190834
430 MBSR1b_contig_501161
431 MBSR1b_contig_7733866
432 JGI24752J21851_1007922
433 JGI24747J21853_1003465
434 JGI24737J22298_10100184
435 JGI24738J21930_10041502
436 JGI24033J26618_1039385
437 JGI24034J26672_10001340
438 JGI24751J29686_10024043
439 Ga0065704_10493203
440 Ga0065712_10101806
441 Ga0065715_10151402
442 Ga0065707_10174321
443 Ga0070658_10154060
444 Ga0070676_10001648
445 Ga0070676_10935466
446 Ga0070683_100003077
447 Ga0070683_100342689
448 Ga0070690_100003425
449 Ga0070670_100236002
450 Ga0070670_100908266
451 Ga0070666_10140594
452 Ga0070682_100011564
453 Ga0068868_100272229
454 Ga0070660_100040414
455 Ga0070689_100004451
456 Ga0070687_100003451
457 Ga0070661_100014697
458 Ga0070668_100002891
459 Ga0070675_100056455
460 Ga0070671_100542478
461 Ga0070674_100019733
462 Ga0070673_100001572
463 Ga0070688_100005169
464 Ga0070659_100004505
465 Ga0070667_100037545
466 Ga0070709_10006837
467 Ga0070709_10170954
468 Ga0070709_10257328
469 Ga0070709_10284480
470 Ga0070714_100014536
471 Ga0070714_100039268
472 Ga0070714_100112923
473 Ga0070714_100124422
474 Ga0070714_100263128
475 Ga0070714_100293421
476 Ga0070714_100468301
477 Ga0070714_101633309
478 Ga0070714_101662649
479 Ga0070713_100000113
480 Ga0070713_100030892
481 Ga0070713_100035893
482 Ga0070713_100067699
483 Ga0070713_100171906
484 Ga0070713_100176592
485 Ga0070713_100251022
486 Ga0070713_100410355
487 Ga0070713_100415495
488 Ga0070713_100964038
489 Ga0070710_10003029
490 Ga0070710_10005123
491 Ga0070710_10044570
492 Ga0070710_10191656
493 Ga0070710_10434313
494 Ga0070710_10605470
495 Ga0070711_100008427
496 Ga0070711_100018979
497 Ga0070711_100619370
498 Ga0070711_101327670
499 Ga0070708_100012137
500 Ga0070708_100245349
501 Ga0070708_100861760
502 Ga0070663_100005372
503 Ga0070678_100126716
504 Ga0070681_10012701
505 Ga0068867_100077613
506 Ga0070685_10003177
507 Ga0070706_100100847
508 Ga0070706_100118327
509 Ga0070707_100005562
510 Ga0070707_100284897
511 Ga0070707_101179000
512 Ga0070698_100224385
513 Ga0070699_100001170
514 Ga0070699_101051498
515 Ga0070679_100753090
516 Ga0070684_100010728
517 Ga0070684_100150580
518 Ga0070697_100007958
519 Ga0070697_100013390
520 Ga0070697_100283569
521 Ga0070697_101879849
522 Ga0068853_100085098
523 Ga0070672_100013361
524 Ga0070686_100005348
525 Ga0070695_100064328
526 Ga0070693_100028826
527 Ga0070693_100443702
528 Ga0070665_101144129
529 Ga0068855_100991996
530 Ga0068855_101033862
531 Ga0070664_100026537
532 Ga0068857_100009427
533 Ga0068854_100076449
534 Ga0068856_100112051
535 Ga0068856_100233298
536 Ga0068856_100371354
537 Ga0070702_100082647
538 Ga0068852_100009082
539 Ga0068859_100022702
540 Ga0068864_100008839
541 Ga0068861_100026567
542 Ga0068851_10012328
543 Ga0068870_10004874
544 Ga0068863_100015122
545 Ga0068863_100397710
546 Ga0068858_100017935
547 Ga0068858_100457819
548 Ga0068860_100142751
549 Ga0068860_100146607
550 Ga0068862_100022651
551 Ga0070717_10009857
552 Ga0070717_10013813
553 Ga0070717_10015984
554 Ga0070717_10017523
555 Ga0070717_10102677
556 Ga0070717_10112688
557 Ga0070717_10145467
558 Ga0070717_10235576
559 Ga0070717_10252303
560 Ga0070717_10374042
561 Ga0070717_10843083
562 Ga0070715_10004001
563 Ga0070716_100000245
564 Ga0070716_100001153
565 Ga0070716_100024938
566 Ga0070716_100035493
567 Ga0070716_100078053
568 Ga0070716_101307488
569 Ga0070712_100008118
570 Ga0070712_100025838
571 Ga0070712_100194390
572 Ga0070712_100470963
573 Ga0097621_100007216
574 Ga0097621_100118560
575 Ga0097621_100489426
576 Ga0068871_100572786
577 Ga0068865_100009158
578 Ga0075436_101330738
579 Ga0097620_100022702
580 Ga0105250_10017649
581 Ga0105240_10078615
582 Ga0105240_10588866
583 Ga0111539_10609928
584 Ga0105245_10098239
585 Ga0105245_10102102
586 Ga0105247_10004129
587 Ga0105241_10022956
588 Ga0105241_10113933
589 Ga0105242_10079129
590 Ga0105242_10511182
591 Ga0105248_10176903
592 Ga0105237_10051034
593 Ga0105237_10413316
594 Ga0105237_10517497
595 Ga0105237_10606776
596 Ga0105249_10009792
597 Ga0105239_10044199
598 Ga0105246_10010240
599 Ga0157373_10021155
600 Ga0157371_10009218
601 Ga0157369_10028986
602 Ga0157369_10048522
603 Ga0157374_10006490
604 Ga0157374_10019562
605 Ga0157374_10167885
606 Ga0157378_10407094
607 Ga0157378_10541322
608 Ga0163162_10022397
609 Ga0163162_10054277
610 Ga0157372_10005586
611 Ga0157372_10015312
612 Ga0157372_10016900
613 Ga0157375_10018555
614 Ga0157375_10272731
615 Ga0163163_10025164
616 Ga0163163_10521060
617 Ga0157380_10911259
618 Ga0157380_11763780
619 Ga0157379_10039237
620 Ga0157379_10063920
621 Ga0157376_10017765
622 Ga0157376_11288187
623 Ga0182007_10267649
624 Ga0182007_10316336
625 Ga0182005_1045387
626 Ga0182005_1245979
627 Ga0163161_10008086
628 Ga0213874_10035922
629 Ga0224569_100255
630 Ga0224571_100033
631 Ga0224571_100509
632 Ga0228598_1000642
633 Ga0228598_1011375
634 Ga0207697_10014742
635 Ga0207692_10010802
636 Ga0207692_10045696
637 Ga0207692_10197856
638 Ga0207692_10270596
639 Ga0207642_10020629
640 Ga0207710_10003632
641 Ga0207688_10009224
642 Ga0207680_10021065
643 Ga0207647_10005628
644 Ga0207685_10003117
645 Ga0207699_10002798
646 Ga0207699_10013769
647 Ga0207699_10077890
648 Ga0207699_10084603
649 Ga0207699_10342677
650 Ga0207645_10000559
651 Ga0207643_10001182
652 Ga0207705_10287408
653 Ga0207684_10113107
654 Ga0207684_10431332
655 Ga0207654_10023508
656 Ga0207654_10318257
657 Ga0207707_10091541
658 Ga0207695_10026452
659 Ga0207695_10056346
660 Ga0207671_10703752
661 Ga0207693_10000015
662 Ga0207693_10010759
663 Ga0207693_10054774
664 Ga0207693_10067694
665 Ga0207693_10196529
666 Ga0207663_10317788
667 Ga0207663_10333305
668 Ga0207663_10664144
669 Ga0207663_11320137
670 Ga0207662_10000619
671 Ga0207657_10001795
672 Ga0207649_10000344
673 Ga0207652_10035456
674 Ga0207646_10027063
675 Ga0207646_10109821
676 Ga0207646_10289289
677 Ga0207646_10796004
678 Ga0207681_10050296
679 Ga0207650_10000058
680 Ga0207650_10469778
681 Ga0207659_10113571
682 Ga0207687_10263497
683 Ga0207687_10531488
684 Ga0207700_10000373
685 Ga0207700_10096705
686 Ga0207700_10100908
687 Ga0207700_10135772
688 Ga0207700_10180668
689 Ga0207700_10220355
690 Ga0207700_10348210
691 Ga0207700_10530576
692 Ga0207700_10540667
693 Ga0207700_10673049
694 Ga0207700_11144274
695 Ga0207700_11624145
696 Ga0207664_10015715
697 Ga0207664_10106953
698 Ga0207664_10282538
699 Ga0207664_10388267
700 Ga0207664_11917882
701 Ga0207644_10007500
702 Ga0207690_10028926
703 Ga0207706_10000732
704 Ga0207670_10055755
705 Ga0207669_10006257
706 Ga0207704_10012011
707 Ga0207665_10000049
708 Ga0207665_10012550
709 Ga0207665_10029565
710 Ga0207665_10032177
711 Ga0207665_10046157
712 Ga0207691_10003257
713 Ga0207711_10008849
714 Ga0207689_10003330
715 Ga0207661_10000328
716 Ga0207679_10000141
717 Ga0207679_10190238
718 Ga0207667_10307256
719 Ga0207651_10001206
720 Ga0207712_10252223
721 Ga0207668_10195573
722 Ga0207640_10483333
723 Ga0207658_10023303
724 Ga0207677_10020506
725 Ga0207677_10815421
726 Ga0207703_10025153
727 Ga0207639_10021194
728 Ga0207678_10000143
729 Ga0207702_10069485
730 Ga0207702_10370868
731 Ga0207702_11085493
732 Ga0207702_11630996
733 Ga0207641_10000323
734 Ga0207641_12403935
735 Ga0207648_10000870
736 Ga0207676_10001926
737 Ga0207674_10008508
738 Ga0207675_100007145
739 Ga0207683_10000493
740 Ga0207698_10095658
741 Ga0268266_10016009
742 Ga0268266_10861358
743 Ga0268265_10009683
744 Ga0268264_10034215
745 Ga0265338_10026207
746 Ga0265338_10140405
747 Ga0265338_10322694
748 Ga0265760_10001119
749 Ga0265760_10001586
750 Ga0265760_10031298
751 Ga0265760_10033273
752 Ga0265339_10022309
753 Ga0265339_10051960
754 Ga0265316_10291513
755 Ga0373926_0249657
756 Ga0373923_0008899
757 Ga0373923_0304099
758 Ga0373936_0012578
759 Ga0373936_0325482
760 Ga0373956_0198567
761 Ga0373943_0467468
762 Ga0373943_0607455
763 Ga0373946_0226591
764 Ga0373935_0064151
765 Ga0373935_0248130
766 Ga0373935_0677455
767 Ga0373927_0559979
768 Ga0373927_0752283
769 Ga0373933_0144831
770 Ga0373933_0446215
771 Ga0373947_0078960
772 Ga0373947_0239594
773 Ga0373947_0496184
774 Ga0373937_0649133
775 Ga0373937_1488750
776 Ga0373925_0004570
777 Ga0373925_0166944
778 Ga0373925_1148945
779 Ga0373925_1270236
780 Ga0395905_0237454
781 Ga0436363_0493222
782 Ga0436363_0866170
783 Ga0451839_0889389
784 Ga0466963_0007270
785 Ga0466963_0188917
786 Ga0466963_0819677
787 Ga0466959_0283390
788 Ga0451576_0473365
789 Ga0466958_0380570
790 Ga0466967_0060516
791 Ga0466967_0134715
792 Ga0466967_1101663
793 Ga0495592_0217379
794 Ga0495629_0243768
795 Ga0495580_0001180
796 Ga0495580_0002094
797 Ga0495580_0003072
798 Ga0495580_0006723
799 Ga0495580_0140165
800 Ga0495580_0203016
801 Ga0495580_0482449
802 Ga0495580_0684559
803 Ga0495582_0235772
804 Ga0495594_0054550
805 Ga0495608_0325535
806 Ga0495618_0711816
807 Ga0495665_0266656
808 Ga0495640_0254899
809 Ga0495586_0118133
810 Ga0495586_0515361
811 Ga0495645_0049247
812 Ga0495635_0103395
813 Ga0495657_0570337
814 Ga0495599_0330519
815 Ga0495646_0410226
816 Ga0495669_0206064
817 Ga0495613_0076953
818 Ga0495670_0144233
819 Ga0495581_0299657
820 Ga0495674_0007675
821 Ga0495674_0495232
822 Ga0495674_0645299
823 Ga0495602_0916688
824 Ga0496100_0104880
825 Ga0496101_0544071
826 Ga0496102_0014281
827 Ga0496102_0176144
828 Ga0496102_0605349
829 Ga0496104_0088636
830 Ga0496104_0957711
831 Ga0496105_0181381
832 Ga0496106_0057951
833 Ga0496108_0000444
834 Ga0496109_0000177
835 Ga0496110_0001872
836 Ga0496111_0027587
837 Ga0496112_0000060
838 Ga0496112_0103875
839 Ga0496113_0002914
840 Ga0496114_0243816
841 Ga0496115_0009256
842 Ga0496115_1109330
843 Ga0501040_0147465
844 Ga0501046_0628958
845 Ga0501048_0173038
846 Ga0501075_0255499
847 Ga0501081_0612600
848 Ga0501083_0214936
849 Ga0501045_0133452
850 nmdc:mga0a205_13197_c1
851 Ga0495601_0503406
852 Ga0495619_1069501
853 Ga0501084_0068136
854 Ga0501082_0184492

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13380

CoA_binding_2

CoA binding domain

15

145

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qa9-assembly1.cif.gz_A crystal structure of prb (ph1109 protein redesigned for binding) 0.9891 10 134
2d5a-assembly1.cif.gz_A hypothetical protein from pyrococcus horikoshii ot3 0.9819 10 137
1iul-assembly1.cif.gz_A the structure of cell-free id.343 from thermus thermophilus 0.9653 10 136
3q9n-assembly1.cif.gz_A in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.957 10 136
3q9u-assembly1.cif.gz_A in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.9534 10 136
ID Description Score Start End Superfamily
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9653 10 136 3.40.50.720
3q9nB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9475 10 137 3.40.50.720
1y81A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9145 18 130 3.40.50.720
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9096 10 136 3.40.50.720
3ff4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9002 17 136 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V9YDE1-F1-model_v4 CoA-binding protein 1.001 30 137
AF-A0A656D473-F1-model_v4 CoA-binding domain-containing protein 0.9981 8 136
AF-A0A661QS61-F1-model_v4 CoA-binding protein 0.9975 36 135
AF-A0A7C4WVZ1-F1-model_v4 CoA-binding protein 0.9961 10 136
AF-A0A2E0J1J2-F1-model_v4 CoA-binding protein 0.9957 23 137

Map