F441162

General Info

Members Datasets Scaffolds Average Seq Length
426 180 852 223

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100007432|Ga0097621_1000074325
Length 252
Sequence MPIDPSAQVAPTARVHARAIICPGVVIGDFAGSRLEPYVYVKRWTNLGERNQISAGTVLGTDPLDKGFTGARSYLKIGNGNIIREHYTISRGTAPESETVIGDENYIMTSGHIAHNCRIGNRTVIASCALVAGYAEVEDQAFISGGVVIHQYSRIGRLVMVGGNTRVNSDLPPYFLYTGFNVAAHGLNLVGLKRAGFTADDMKALKAAYRLLYRSGLKLEEALRRIEAEIPTEHARHLVSFIRASKRGICRE

Samples

Sample ID Description Type Environment
1 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
102 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
103 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
104 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
105 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
106 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
107 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
108 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
109 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
110 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
111 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
112 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
113 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
114 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
115 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
131 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
143 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
156 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
178 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 0.94
Rhizosphere 96.01
Stem 0
Stem Tuber 0
Unclassified 21.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0097621_100007432 3300006237 Bacteria 7837
2 Ga0070658_10028206 3300005327 Bacteria 4506
3 Ga0070683_100004150 3300005329 Bacteria 11870
4 Ga0070683_100019672 3300005329 Bacteria 6000
5 Ga0070683_100037655 3300005329 Unclassified 4428
6 Ga0070683_100123020 3300005329 Bacteria 2451
7 Ga0070680_100023806 3300005336 Bacteria 4888
8 Ga0068868_100023250 3300005338 Bacteria 4690
9 Ga0068868_100123652 3300005338 Bacteria 2111
10 Ga0068868_100644041 3300005338 Unclassified 943
11 Ga0070660_100015945 3300005339 Bacteria 5442
12 Ga0070660_100016917 3300005339 Bacteria 5307
13 Ga0070689_100152977 3300005340 Unclassified 1861
14 Ga0070691_10003535 3300005341 Bacteria 7047
15 Ga0070687_100349184 3300005343 Bacteria 954
16 Ga0070661_100047419 3300005344 Bacteria 3144
17 Ga0070671_100159030 3300005355 Unclassified 1909
18 Ga0070671_100594559 3300005355 Bacteria 956
19 Ga0070671_100631081 3300005355 Unclassified 927
20 Ga0070673_100436938 3300005364 Unclassified 1175
21 Ga0070688_100037875 3300005365 Bacteria 2941
22 Ga0070688_100264503 3300005365 Unclassified 1229
23 Ga0070714_100055654 3300005435 Bacteria 3382
24 Ga0070713_100001456 3300005436 Bacteria 15108
25 Ga0070713_100016417 3300005436 Bacteria 5567
26 Ga0070713_100050615 3300005436 Bacteria 3432
27 Ga0070713_100173826 3300005436 Bacteria 1931
28 Ga0070710_10145457 3300005437 Bacteria 1457
29 Ga0070711_100010239 3300005439 Bacteria 5798
30 Ga0070711_100012164 3300005439 Bacteria 5371
31 Ga0070711_100082565 3300005439 Bacteria 2294
32 Ga0070681_10002648 3300005458 Bacteria 16442
33 Ga0070681_10162145 3300005458 Bacteria 2160
34 Ga0070681_10223645 3300005458 Bacteria 1797
35 Ga0068867_100179404 3300005459 Unclassified 1683
36 Ga0070679_100000878 3300005530 Bacteria 26099
37 Ga0070679_100104619 3300005530 Bacteria 2817
38 Ga0070679_100115068 3300005530 Bacteria 2675
39 Ga0070679_100341200 3300005530 Bacteria 1446
40 Ga0070684_100005003 3300005535 Bacteria 10122
41 Ga0070684_100022569 3300005535 Bacteria 5252
42 Ga0070684_100043162 3300005535 Bacteria 3893
43 Ga0070684_100145175 3300005535 Bacteria 2147
44 Ga0070697_100233804 3300005536 Bacteria 1568
45 Ga0070697_100278825 3300005536 Bacteria 1434
46 Ga0068853_100027719 3300005539 Bacteria 4761
47 Ga0068853_100037522 3300005539 Unclassified 4123
48 Ga0068853_100288601 3300005539 Bacteria 1514
49 Ga0068853_100345126 3300005539 Bacteria 1384
50 Ga0070695_100053045 3300005545 Bacteria 2607
51 Ga0070695_100100711 3300005545 Unclassified 1945
52 Ga0070696_100004162 3300005546 Bacteria 9637
53 Ga0070693_100184340 3300005547 Bacteria 1346
54 Ga0070665_100013667 3300005548 Bacteria 8167
55 Ga0070665_100119083 3300005548 Bacteria 2643
56 Ga0068855_100008357 3300005563 Bacteria 12518
57 Ga0068855_100015574 3300005563 Bacteria 9153
58 Ga0068855_100022897 3300005563 Bacteria 7487
59 Ga0068855_100031125 3300005563 Bacteria 6374
60 Ga0068855_100042564 3300005563 Bacteria 5380
61 Ga0068855_100316321 3300005563 Bacteria 1726
62 Ga0068855_100631029 3300005563 Unclassified 1153
63 Ga0070664_100137023 3300005564 Bacteria 2153
64 Ga0070664_100585381 3300005564 Bacteria 1034
65 Ga0068857_100000098 3300005577 Bacteria 50740
66 Ga0068857_100012957 3300005577 Bacteria 7268
67 Ga0068856_100000431 3300005614 Bacteria 46002
68 Ga0068856_100007408 3300005614 Bacteria 10708
69 Ga0068856_100022856 3300005614 Bacteria 6082
70 Ga0068856_100069055 3300005614 Bacteria 3494
71 Ga0068856_100076615 3300005614 Bacteria 3313
72 Ga0068856_100218766 3300005614 Bacteria 1920
73 Ga0068856_100318038 3300005614 Bacteria 1574
74 Ga0068852_100007074 3300005616 Bacteria 8173
75 Ga0068852_100011838 3300005616 Bacteria 6592
76 Ga0068859_100199338 3300005617 Unclassified 2086
77 Ga0068859_100724829 3300005617 Bacteria 1084
78 Ga0068864_100011076 3300005618 Bacteria 7452
79 Ga0068864_100068657 3300005618 Bacteria 3080
80 Ga0068864_100914631 3300005618 Unclassified 867
81 Ga0068866_10146495 3300005718 Unclassified 1362
82 Ga0068863_100012495 3300005841 Bacteria 8195
83 Ga0068863_100091859 3300005841 Bacteria 2879
84 Ga0068863_100193077 3300005841 Bacteria 1957
85 Ga0068858_100021045 3300005842 Bacteria 6092
86 Ga0068858_100061327 3300005842 Unclassified 3477
87 Ga0068858_100076960 3300005842 Bacteria 3099
88 Ga0068858_100297536 3300005842 Unclassified 1539
89 Ga0068860_100078892 3300005843 Bacteria 3131
90 Ga0068860_100123616 3300005843 Bacteria 2480
91 Ga0070717_10003940 3300006028 Bacteria 10683
92 Ga0070717_10011363 3300006028 Bacteria 6758
93 Ga0097621_100062376 3300006237 Unclassified 3060
94 Ga0097621_100097131 3300006237 Unclassified 2473
95 Ga0097621_100099237 3300006237 Unclassified 2447
96 Ga0097621_100108465 3300006237 Unclassified 2344
97 Ga0097621_100202484 3300006237 Unclassified 1724
98 Ga0097621_100267338 3300006237 Unclassified 1502
99 Ga0097621_100272279 3300006237 Bacteria 1488
100 Ga0097621_100772253 3300006237 Bacteria 889
101 Ga0068871_100031825 3300006358 Unclassified 4162
102 Ga0068871_100037398 3300006358 Bacteria 3871
103 Ga0068871_100269036 3300006358 Unclassified 1488
104 Ga0068871_100425682 3300006358 Unclassified 1186
105 Ga0075436_100007178 3300006914 Bacteria 7621
106 Ga0097620_100199341 3300006931 Unclassified 2086
107 Ga0097620_100724704 3300006931 Bacteria 1084
108 Ga0105240_10000816 3300009093 Bacteria 56580
109 Ga0105240_10000836 3300009093 Bacteria 55438
110 Ga0105240_10003098 3300009093 Bacteria 26153
111 Ga0105240_10019066 3300009093 Bacteria 9175
112 Ga0105240_10061856 3300009093 Bacteria 4664
113 Ga0105240_10104544 3300009093 Unclassified 3439
114 Ga0105240_10363421 3300009093 Bacteria 1639
115 Ga0105240_10376835 3300009093 Bacteria 1603
116 Ga0105240_10413985 3300009093 Unclassified 1516
117 Ga0105240_10707841 3300009093 Bacteria 1099
118 Ga0105245_10000579 3300009098 Bacteria 33283
119 Ga0105245_10000827 3300009098 Bacteria 28177
120 Ga0105245_10029274 3300009098 Bacteria 4864
121 Ga0105245_10043110 3300009098 Bacteria 4025
122 Ga0105247_10173456 3300009101 Bacteria 1435
123 Ga0105243_10252324 3300009148 Bacteria 1576
124 Ga0105241_10003348 3300009174 Bacteria 11936
125 Ga0105241_10019112 3300009174 Bacteria 5053
126 Ga0105241_10021647 3300009174 Unclassified 4756
127 Ga0105241_10026239 3300009174 Unclassified 4333
128 Ga0105241_10045341 3300009174 Bacteria 3335
129 Ga0105241_10046317 3300009174 Bacteria 3303
130 Ga0105241_10119963 3300009174 Unclassified 2116
131 Ga0105241_10152479 3300009174 Bacteria 1892
132 Ga0105241_10159553 3300009174 Unclassified 1852
133 Ga0105241_10242972 3300009174 Bacteria 1523
134 Ga0105241_10273278 3300009174 Bacteria 1441
135 Ga0105241_10323274 3300009174 Unclassified 1331
136 Ga0105242_10009997 3300009176 Bacteria 7265
137 Ga0105242_10041637 3300009176 Bacteria 3706
138 Ga0105242_10124831 3300009176 Bacteria 2214
139 Ga0105242_10282959 3300009176 Unclassified 1507
140 Ga0105248_10017389 3300009177 Bacteria 7927
141 Ga0105248_10031209 3300009177 Bacteria 5955
142 Ga0105248_10163447 3300009177 Bacteria 2510
143 Ga0105248_10167345 3300009177 Bacteria 2477
144 Ga0105248_10170111 3300009177 Bacteria 2456
145 Ga0105248_10446758 3300009177 Bacteria 1457
146 Ga0105237_10001791 3300009545 Bacteria 27763
147 Ga0105237_10005855 3300009545 Bacteria 13790
148 Ga0105237_10011727 3300009545 Bacteria 9270
149 Ga0105237_10023011 3300009545 Bacteria 6390
150 Ga0105237_10095151 3300009545 Unclassified 2968
151 Ga0105237_10277132 3300009545 Bacteria 1679
152 Ga0105237_10279487 3300009545 Bacteria 1672
153 Ga0105237_10342478 3300009545 Unclassified 1499
154 Ga0105237_10372641 3300009545 Unclassified 1432
155 Ga0105238_10001899 3300009551 Bacteria 20977
156 Ga0105238_10007468 3300009551 Bacteria 10949
157 Ga0105238_10019159 3300009551 Bacteria 6973
158 Ga0105238_10044129 3300009551 Bacteria 4509
159 Ga0105238_10219246 3300009551 Bacteria 1878
160 Ga0105238_10447094 3300009551 Bacteria 1289
161 Ga0105249_10002362 3300009553 Bacteria 16384
162 Ga0105249_10249984 3300009553 Unclassified 1758
163 Ga0105249_11157959 3300009553 Bacteria 844
164 Ga0105239_10003045 3300010375 Bacteria 20838
165 Ga0105239_10006490 3300010375 Bacteria 13565
166 Ga0105239_10006891 3300010375 Bacteria 13108
167 Ga0105239_10016236 3300010375 Bacteria 8237
168 Ga0105239_10107665 3300010375 Unclassified 3088
169 Ga0105239_10463997 3300010375 Bacteria 1438
170 Ga0105246_10003236 3300011119 Bacteria 9885
171 Ga0105246_10140411 3300011119 Bacteria 1816
172 Ga0105246_10191555 3300011119 Unclassified 1583
173 Ga0157373_10228994 3300013100 Bacteria 1312
174 Ga0157370_10004359 3300013104 Bacteria 16244
175 Ga0157370_10008982 3300013104 Bacteria 10728
176 Ga0157370_10054627 3300013104 Bacteria 3807
177 Ga0157370_10101665 3300013104 Bacteria 2692
178 Ga0157370_10486729 3300013104 Unclassified 1134
179 Ga0157369_10001061 3300013105 Bacteria 34642
180 Ga0157369_10001514 3300013105 Bacteria 28521
181 Ga0157369_10008769 3300013105 Bacteria 11585
182 Ga0157369_10017524 3300013105 Bacteria 8049
183 Ga0157374_10002484 3300013296 Bacteria 15572
184 Ga0157374_10003780 3300013296 Bacteria 12736
185 Ga0157374_10216491 3300013296 Bacteria 1879
186 Ga0157374_10986243 3300013296 Bacteria 861
187 Ga0157378_10007608 3300013297 Bacteria 9457
188 Ga0157378_10389450 3300013297 Bacteria 1370
189 Ga0157378_10572609 3300013297 Bacteria 1137
190 Ga0163162_10092360 3300013306 Bacteria 3110
191 Ga0157372_10019244 3300013307 Bacteria 7352
192 Ga0157372_10035091 3300013307 Bacteria 5519
193 Ga0157372_10036977 3300013307 Bacteria 5383
194 Ga0157372_10200820 3300013307 Bacteria 2309
195 Ga0157372_10246364 3300013307 Bacteria 2074
196 Ga0157372_10291851 3300013307 Bacteria 1897
197 Ga0157372_10704931 3300013307 Bacteria 1174
198 Ga0157375_10040483 3300013308 Bacteria 4492
199 Ga0157375_10252815 3300013308 Bacteria 1923
200 Ga0163163_10002441 3300014325 Bacteria 15723
201 Ga0163163_10028071 3300014325 Bacteria 5400
202 Ga0163163_10029116 3300014325 Bacteria 5310
203 Ga0163163_10172008 3300014325 Bacteria 2213
204 Ga0163163_10235181 3300014325 Bacteria 1881
205 Ga0163163_10596657 3300014325 Unclassified 1168
206 Ga0157379_10022948 3300014968 Bacteria 5531
207 Ga0157379_10047403 3300014968 Bacteria 3834
208 Ga0157376_10158526 3300014969 Bacteria 2049
209 Ga0213875_10000776 3300021388 Bacteria 23853
210 Ga0213875_10012356 3300021388 Bacteria 4223
211 Ga0213875_10046553 3300021388 Bacteria 2035
212 Ga0207705_10005419 3300025909 Bacteria 9544
213 Ga0207654_10003485 3300025911 Bacteria 7957
214 Ga0207654_10093002 3300025911 Bacteria 1842
215 Ga0207654_10101596 3300025911 Bacteria 1773
216 Ga0207654_10137079 3300025911 Bacteria 1556
217 Ga0207654_10245423 3300025911 Unclassified 1198
218 Ga0207654_10313359 3300025911 Unclassified 1070
219 Ga0207707_10000509 3300025912 Bacteria 39960
220 Ga0207707_10667348 3300025912 Bacteria 875
221 Ga0207695_10000470 3300025913 Bacteria 87551
222 Ga0207695_10001175 3300025913 Bacteria 45160
223 Ga0207695_10002938 3300025913 Bacteria 24585
224 Ga0207695_10008975 3300025913 Bacteria 12443
225 Ga0207695_10017825 3300025913 Bacteria 8234
226 Ga0207695_10035815 3300025913 Bacteria 5374
227 Ga0207695_10382809 3300025913 Unclassified 1292
228 Ga0207671_10011046 3300025914 Bacteria 7392
229 Ga0207671_10014389 3300025914 Bacteria 6256
230 Ga0207671_10025434 3300025914 Bacteria 4447
231 Ga0207671_10094062 3300025914 Unclassified 2261
232 Ga0207671_10371104 3300025914 Bacteria 1136
233 Ga0207693_10284700 3300025915 Unclassified 1295
234 Ga0207693_10333042 3300025915 Bacteria 1188
235 Ga0207663_10234968 3300025916 Bacteria 1341
236 Ga0207657_10002168 3300025919 Bacteria 21257
237 Ga0207657_10023291 3300025919 Bacteria 5770
238 Ga0207657_10436470 3300025919 Unclassified 1028
239 Ga0207652_10006118 3300025921 Bacteria 9732
240 Ga0207652_10200865 3300025921 Bacteria 1794
241 Ga0207652_10338706 3300025921 Bacteria 1358
242 Ga0207694_10001376 3300025924 Bacteria 20931
243 Ga0207694_10010662 3300025924 Bacteria 6933
244 Ga0207694_10030641 3300025924 Bacteria 4107
245 Ga0207694_10048963 3300025924 Unclassified 3271
246 Ga0207694_10063127 3300025924 Bacteria 2885
247 Ga0207694_10721096 3300025924 Bacteria 841
248 Ga0207687_10001622 3300025927 Bacteria 15504
249 Ga0207687_10011441 3300025927 Bacteria 5799
250 Ga0207687_10083514 3300025927 Unclassified 2313
251 Ga0207687_10393652 3300025927 Bacteria 1138
252 Ga0207687_10602776 3300025927 Bacteria 926
253 Ga0207700_10001226 3300025928 Bacteria 14668
254 Ga0207700_10234500 3300025928 Bacteria 1562
255 Ga0207700_10605304 3300025928 Unclassified 975
256 Ga0207664_10001158 3300025929 Bacteria 17550
257 Ga0207664_10235560 3300025929 Unclassified 1592
258 Ga0207644_10610150 3300025931 Bacteria 906
259 Ga0207690_10011945 3300025932 Bacteria 5192
260 Ga0207686_10049125 3300025934 Bacteria 2617
261 Ga0207686_10091316 3300025934 Bacteria 2011
262 Ga0207686_10108988 3300025934 Bacteria 1864
263 Ga0207686_10177787 3300025934 Unclassified 1507
264 Ga0207686_10319184 3300025934 Bacteria 1160
265 Ga0207686_10618395 3300025934 Unclassified 854
266 Ga0207670_10089146 3300025936 Unclassified 2177
267 Ga0207704_10156160 3300025938 Unclassified 1617
268 Ga0207711_10022305 3300025941 Bacteria 5293
269 Ga0207711_10035317 3300025941 Bacteria 4237
270 Ga0207711_10129686 3300025941 Bacteria 2260
271 Ga0207711_10170439 3300025941 Bacteria 1975
272 Ga0207711_10509844 3300025941 Bacteria 1121
273 Ga0207661_10006895 3300025944 Bacteria 8052
274 Ga0207661_10008379 3300025944 Bacteria 7384
275 Ga0207661_10016217 3300025944 Bacteria 5494
276 Ga0207661_10030665 3300025944 Bacteria 4145
277 Ga0207667_10000145 3300025949 Bacteria 107389
278 Ga0207667_10000290 3300025949 Bacteria 69361
279 Ga0207667_10002700 3300025949 Bacteria 21961
280 Ga0207667_10068521 3300025949 Unclassified 3695
281 Ga0207667_10156117 3300025949 Unclassified 2348
282 Ga0207658_10495665 3300025986 Unclassified 1087
283 Ga0207677_10004490 3300026023 Bacteria 7501
284 Ga0207703_10012461 3300026035 Bacteria 6629
285 Ga0207703_10016635 3300026035 Bacteria 5737
286 Ga0207703_10034926 3300026035 Unclassified 3993
287 Ga0207703_10047947 3300026035 Bacteria 3446
288 Ga0207703_10461641 3300026035 Unclassified 1188
289 Ga0207639_10046640 3300026041 Unclassified 3271
290 Ga0207639_10144465 3300026041 Unclassified 1986
291 Ga0207639_10245581 3300026041 Bacteria 1559
292 Ga0207702_10003973 3300026078 Bacteria 13278
293 Ga0207702_10097641 3300026078 Unclassified 2586
294 Ga0207702_10104353 3300026078 Bacteria 2508
295 Ga0207702_10237868 3300026078 Bacteria 1705
296 Ga0207702_10276683 3300026078 Bacteria 1585
297 Ga0207641_10006533 3300026088 Bacteria 9806
298 Ga0207641_10042051 3300026088 Unclassified 3833
299 Ga0207676_10051880 3300026095 Bacteria 3204
300 Ga0207676_10067769 3300026095 Bacteria 2852
301 Ga0207676_10111198 3300026095 Bacteria 2293
302 Ga0207676_10155083 3300026095 Bacteria 1977
303 Ga0207674_10000264 3300026116 Bacteria 65695
304 Ga0207674_10001670 3300026116 Bacteria 28551
305 Ga0207674_10122341 3300026116 Unclassified 2568
306 Ga0207683_10421654 3300026121 Bacteria 1229
307 Ga0207698_10033217 3300026142 Bacteria 3747
308 Ga0268266_10016891 3300028379 Bacteria 6236
309 Ga0268264_10485267 3300028381 Bacteria 1203
310 Ga0265338_10013554 3300028800 Bacteria 9188
311 Ga0265338_10167037 3300028800 Unclassified 1693
312 Ga0265330_10100155 3300031235 Unclassified 1241
313 Ga0265328_10016841 3300031239 Bacteria 2838
314 Ga0265320_10017610 3300031240 Bacteria 3960
315 Ga0265325_10039795 3300031241 Unclassified 2472
316 Ga0265325_10167772 3300031241 Unclassified 1029
317 Ga0265329_10016977 3300031242 Bacteria 2513
318 Ga0265331_10013614 3300031250 Bacteria 4367
319 Ga0265316_10002549 3300031344 Bacteria 18826
320 Ga0265316_10002888 3300031344 Bacteria 17582
321 Ga0265316_10012282 3300031344 Bacteria 7685
322 Ga0265316_10040624 3300031344 Unclassified 3728
323 Ga0265316_10086542 3300031344 Unclassified 2395
324 Ga0265316_10117259 3300031344 Bacteria 2013
325 Ga0265316_10333867 3300031344 Bacteria 1099
326 Ga0265313_10011492 3300031595 Bacteria 5497
327 Ga0265313_10105222 3300031595 Bacteria 1247
328 Ga0265314_10004325 3300031711 Bacteria 13256
329 Ga0265314_10020822 3300031711 Bacteria 5057
330 Ga0265314_10123748 3300031711 Bacteria 1623
331 Ga0265342_10040417 3300031712 Bacteria 2828
332 Ga0265342_10046440 3300031712 Unclassified 2610
333 Ga0265342_10056027 3300031712 Unclassified 2338
334 Ga0373934_0013437 3300035086 Unclassified 3096
335 Ga0373953_0097238 3300035117 Unclassified 1236
336 Ga0373954_0008491 3300035118 Bacteria 4510
337 Ga0373954_0042657 3300035118 Bacteria 2115
338 Ga0373954_0182546 3300035118 Unclassified 1029
339 Ga0373956_0080765 3300035119 Bacteria 1492
340 Ga0373957_0025187 3300035120 Bacteria 2142
341 Ga0373935_0012627 3300035692 Bacteria 5082
342 Ga0373927_0000959 3300035695 Bacteria 22003
343 Ga0373927_0012918 3300035695 Bacteria 5553
344 Ga0373933_0086474 3300035724 Bacteria 1929
345 Ga0373933_0327273 3300035724 Bacteria 994
346 Ga0373937_0003558 3300036401 Bacteria 13123
347 Ga0373937_0003683 3300036401 Bacteria 12945
348 Ga0373937_0008047 3300036401 Bacteria 9143
349 Ga0373937_0010601 3300036401 Bacteria 8053
350 Ga0373925_0252486 3300037068 Unclassified 1415
351 Ga0373925_0383647 3300037068 Bacteria 1144
352 Ga0373925_0427948 3300037068 Bacteria 1082
353 Ga0436364_0105113 3300037853 Bacteria 15648
354 Ga0436364_0628510 3300037853 Bacteria 2210
355 Ga0436364_0689035 3300037853 Bacteria 2272
356 Ga0436364_1033499 3300037853 Bacteria 8711
357 Ga0436364_1528920 3300037853 Unclassified 1867
358 Ga0436365_0006517 3300039437 Bacteria 1050
359 Ga0436365_1361019 3300039437 Bacteria 3010
360 Ga0436365_1663767 3300039437 Bacteria 3285
361 Ga0436360_0165878 3300039438 Bacteria 941
362 Ga0451577_0441434 3300042876 Bacteria 1182
363 Ga0453684_0664893 3300044712 Bacteria 1135
364 Ga0466960_0088273 3300044901 Bacteria 1576
365 Ga0451576_0762916 3300045051 Unclassified 1016
366 Ga0495592_0391299 3300046454 Bacteria 882
367 Ga0495580_0015468 3300046472 Bacteria 5753
368 Ga0495582_0004128 3300046473 Bacteria 8166
369 Ga0495639_0269215 3300046475 Bacteria 845
370 Ga0495608_0134852 3300046511 Bacteria 1578
371 Ga0495630_0402608 3300046517 Unclassified 1049
372 Ga0495652_0343736 3300046529 Bacteria 1071
373 Ga0495652_0512406 3300046529 Bacteria 830
374 Ga0495665_0055415 3300046531 Bacteria 2094
375 Ga0495586_0080174 3300046535 Bacteria 1793
376 Ga0495587_0000640 3300046536 Bacteria 23483
377 Ga0495587_0137657 3300046536 Bacteria 1394
378 Ga0495667_0109592 3300046559 Bacteria 1784
379 Ga0495634_0049587 3300046642 Unclassified 2823
380 Ga0495657_0175249 3300046675 Archaea 1319
381 Ga0495599_0070433 3300046678 Bacteria 2183
382 Ga0495623_0136889 3300046679 Bacteria 1461
383 Ga0495658_0092029 3300046683 Bacteria 1797
384 Ga0495613_0063917 3300046689 Unclassified 2692
385 Ga0495613_0073117 3300046689 Bacteria 2499
386 Ga0495613_0116199 3300046689 Bacteria 1925
387 Ga0495600_0106802 3300046809 Bacteria 1824
388 Ga0495604_0017665 3300047317 Bacteria 5710
389 Ga0495674_0008493 3300047319 Bacteria 9783
390 Ga0495674_0225832 3300047319 Bacteria 1547
391 Ga0495675_0124008 3300047444 Unclassified 1608
392 Ga0495684_0011916 3300047471 Bacteria 6706
393 Ga0495684_0044808 3300047471 Unclassified 3385
394 Ga0495684_0089975 3300047471 Bacteria 2325
395 Ga0495684_0107522 3300047471 Bacteria 2107
396 Ga0495602_0002475 3300048088 Bacteria 18822
397 Ga0496102_0577088 3300048905 Bacteria 1047
398 Ga0496104_0039434 3300048907 Bacteria 4423
399 Ga0496112_0096027 3300048915 Bacteria 2935
400 Ga0496115_0077960 3300048918 Bacteria 2695
401 Ga0496126_0048904 3300048929 Unclassified 3862
402 Ga0501031_0005602 3300049568 Bacteria 8182
403 Ga0501032_0012535 3300049569 Bacteria 6053
404 Ga0501033_0004139 3300049570 Bacteria 11683
405 Ga0501034_0084745 3300049571 Unclassified 3170
406 Ga0501036_0014547 3300049572 Bacteria 6552
407 Ga0501037_0053797 3300049573 Unclassified 2944
408 Ga0501038_0000876 3300049574 Bacteria 26661
409 Ga0501039_0003112 3300049575 Bacteria 12404
410 Ga0501043_0000791 3300049579 Bacteria 28154
411 Ga0501046_0001434 3300049580 Bacteria 22924
412 Ga0501047_0070554 3300049581 Unclassified 3363
413 Ga0501068_0001050 3300049584 Bacteria 14629
414 Ga0501070_0007308 3300049586 Bacteria 9381
415 Ga0501072_0000473 3300049588 Bacteria 28827
416 Ga0501073_0000813 3300049589 Bacteria 22175
417 Ga0501074_0019377 3300049590 Unclassified 4942
418 Ga0501076_0015811 3300049592 Bacteria 5709
419 Ga0501077_0018315 3300049593 Unclassified 4432
420 Ga0501079_0004243 3300049741 Bacteria 10628
421 Ga0501083_0001755 3300049744 Bacteria 14796
422 Ga0501035_0057439 3300049822 Unclassified 3469
423 Ga0495601_0099234 3300053077 Unclassified 1880
424 Ga0500568_0002689 3300053139 Bacteria 10306
425 Ga0501084_0001162 3300054114 Bacteria 20532
426 Ga0501082_0001033 3300060353 Bacteria 24598
427 Ga0097621_100007432
428 Ga0070658_10028206
429 Ga0070683_100004150
430 Ga0070683_100019672
431 Ga0070683_100037655
432 Ga0070683_100123020
433 Ga0070680_100023806
434 Ga0068868_100023250
435 Ga0068868_100123652
436 Ga0068868_100644041
437 Ga0070660_100015945
438 Ga0070660_100016917
439 Ga0070689_100152977
440 Ga0070691_10003535
441 Ga0070687_100349184
442 Ga0070661_100047419
443 Ga0070671_100159030
444 Ga0070671_100594559
445 Ga0070671_100631081
446 Ga0070673_100436938
447 Ga0070688_100037875
448 Ga0070688_100264503
449 Ga0070714_100055654
450 Ga0070713_100001456
451 Ga0070713_100016417
452 Ga0070713_100050615
453 Ga0070713_100173826
454 Ga0070710_10145457
455 Ga0070711_100010239
456 Ga0070711_100012164
457 Ga0070711_100082565
458 Ga0070681_10002648
459 Ga0070681_10162145
460 Ga0070681_10223645
461 Ga0068867_100179404
462 Ga0070679_100000878
463 Ga0070679_100104619
464 Ga0070679_100115068
465 Ga0070679_100341200
466 Ga0070684_100005003
467 Ga0070684_100022569
468 Ga0070684_100043162
469 Ga0070684_100145175
470 Ga0070697_100233804
471 Ga0070697_100278825
472 Ga0068853_100027719
473 Ga0068853_100037522
474 Ga0068853_100288601
475 Ga0068853_100345126
476 Ga0070695_100053045
477 Ga0070695_100100711
478 Ga0070696_100004162
479 Ga0070693_100184340
480 Ga0070665_100013667
481 Ga0070665_100119083
482 Ga0068855_100008357
483 Ga0068855_100015574
484 Ga0068855_100022897
485 Ga0068855_100031125
486 Ga0068855_100042564
487 Ga0068855_100316321
488 Ga0068855_100631029
489 Ga0070664_100137023
490 Ga0070664_100585381
491 Ga0068857_100000098
492 Ga0068857_100012957
493 Ga0068856_100000431
494 Ga0068856_100007408
495 Ga0068856_100022856
496 Ga0068856_100069055
497 Ga0068856_100076615
498 Ga0068856_100218766
499 Ga0068856_100318038
500 Ga0068852_100007074
501 Ga0068852_100011838
502 Ga0068859_100199338
503 Ga0068859_100724829
504 Ga0068864_100011076
505 Ga0068864_100068657
506 Ga0068864_100914631
507 Ga0068866_10146495
508 Ga0068863_100012495
509 Ga0068863_100091859
510 Ga0068863_100193077
511 Ga0068858_100021045
512 Ga0068858_100061327
513 Ga0068858_100076960
514 Ga0068858_100297536
515 Ga0068860_100078892
516 Ga0068860_100123616
517 Ga0070717_10003940
518 Ga0070717_10011363
519 Ga0097621_100062376
520 Ga0097621_100097131
521 Ga0097621_100099237
522 Ga0097621_100108465
523 Ga0097621_100202484
524 Ga0097621_100267338
525 Ga0097621_100272279
526 Ga0097621_100772253
527 Ga0068871_100031825
528 Ga0068871_100037398
529 Ga0068871_100269036
530 Ga0068871_100425682
531 Ga0075436_100007178
532 Ga0097620_100199341
533 Ga0097620_100724704
534 Ga0105240_10000816
535 Ga0105240_10000836
536 Ga0105240_10003098
537 Ga0105240_10019066
538 Ga0105240_10061856
539 Ga0105240_10104544
540 Ga0105240_10363421
541 Ga0105240_10376835
542 Ga0105240_10413985
543 Ga0105240_10707841
544 Ga0105245_10000579
545 Ga0105245_10000827
546 Ga0105245_10029274
547 Ga0105245_10043110
548 Ga0105247_10173456
549 Ga0105243_10252324
550 Ga0105241_10003348
551 Ga0105241_10019112
552 Ga0105241_10021647
553 Ga0105241_10026239
554 Ga0105241_10045341
555 Ga0105241_10046317
556 Ga0105241_10119963
557 Ga0105241_10152479
558 Ga0105241_10159553
559 Ga0105241_10242972
560 Ga0105241_10273278
561 Ga0105241_10323274
562 Ga0105242_10009997
563 Ga0105242_10041637
564 Ga0105242_10124831
565 Ga0105242_10282959
566 Ga0105248_10017389
567 Ga0105248_10031209
568 Ga0105248_10163447
569 Ga0105248_10167345
570 Ga0105248_10170111
571 Ga0105248_10446758
572 Ga0105237_10001791
573 Ga0105237_10005855
574 Ga0105237_10011727
575 Ga0105237_10023011
576 Ga0105237_10095151
577 Ga0105237_10277132
578 Ga0105237_10279487
579 Ga0105237_10342478
580 Ga0105237_10372641
581 Ga0105238_10001899
582 Ga0105238_10007468
583 Ga0105238_10019159
584 Ga0105238_10044129
585 Ga0105238_10219246
586 Ga0105238_10447094
587 Ga0105249_10002362
588 Ga0105249_10249984
589 Ga0105249_11157959
590 Ga0105239_10003045
591 Ga0105239_10006490
592 Ga0105239_10006891
593 Ga0105239_10016236
594 Ga0105239_10107665
595 Ga0105239_10463997
596 Ga0105246_10003236
597 Ga0105246_10140411
598 Ga0105246_10191555
599 Ga0157373_10228994
600 Ga0157370_10004359
601 Ga0157370_10008982
602 Ga0157370_10054627
603 Ga0157370_10101665
604 Ga0157370_10486729
605 Ga0157369_10001061
606 Ga0157369_10001514
607 Ga0157369_10008769
608 Ga0157369_10017524
609 Ga0157374_10002484
610 Ga0157374_10003780
611 Ga0157374_10216491
612 Ga0157374_10986243
613 Ga0157378_10007608
614 Ga0157378_10389450
615 Ga0157378_10572609
616 Ga0163162_10092360
617 Ga0157372_10019244
618 Ga0157372_10035091
619 Ga0157372_10036977
620 Ga0157372_10200820
621 Ga0157372_10246364
622 Ga0157372_10291851
623 Ga0157372_10704931
624 Ga0157375_10040483
625 Ga0157375_10252815
626 Ga0163163_10002441
627 Ga0163163_10028071
628 Ga0163163_10029116
629 Ga0163163_10172008
630 Ga0163163_10235181
631 Ga0163163_10596657
632 Ga0157379_10022948
633 Ga0157379_10047403
634 Ga0157376_10158526
635 Ga0213875_10000776
636 Ga0213875_10012356
637 Ga0213875_10046553
638 Ga0207705_10005419
639 Ga0207654_10003485
640 Ga0207654_10093002
641 Ga0207654_10101596
642 Ga0207654_10137079
643 Ga0207654_10245423
644 Ga0207654_10313359
645 Ga0207707_10000509
646 Ga0207707_10667348
647 Ga0207695_10000470
648 Ga0207695_10001175
649 Ga0207695_10002938
650 Ga0207695_10008975
651 Ga0207695_10017825
652 Ga0207695_10035815
653 Ga0207695_10382809
654 Ga0207671_10011046
655 Ga0207671_10014389
656 Ga0207671_10025434
657 Ga0207671_10094062
658 Ga0207671_10371104
659 Ga0207693_10284700
660 Ga0207693_10333042
661 Ga0207663_10234968
662 Ga0207657_10002168
663 Ga0207657_10023291
664 Ga0207657_10436470
665 Ga0207652_10006118
666 Ga0207652_10200865
667 Ga0207652_10338706
668 Ga0207694_10001376
669 Ga0207694_10010662
670 Ga0207694_10030641
671 Ga0207694_10048963
672 Ga0207694_10063127
673 Ga0207694_10721096
674 Ga0207687_10001622
675 Ga0207687_10011441
676 Ga0207687_10083514
677 Ga0207687_10393652
678 Ga0207687_10602776
679 Ga0207700_10001226
680 Ga0207700_10234500
681 Ga0207700_10605304
682 Ga0207664_10001158
683 Ga0207664_10235560
684 Ga0207644_10610150
685 Ga0207690_10011945
686 Ga0207686_10049125
687 Ga0207686_10091316
688 Ga0207686_10108988
689 Ga0207686_10177787
690 Ga0207686_10319184
691 Ga0207686_10618395
692 Ga0207670_10089146
693 Ga0207704_10156160
694 Ga0207711_10022305
695 Ga0207711_10035317
696 Ga0207711_10129686
697 Ga0207711_10170439
698 Ga0207711_10509844
699 Ga0207661_10006895
700 Ga0207661_10008379
701 Ga0207661_10016217
702 Ga0207661_10030665
703 Ga0207667_10000145
704 Ga0207667_10000290
705 Ga0207667_10002700
706 Ga0207667_10068521
707 Ga0207667_10156117
708 Ga0207658_10495665
709 Ga0207677_10004490
710 Ga0207703_10012461
711 Ga0207703_10016635
712 Ga0207703_10034926
713 Ga0207703_10047947
714 Ga0207703_10461641
715 Ga0207639_10046640
716 Ga0207639_10144465
717 Ga0207639_10245581
718 Ga0207702_10003973
719 Ga0207702_10097641
720 Ga0207702_10104353
721 Ga0207702_10237868
722 Ga0207702_10276683
723 Ga0207641_10006533
724 Ga0207641_10042051
725 Ga0207676_10051880
726 Ga0207676_10067769
727 Ga0207676_10111198
728 Ga0207676_10155083
729 Ga0207674_10000264
730 Ga0207674_10001670
731 Ga0207674_10122341
732 Ga0207683_10421654
733 Ga0207698_10033217
734 Ga0268266_10016891
735 Ga0268264_10485267
736 Ga0265338_10013554
737 Ga0265338_10167037
738 Ga0265330_10100155
739 Ga0265328_10016841
740 Ga0265320_10017610
741 Ga0265325_10039795
742 Ga0265325_10167772
743 Ga0265329_10016977
744 Ga0265331_10013614
745 Ga0265316_10002549
746 Ga0265316_10002888
747 Ga0265316_10012282
748 Ga0265316_10040624
749 Ga0265316_10086542
750 Ga0265316_10117259
751 Ga0265316_10333867
752 Ga0265313_10011492
753 Ga0265313_10105222
754 Ga0265314_10004325
755 Ga0265314_10020822
756 Ga0265314_10123748
757 Ga0265342_10040417
758 Ga0265342_10046440
759 Ga0265342_10056027
760 Ga0373934_0013437
761 Ga0373953_0097238
762 Ga0373954_0008491
763 Ga0373954_0042657
764 Ga0373954_0182546
765 Ga0373956_0080765
766 Ga0373957_0025187
767 Ga0373935_0012627
768 Ga0373927_0000959
769 Ga0373927_0012918
770 Ga0373933_0086474
771 Ga0373933_0327273
772 Ga0373937_0003558
773 Ga0373937_0003683
774 Ga0373937_0008047
775 Ga0373937_0010601
776 Ga0373925_0252486
777 Ga0373925_0383647
778 Ga0373925_0427948
779 Ga0436364_0105113
780 Ga0436364_0628510
781 Ga0436364_0689035
782 Ga0436364_1033499
783 Ga0436364_1528920
784 Ga0436365_0006517
785 Ga0436365_1361019
786 Ga0436365_1663767
787 Ga0436360_0165878
788 Ga0451577_0441434
789 Ga0453684_0664893
790 Ga0466960_0088273
791 Ga0451576_0762916
792 Ga0495592_0391299
793 Ga0495580_0015468
794 Ga0495582_0004128
795 Ga0495639_0269215
796 Ga0495608_0134852
797 Ga0495630_0402608
798 Ga0495652_0343736
799 Ga0495652_0512406
800 Ga0495665_0055415
801 Ga0495586_0080174
802 Ga0495587_0000640
803 Ga0495587_0137657
804 Ga0495667_0109592
805 Ga0495634_0049587
806 Ga0495657_0175249
807 Ga0495599_0070433
808 Ga0495623_0136889
809 Ga0495658_0092029
810 Ga0495613_0063917
811 Ga0495613_0073117
812 Ga0495613_0116199
813 Ga0495600_0106802
814 Ga0495604_0017665
815 Ga0495674_0008493
816 Ga0495674_0225832
817 Ga0495675_0124008
818 Ga0495684_0011916
819 Ga0495684_0044808
820 Ga0495684_0089975
821 Ga0495684_0107522
822 Ga0495602_0002475
823 Ga0496102_0577088
824 Ga0496104_0039434
825 Ga0496112_0096027
826 Ga0496115_0077960
827 Ga0496126_0048904
828 Ga0501031_0005602
829 Ga0501032_0012535
830 Ga0501033_0004139
831 Ga0501034_0084745
832 Ga0501036_0014547
833 Ga0501037_0053797
834 Ga0501038_0000876
835 Ga0501039_0003112
836 Ga0501043_0000791
837 Ga0501046_0001434
838 Ga0501047_0070554
839 Ga0501068_0001050
840 Ga0501070_0007308
841 Ga0501072_0000473
842 Ga0501073_0000813
843 Ga0501074_0019377
844 Ga0501076_0015811
845 Ga0501077_0018315
846 Ga0501079_0004243
847 Ga0501083_0001755
848 Ga0501035_0057439
849 Ga0495601_0099234
850 Ga0500568_0002689
851 Ga0501084_0001162
852 Ga0501082_0001033

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13720

Acetyltransf_11

Udp N-acetylglucosamine O-acyltransferase; Domain 2

170

250

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hzc-assembly2.cif.gz_G crystal structure of serine acetyltransferase from brucella abortus strain s19 0.8388 15 116
4n6b-assembly2.cif.gz_F soybean serine acetyltransferase complexed with coa 0.8333 13 111
3gos-assembly1.cif.gz_A the crystal structure of 2,3,4,5-tetrahydropyridine-2-carboxylate n-succinyltransferase from yersinia pestis co92 0.8179 6 106
3mc4-assembly1.cif.gz_A crystal structure of ww/rsp5/wwp domain: bacterial transferase hexapeptide repeat: serine o-acetyltransferase from brucella melitensis 0.8159 15 116
1ssq-assembly1.cif.gz_A serine acetyltransferase- complex with cysteine 0.7855 15 111
ID Description Score Start End Superfamily
4r37A02 Mainly Alpha;Up-down Bundle;Udp N-acetylglucosamine O-acyltransferase; Domain 2;Udp N-acetylglucosamine O-acyltransferase, C-terminal domain 0.9624 148 210 1.20.1180.10
4r36A02 Mainly Alpha;Up-down Bundle;Udp N-acetylglucosamine O-acyltransferase; Domain 2;Udp N-acetylglucosamine O-acyltransferase, C-terminal domain 0.9617 148 210 1.20.1180.10
4r37B02 Mainly Alpha;Up-down Bundle;Udp N-acetylglucosamine O-acyltransferase; Domain 2;Udp N-acetylglucosamine O-acyltransferase, C-terminal domain 0.958 148 210 1.20.1180.10
4e6uA02 Mainly Alpha;Up-down Bundle;Udp N-acetylglucosamine O-acyltransferase; Domain 2;Udp N-acetylglucosamine O-acyltransferase, C-terminal domain 0.9122 148 212 1.20.1180.10
4e6tC02 Mainly Alpha;Up-down Bundle;Udp N-acetylglucosamine O-acyltransferase; Domain 2;Udp N-acetylglucosamine O-acyltransferase, C-terminal domain 0.9115 148 212 1.20.1180.10
ID Description Score Start End GO Terms
AF-A0A2E4PEQ3-F1-model_v4 Sugar O-acyltransferase 0.948 7 114 GO:0016746
AF-A0A7C3GV58-F1-model_v4 Acetyltransferase 0.9383 5 113 GO:0016746
AF-A0A8B3BQ37-F1-model_v4 deleted 0.9378 7 113
AF-A0A2D6DQB8-F1-model_v4 PglD N-terminal domain-containing protein 0.9364 7 113
AF-A0A7C1IVM4-F1-model_v4 Acetyltransferase 0.9358 7 113 GO:0016740

Map