F440691

General Info

Members Datasets Scaffolds Average Seq Length
424 201 424 373

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100000027|Ga0070714_10000002746
Length 400
Sequence MRNLNWCSIRATRSAWAFAPKSFSMNQTSYDVAIMGAGIVGAACANEFARRGMSVVIVDRDVVGSGATAAGMGHIVVMDDSDAQFALTRYSQQLWQALRPELPDDVEYESCGTIWVAADEEEMIEVRRKHDYFTRRRVPVQVIDSQALERLEPNLRPGLAGGLLVPEDGVLYPPCAARFLIERAQKIGAKLQLGVSISQIGQGRIRLSDGLELTARIIVNAAGAWAPEITPGIEIRKRKGHLVITDRYPGFLRHQLVELGYLKSAHSVASDSVAFNVQPRRTGQILIGSSRQYGAEHKDVDHGILMRMLQRAQEYMPALGQMSAVRTWTGFRAATPDKLPLIGPLPGDKSVFMATGHEGLGITTSLGTAKILVDQITGANPEIAIEPYLPSRAGKEFAHA

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
138 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
139 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
140 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
141 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
142 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
145 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
146 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
147 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.3
Rhizosphere 93.4
Stem 0
Stem Tuber 0
Unclassified 3.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100000048 3300005329 Bacteria 93771
2 Ga0070683_100010625 3300005329 Bacteria 7912
3 Ga0070680_100067580 3300005336 Bacteria 2932
4 Ga0068868_100006053 3300005338 Bacteria 8542
5 Ga0068868_100019540 3300005338 Bacteria 5077
6 Ga0068868_100031311 3300005338 Bacteria 4086
7 Ga0070660_100004991 3300005339 Bacteria 9174
8 Ga0070660_100169443 3300005339 Unclassified 1763
9 Ga0070689_100201515 3300005340 Bacteria 1625
10 Ga0070661_100034267 3300005344 Bacteria 3682
11 Ga0070668_100009861 3300005347 Bacteria 7074
12 Ga0070675_100296634 3300005354 Bacteria 1423
13 Ga0070673_100060828 3300005364 Bacteria 2994
14 Ga0070659_100009128 3300005366 Bacteria 7272
15 Ga0070659_100010419 3300005366 Bacteria 6836
16 Ga0070659_100280799 3300005366 Bacteria 1385
17 Ga0070709_10000540 3300005434 Bacteria 22135
18 Ga0070714_100000027 3300005435 Bacteria 141750
19 Ga0070714_100067483 3300005435 Bacteria 3084
20 Ga0070714_100078627 3300005435 Bacteria 2867
21 Ga0070714_100419077 3300005435 Bacteria 1268
22 Ga0070713_100000675 3300005436 Bacteria 21861
23 Ga0070713_100001436 3300005436 Bacteria 15282
24 Ga0070713_100003514 3300005436 Bacteria 10353
25 Ga0070713_100005598 3300005436 Bacteria 8613
26 Ga0070713_100115522 3300005436 Bacteria 2346
27 Ga0070710_10035866 3300005437 Bacteria 2707
28 Ga0070710_10057217 3300005437 Unclassified 2209
29 Ga0070711_100000291 3300005439 Bacteria 26041
30 Ga0070711_100002406 3300005439 Bacteria 10676
31 Ga0070711_100019403 3300005439 Bacteria 4362
32 Ga0070708_100000501 3300005445 Bacteria 29429
33 Ga0070708_100013214 3300005445 Bacteria 6754
34 Ga0070708_100060747 3300005445 Bacteria 3374
35 Ga0070663_100130008 3300005455 Bacteria 1911
36 Ga0070662_100000890 3300005457 Bacteria 18277
37 Ga0070662_100067296 3300005457 Bacteria 2630
38 Ga0070681_10026999 3300005458 Bacteria 5773
39 Ga0070681_10075692 3300005458 Bacteria 3326
40 Ga0070681_10114148 3300005458 Bacteria 2640
41 Ga0070681_10196457 3300005458 Bacteria 1936
42 Ga0068867_100006371 3300005459 Bacteria 8345
43 Ga0068867_100029954 3300005459 Bacteria 3924
44 Ga0070706_100000445 3300005467 Bacteria 49819
45 Ga0070706_100181135 3300005467 Bacteria 1967
46 Ga0070707_100003309 3300005468 Bacteria 15219
47 Ga0070698_100069578 3300005471 Bacteria 3533
48 Ga0070699_100126548 3300005518 Bacteria 2250
49 Ga0070699_100132180 3300005518 Bacteria 2200
50 Ga0070679_100028449 3300005530 Bacteria 5511
51 Ga0070679_100043796 3300005530 Bacteria 4457
52 Ga0070679_100084649 3300005530 Bacteria 3159
53 Ga0070679_100087793 3300005530 Bacteria 3097
54 Ga0070679_100148093 3300005530 Unclassified 2325
55 Ga0070684_100000038 3300005535 Bacteria 94959
56 Ga0070684_100015433 3300005535 Bacteria 6221
57 Ga0070684_100025493 3300005535 Bacteria 4972
58 Ga0070697_100000400 3300005536 Bacteria 33575
59 Ga0068853_100029924 3300005539 Bacteria 4595
60 Ga0070695_100110792 3300005545 Bacteria 1862
61 Ga0070696_100015429 3300005546 Bacteria 5130
62 Ga0070693_100085487 3300005547 Bacteria 1890
63 Ga0070665_100011150 3300005548 Bacteria 9086
64 Ga0070665_100090526 3300005548 Unclassified 3065
65 Ga0070665_100317013 3300005548 Bacteria 1563
66 Ga0068855_100002907 3300005563 Bacteria 20961
67 Ga0068855_100003433 3300005563 Bacteria 19379
68 Ga0068855_100034584 3300005563 Bacteria 6024
69 Ga0068855_100047506 3300005563 Bacteria 5071
70 Ga0070664_100004040 3300005564 Bacteria 11785
71 Ga0070664_100004168 3300005564 Bacteria 11616
72 Ga0070664_100281850 3300005564 Eukaryota 1499
73 Ga0068857_100001303 3300005577 Bacteria 19594
74 Ga0068857_100020666 3300005577 Bacteria 5794
75 Ga0068857_100024816 3300005577 Bacteria 5280
76 Ga0068857_100055661 3300005577 Bacteria 3510
77 Ga0068854_100003344 3300005578 Bacteria 9998
78 Ga0068854_100010526 3300005578 Bacteria 6002
79 Ga0068854_100051745 3300005578 Bacteria 2943
80 Ga0068854_100170293 3300005578 Bacteria 1694
81 Ga0068856_100001061 3300005614 Bacteria 29098
82 Ga0068856_100003033 3300005614 Bacteria 17203
83 Ga0068856_100003434 3300005614 Bacteria 16018
84 Ga0068856_100005358 3300005614 Bacteria 12654
85 Ga0068856_100006511 3300005614 Bacteria 11454
86 Ga0068856_100014449 3300005614 Bacteria 7626
87 Ga0068856_100044831 3300005614 Bacteria 4353
88 Ga0068852_100051972 3300005616 Bacteria 3520
89 Ga0068852_100285552 3300005616 Unclassified 1592
90 Ga0068859_100001375 3300005617 Bacteria 24747
91 Ga0068859_100010999 3300005617 Bacteria 9106
92 Ga0068864_100000812 3300005618 Bacteria 26268
93 Ga0068861_100045585 3300005719 Bacteria 3302
94 Ga0068870_10013832 3300005840 Bacteria 3800
95 Ga0068870_10016046 3300005840 Bacteria 3570
96 Ga0068863_100250884 3300005841 Bacteria 1709
97 Ga0068858_100004322 3300005842 Bacteria 13958
98 Ga0068858_100036894 3300005842 Bacteria 4531
99 Ga0068858_100085283 3300005842 Bacteria 2938
100 Ga0068858_100229372 3300005842 Bacteria 1760
101 Ga0068860_100010174 3300005843 Bacteria 9317
102 Ga0068860_100042163 3300005843 Bacteria 4360
103 Ga0068860_100296542 3300005843 Bacteria 1583
104 Ga0081455_10058501 3300005937 Bacteria 3261
105 Ga0070717_10002865 3300006028 Bacteria 12231
106 Ga0070717_10009093 3300006028 Bacteria 7459
107 Ga0070717_10060878 3300006028 Bacteria 3127
108 Ga0070716_100003303 3300006173 Bacteria 7581
109 Ga0070716_100009781 3300006173 Bacteria 4792
110 Ga0070716_100033830 3300006173 Bacteria 2799
111 Ga0070712_100000105 3300006175 Bacteria 43144
112 Ga0070712_100001546 3300006175 Bacteria 14064
113 Ga0070712_100002207 3300006175 Bacteria 11978
114 Ga0070712_100002753 3300006175 Bacteria 10863
115 Ga0070712_100023342 3300006175 Bacteria 4085
116 Ga0097621_100002424 3300006237 Bacteria 12773
117 Ga0097621_100003366 3300006237 Bacteria 11004
118 Ga0097621_100016447 3300006237 Bacteria 5593
119 Ga0097621_100048283 3300006237 Bacteria 3453
120 Ga0068871_100000026 3300006358 Bacteria 79197
121 Ga0068871_100000497 3300006358 Bacteria 26923
122 Ga0068871_100005110 3300006358 Bacteria 9168
123 Ga0068871_100024873 3300006358 Unclassified 4650
124 Ga0075431_100017885 3300006847 Bacteria 7210
125 Ga0075433_10004469 3300006852 Bacteria 10895
126 Ga0075434_100001797 3300006871 Bacteria 18533
127 Ga0075434_100003010 3300006871 Bacteria 14990
128 Ga0068865_100018597 3300006881 Bacteria 4486
129 Ga0075436_100038499 3300006914 Bacteria 3301
130 Ga0075436_100096631 3300006914 Bacteria 2055
131 Ga0097620_100001376 3300006931 Bacteria 24747
132 Ga0097620_100010998 3300006931 Bacteria 9106
133 Ga0075435_100011410 3300007076 Bacteria 6534
134 Ga0075435_100076731 3300007076 Bacteria 2739
135 Ga0105240_10000404 3300009093 Bacteria 80037
136 Ga0105240_10005878 3300009093 Bacteria 18173
137 Ga0105240_10013939 3300009093 Bacteria 11004
138 Ga0105240_10066337 3300009093 Bacteria 4478
139 Ga0105240_10169177 3300009093 Bacteria 2590
140 Ga0105240_10225869 3300009093 Bacteria 2179
141 Ga0105240_10233343 3300009093 Bacteria 2137
142 Ga0105240_10286856 3300009093 Bacteria 1889
143 Ga0105245_10003847 3300009098 Bacteria 13357
144 Ga0105245_10103767 3300009098 Bacteria 2635
145 Ga0105247_10047171 3300009101 Bacteria 2645
146 Ga0114129_10019995 3300009147 Bacteria 9530
147 Ga0114129_10093497 3300009147 Bacteria 4165
148 Ga0114129_10553859 3300009147 Bacteria 1495
149 Ga0105241_10034461 3300009174 Bacteria 3803
150 Ga0105242_10310867 3300009176 Bacteria 1442
151 Ga0105248_10000004 3300009177 Bacteria 695244
152 Ga0105248_10040393 3300009177 Bacteria 5229
153 Ga0105248_10059503 3300009177 Bacteria 4291
154 Ga0105248_10071590 3300009177 Bacteria 3895
155 Ga0105248_10141632 3300009177 Bacteria 2713
156 Ga0105237_10048516 3300009545 Bacteria 4269
157 Ga0105237_10054554 3300009545 Bacteria 4005
158 Ga0105237_10145226 3300009545 Bacteria 2367
159 Ga0105238_10000216 3300009551 Bacteria 63555
160 Ga0105238_10007682 3300009551 Bacteria 10781
161 Ga0105249_10180154 3300009553 Bacteria 2055
162 Ga0105239_10024204 3300010375 Bacteria 6687
163 Ga0105239_10050510 3300010375 Bacteria 4561
164 Ga0105239_10505457 3300010375 Bacteria 1374
165 Ga0157371_10096808 3300013102 Bacteria 2092
166 Ga0157370_10027740 3300013104 Bacteria 5582
167 Ga0157370_10030774 3300013104 Bacteria 5258
168 Ga0157370_10211143 3300013104 Bacteria 1799
169 Ga0157369_10000041 3300013105 Bacteria 181798
170 Ga0157369_10008530 3300013105 Bacteria 11754
171 Ga0157369_10016299 3300013105 Bacteria 8365
172 Ga0157369_10115767 3300013105 Bacteria 2847
173 Ga0157369_10115950 3300013105 Bacteria 2844
174 Ga0157369_10305472 3300013105 Unclassified 1655
175 Ga0157374_10000078 3300013296 Bacteria 97051
176 Ga0157374_10000238 3300013296 Bacteria 51261
177 Ga0157374_10007667 3300013296 Bacteria 9215
178 Ga0157374_10070102 3300013296 Bacteria 3302
179 Ga0157378_10000132 3300013297 Bacteria 71918
180 Ga0157378_10000603 3300013297 Bacteria 33724
181 Ga0157378_10000773 3300013297 Bacteria 29713
182 Ga0157378_10018725 3300013297 Bacteria 6086
183 Ga0163162_10002552 3300013306 Bacteria 17234
184 Ga0157372_10000319 3300013307 Bacteria 52819
185 Ga0157372_10000369 3300013307 Bacteria 49966
186 Ga0157372_10001848 3300013307 Bacteria 22942
187 Ga0157372_10004982 3300013307 Bacteria 14112
188 Ga0157372_10007652 3300013307 Bacteria 11487
189 Ga0157372_10010849 3300013307 Bacteria 9699
190 Ga0157372_10010935 3300013307 Bacteria 9659
191 Ga0157372_10052844 3300013307 Unclassified 4526
192 Ga0157372_10053496 3300013307 Bacteria 4500
193 Ga0157372_10132805 3300013307 Bacteria 2866
194 Ga0163163_10094424 3300014325 Bacteria 3009
195 Ga0163163_10130171 3300014325 Bacteria 2556
196 Ga0157380_10047859 3300014326 Bacteria 3365
197 Ga0157380_10142261 3300014326 Bacteria 2063
198 Ga0157379_10034532 3300014968 Bacteria 4509
199 Ga0157376_10043915 3300014969 Bacteria 3671
200 Ga0213876_10001597 3300021384 Bacteria 13930
201 Ga0213875_10000084 3300021388 Bacteria 109683
202 Ga0213875_10044921 3300021388 Bacteria 2074
203 Ga0213875_10106106 3300021388 Bacteria 1312
204 Ga0228598_1001445 3300024227 Bacteria 5232
205 Ga0207692_10009120 3300025898 Bacteria 4130
206 Ga0207692_10089692 3300025898 Bacteria 1664
207 Ga0207680_10105213 3300025903 Bacteria 1820
208 Ga0207647_10003038 3300025904 Bacteria 12616
209 Ga0207647_10010019 3300025904 Bacteria 6711
210 Ga0207699_10006900 3300025906 Bacteria 5525
211 Ga0207699_10033913 3300025906 Bacteria 2890
212 Ga0207643_10045189 3300025908 Bacteria 2487
213 Ga0207643_10070215 3300025908 Bacteria 2014
214 Ga0207705_10004104 3300025909 Bacteria 11043
215 Ga0207684_10026988 3300025910 Bacteria 4897
216 Ga0207684_10162900 3300025910 Bacteria 1921
217 Ga0207654_10003745 3300025911 Bacteria 7670
218 Ga0207707_10052048 3300025912 Bacteria 3566
219 Ga0207707_10094223 3300025912 Bacteria 2616
220 Ga0207707_10109425 3300025912 Bacteria 2416
221 Ga0207707_10172937 3300025912 Bacteria 1887
222 Ga0207695_10007441 3300025913 Bacteria 13935
223 Ga0207695_10009484 3300025913 Bacteria 12037
224 Ga0207695_10025602 3300025913 Bacteria 6600
225 Ga0207695_10207896 3300025913 Bacteria 1869
226 Ga0207695_10270875 3300025913 Bacteria 1594
227 Ga0207671_10153048 3300025914 Bacteria 1782
228 Ga0207693_10000016 3300025915 Bacteria 145892
229 Ga0207693_10000065 3300025915 Bacteria 91476
230 Ga0207693_10000241 3300025915 Bacteria 50544
231 Ga0207693_10040304 3300025915 Bacteria 3678
232 Ga0207693_10204685 3300025915 Bacteria 1552
233 Ga0207663_10000935 3300025916 Bacteria 13320
234 Ga0207663_10005184 3300025916 Bacteria 6555
235 Ga0207663_10106292 3300025916 Bacteria 1897
236 Ga0207657_10006692 3300025919 Bacteria 11915
237 Ga0207657_10019466 3300025919 Bacteria 6445
238 Ga0207657_10020895 3300025919 Bacteria 6178
239 Ga0207649_10016368 3300025920 Bacteria 4180
240 Ga0207652_10011109 3300025921 Bacteria 7257
241 Ga0207652_10047802 3300025921 Bacteria 3655
242 Ga0207652_10090845 3300025921 Bacteria 2684
243 Ga0207652_10299782 3300025921 Bacteria 1451
244 Ga0207694_10004019 3300025924 Bacteria 11587
245 Ga0207650_10007687 3300025925 Bacteria 7341
246 Ga0207687_10055116 3300025927 Bacteria 2785
247 Ga0207700_10001701 3300025928 Bacteria 12490
248 Ga0207700_10001772 3300025928 Bacteria 12238
249 Ga0207700_10019265 3300025928 Bacteria 4606
250 Ga0207700_10108400 3300025928 Bacteria 2230
251 Ga0207700_10113200 3300025928 Bacteria 2187
252 Ga0207700_10231013 3300025928 Bacteria 1573
253 Ga0207664_10000098 3300025929 Bacteria 80444
254 Ga0207664_10017221 3300025929 Bacteria 5292
255 Ga0207644_10056599 3300025931 Bacteria 2830
256 Ga0207690_10059813 3300025932 Unclassified 2583
257 Ga0207690_10098118 3300025932 Bacteria 2086
258 Ga0207706_10002906 3300025933 Bacteria 16558
259 Ga0207706_10047297 3300025933 Bacteria 3807
260 Ga0207686_10047768 3300025934 Bacteria 2648
261 Ga0207670_10167492 3300025936 Unclassified 1645
262 Ga0207704_10007986 3300025938 Bacteria 5032
263 Ga0207665_10010664 3300025939 Bacteria 6035
264 Ga0207665_10010856 3300025939 Bacteria 5981
265 Ga0207665_10048755 3300025939 Unclassified 2845
266 Ga0207665_10055401 3300025939 Bacteria 2675
267 Ga0207711_10000008 3300025941 Bacteria 597686
268 Ga0207711_10000010 3300025941 Bacteria 557970
269 Ga0207711_10001821 3300025941 Bacteria 19442
270 Ga0207661_10000049 3300025944 Bacteria 93797
271 Ga0207661_10060531 3300025944 Bacteria 3056
272 Ga0207679_10002250 3300025945 Bacteria 11906
273 Ga0207679_10232447 3300025945 Bacteria 1558
274 Ga0207667_10008195 3300025949 Bacteria 12436
275 Ga0207667_10008385 3300025949 Bacteria 12280
276 Ga0207667_10022358 3300025949 Bacteria 6989
277 Ga0207667_10047755 3300025949 Bacteria 4530
278 Ga0207667_10052121 3300025949 Bacteria 4312
279 Ga0207667_10127757 3300025949 Bacteria 2618
280 Ga0207651_10158509 3300025960 Bacteria 1771
281 Ga0207668_10009024 3300025972 Bacteria 5959
282 Ga0207640_10003211 3300025981 Bacteria 8808
283 Ga0207640_10006461 3300025981 Bacteria 6434
284 Ga0207640_10015750 3300025981 Bacteria 4383
285 Ga0207658_10104427 3300025986 Bacteria 2226
286 Ga0207677_10007354 3300026023 Bacteria 6084
287 Ga0207677_10019675 3300026023 Bacteria 4083
288 Ga0207677_10033633 3300026023 Bacteria 3310
289 Ga0207677_10046018 3300026023 Bacteria 2918
290 Ga0207703_10018886 3300026035 Bacteria 5385
291 Ga0207703_10023988 3300026035 Bacteria 4799
292 Ga0207703_10059418 3300026035 Bacteria 3123
293 Ga0207703_10197740 3300026035 Bacteria 1785
294 Ga0207678_10012805 3300026067 Bacteria 7365
295 Ga0207702_10001327 3300026078 Bacteria 24772
296 Ga0207702_10001798 3300026078 Bacteria 21118
297 Ga0207702_10002870 3300026078 Bacteria 16118
298 Ga0207702_10007465 3300026078 Bacteria 9325
299 Ga0207702_10007962 3300026078 Bacteria 8980
300 Ga0207702_10019846 3300026078 Bacteria 5567
301 Ga0207702_10123469 3300026078 Bacteria 2321
302 Ga0207641_10069854 3300026088 Bacteria 3017
303 Ga0207641_10282348 3300026088 Bacteria 1562
304 Ga0207648_10008078 3300026089 Bacteria 10251
305 Ga0207676_10003613 3300026095 Bacteria 10937
306 Ga0207676_10134201 3300026095 Bacteria 2109
307 Ga0207674_10001561 3300026116 Bacteria 29504
308 Ga0207674_10006365 3300026116 Bacteria 13896
309 Ga0207674_10007367 3300026116 Bacteria 12815
310 Ga0207674_10045026 3300026116 Bacteria 4541
311 Ga0207675_100025623 3300026118 Bacteria 5488
312 Ga0207698_10142588 3300026142 Bacteria 2067
313 Ga0207698_10237122 3300026142 Bacteria 1660
314 Ga0265356_1000024 3300028017 Bacteria 23952
315 Ga0268266_10020573 3300028379 Bacteria 5623
316 Ga0268266_10025754 3300028379 Bacteria 5005
317 Ga0268264_10015105 3300028381 Bacteria 6334
318 Ga0268264_10050652 3300028381 Bacteria 3458
319 Ga0265336_10030600 3300028666 Unclassified 1676
320 Ga0265338_10002211 3300028800 Bacteria 29688
321 Ga0265762_1000326 3300030760 Bacteria 8063
322 Ga0265760_10000017 3300031090 Bacteria 89357
323 Ga0265760_10009357 3300031090 Unclassified 2801
324 Ga0265340_10047438 3300031247 Unclassified 2092
325 Ga0265339_10011904 3300031249 Bacteria 5333
326 Ga0265316_10033368 3300031344 Unclassified 4192
327 Ga0265313_10027086 3300031595 Bacteria 3006
328 Ga0373926_0058539 3300035083 Unclassified 1401
329 Ga0373923_0001166 3300035111 Bacteria 7311
330 Ga0373923_0010121 3300035111 Unclassified 3423
331 Ga0373936_0006973 3300035113 Unclassified 4253
332 Ga0373936_0012804 3300035113 Bacteria 3197
333 Ga0373939_0053962 3300035114 Bacteria 1257
334 Ga0373945_0029032 3300035116 Bacteria 1941
335 Ga0373954_0041617 3300035118 Bacteria 2143
336 Ga0373956_0042667 3300035119 Unclassified 2017
337 Ga0373943_0000281 3300035170 Bacteria 21061
338 Ga0373943_0013298 3300035170 Bacteria 3716
339 Ga0373924_0035407 3300035410 Unclassified 2024
340 Ga0373931_0032492 3300035691 Bacteria 2701
341 Ga0373931_0043980 3300035691 Bacteria 2354
342 Ga0373935_0003233 3300035692 Bacteria 9415
343 Ga0373935_0031293 3300035692 Unclassified 3301
344 Ga0373935_0263427 3300035692 Bacteria 1209
345 Ga0373935_0290707 3300035692 Bacteria 1153
346 Ga0373927_0000219 3300035695 Bacteria 45343
347 Ga0373927_0070368 3300035695 Bacteria 2265
348 Ga0373933_0080872 3300035724 Bacteria 1992
349 Ga0373947_0000085 3300035725 Bacteria 46581
350 Ga0373947_0030797 3300035725 Bacteria 3154
351 Ga0373937_0056267 3300036401 Bacteria 3612
352 Ga0373925_0001397 3300037068 Bacteria 21000
353 Ga0373925_0009749 3300037068 Bacteria 6976
354 Ga0373925_0010038 3300037068 Bacteria 6878
355 Ga0373925_0090766 3300037068 Unclassified 2336
356 Ga0373925_0418347 3300037068 Bacteria 1095
357 Ga0436364_0147763 3300037853 Unclassified 1386
358 Ga0436364_0576140 3300037853 Bacteria 2623
359 Ga0436364_0880534 3300037853 Bacteria 127762
360 Ga0436364_0946148 3300037853 Unclassified 2601
361 Ga0436364_1121302 3300037853 Bacteria 1450
362 Ga0436365_0147581 3300039437 Bacteria 16101
363 Ga0436365_1824253 3300039437 Bacteria 2030
364 Ga0436363_0440558 3300039450 Bacteria 5560
365 Ga0436363_0719219 3300039450 Bacteria 3306
366 Ga0466963_0025462 3300044694 Unclassified 3774
367 Ga0466964_0059504 3300044706 Bacteria 1587
368 Ga0495592_0264924 3300046454 Bacteria 1130
369 Ga0495603_0048416 3300046455 Bacteria 2531
370 Ga0495603_0059384 3300046455 Bacteria 2261
371 Ga0495629_0008230 3300046459 Bacteria 7667
372 Ga0495653_0031072 3300046463 Unclassified 4248
373 Ga0495580_0000243 3300046472 Bacteria 43209
374 Ga0495580_0002445 3300046472 Bacteria 16238
375 Ga0495580_0003947 3300046472 Bacteria 12511
376 Ga0495580_0015668 3300046472 Bacteria 5713
377 Ga0495580_0033793 3300046472 Bacteria 3683
378 Ga0495580_0069887 3300046472 Bacteria 2453
379 Ga0495580_0158639 3300046472 Bacteria 1566
380 Ga0495582_0033985 3300046473 Bacteria 2803
381 Ga0495639_0013516 3300046475 Bacteria 3527
382 Ga0495664_0007432 3300046477 Bacteria 6085
383 Ga0495664_0091001 3300046477 Bacteria 1834
384 Ga0495584_0033774 3300046491 Bacteria 2589
385 Ga0495628_0165853 3300046516 Bacteria 1677
386 Ga0495587_0141650 3300046536 Bacteria 1372
387 Ga0495645_0255675 3300046543 Bacteria 1162
388 Ga0495667_0148476 3300046559 Bacteria 1510
389 Ga0495657_0095800 3300046675 Bacteria 1897
390 Ga0495623_0038545 3300046679 Bacteria 3056
391 Ga0495669_0084841 3300046684 Bacteria 1457
392 Ga0495581_0074301 3300047315 Bacteria 1967
393 Ga0495674_0124707 3300047319 Unclassified 2174
394 Ga0495675_0027189 3300047444 Bacteria 3646
395 Ga0495684_0146155 3300047471 Unclassified 1771
396 Ga0495602_0099025 3300048088 Bacteria 2398
397 Ga0496102_0002949 3300048905 Bacteria 14436
398 Ga0496102_0043943 3300048905 Bacteria 4052
399 Ga0496102_0077172 3300048905 Bacteria 3066
400 Ga0496103_0010098 3300048906 Bacteria 5582
401 Ga0496104_0289519 3300048907 Bacteria 1550
402 Ga0496105_0086333 3300048908 Bacteria 2593
403 Ga0496106_0031584 3300048909 Bacteria 3947
404 Ga0496107_0019408 3300048910 Bacteria 4796
405 Ga0496107_0021097 3300048910 Bacteria 4603
406 Ga0496112_0001064 3300048915 Bacteria 20256
407 Ga0496112_0059621 3300048915 Bacteria 3761
408 Ga0496115_0036905 3300048918 Unclassified 3871
409 Ga0496115_0079363 3300048918 Bacteria 2671
410 Ga0496115_0378821 3300048918 Unclassified 1151
411 Ga0496126_0000723 3300048929 Bacteria 60037
412 Ga0501033_0111379 3300049570 Bacteria 1992
413 Ga0501047_0030544 3300049581 Bacteria 5193
414 Ga0501070_0130986 3300049586 Bacteria 2072
415 Ga0501073_0091044 3300049589 Bacteria 2120
416 Ga0501235_020182 3300049669 Unclassified 1480
417 nmdc:mga05p37_129961_c1 3300050507 Bacteria 3090
418 nmdc:mga05p37_5175_c1 3300050507 Bacteria 15297
419 nmdc:mga05p37_532460_c1 3300050507 Eukaryota 1341
420 nmdc:mga0qj67_29713_c1 3300050509 Bacteria 4246
421 nmdc:mga0n895_21279_c1 3300050512 Bacteria 6061
422 nmdc:mga0rr50_154534_c1 3300050513 Bacteria 1857
423 nmdc:mga0rr50_21812_c1 3300050513 Bacteria 4381
424 nmdc:mga0a205_147276_c1 3300050515 Bacteria 2255

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048910 Ga0496107_0019408 Ga0496107_0019408_3753_4742 290
2 3300009545 Ga0105237_10054554 Ga0105237_100545543 316
3 3300035692 Ga0373935_0290707 Ga0373935_0290707_35_1006 317
4 3300046475 Ga0495639_0013516 Ga0495639_0013516_74_1057 317
5 3300013102 Ga0157371_10096808 Ga0157371_100968083 318
6 3300035111 Ga0373923_0010121 Ga0373923_0010121_16_1005 318
7 3300037068 Ga0373925_0418347 Ga0373925_0418347_51_1040 318
8 3300037853 Ga0436364_0147763 Ga0436364_0147763_109_1107 318
9 3300046472 Ga0495580_0015668 Ga0495580_0015668_1702_2748 318
10 3300046516 Ga0495628_0165853 Ga0495628_0165853_673_1662 318
11 3300046543 Ga0495645_0255675 Ga0495645_0255675_154_1143 318
12 3300046684 Ga0495669_0084841 Ga0495669_0084841_455_1444 318
13 3300005843 Ga0068860_100042163 Ga0068860_1000421632 328
14 3300009093 Ga0105240_10005878 Ga0105240_1000587815 328
15 3300025913 Ga0207695_10009484 Ga0207695_100094848 328
16 3300028381 Ga0268264_10015105 Ga0268264_100151052 328
17 3300046472 Ga0495580_0158639 Ga0495580_0158639_327_1340 328
18 3300031595 Ga0265313_10027086 Ga0265313_100270863 330
19 3300048918 Ga0496115_0378821 Ga0496115_0378821_78_1115 333
20 3300005545 Ga0070695_100110792 Ga0070695_1001107922 336
21 3300009101 Ga0105247_10047171 Ga0105247_100471713 336
22 3300014968 Ga0157379_10034532 Ga0157379_100345323 336
23 3300048905 Ga0496102_0002949 Ga0496102_0002949_9970_11100 336
24 3300048906 Ga0496103_0010098 Ga0496103_0010098_3158_4288 336
25 3300048909 Ga0496106_0031584 Ga0496106_0031584_240_1370 336
26 3300005436 Ga0070713_100000675 Ga0070713_10000067517 337
27 3300005439 Ga0070711_100000291 Ga0070711_1000002914 337
28 3300021388 Ga0213875_10044921 Ga0213875_100449212 337
29 3300025915 Ga0207693_10000016 Ga0207693_10000016107 337
30 3300035695 Ga0373927_0070368 Ga0373927_0070368_1179_2225 337
31 3300037068 Ga0373925_0009749 Ga0373925_0009749_1927_2976 337
32 3300049589 Ga0501073_0091044 Ga0501073_0091044_1008_2048 337
33 3300005518 Ga0070699_100132180 Ga0070699_1001321801 338
34 3300035114 Ga0373939_0053962 Ga0373939_0053962_37_1122 338
35 3300024227 Ga0228598_1001445 Ga0228598_10014453 341
36 3300009093 Ga0105240_10233343 Ga0105240_102333433 342
37 3300013307 Ga0157372_10010849 Ga0157372_100108494 342
38 3300044706 Ga0466964_0059504 Ga0466964_0059504_324_1454 344
39 3300025915 Ga0207693_10204685 Ga0207693_102046851 345
40 3300006847 Ga0075431_100017885 Ga0075431_1000178855 346
41 3300009147 Ga0114129_10093497 Ga0114129_100934973 346
42 3300050509 nmdc:mga0qj67_29713_c1 nmdc:mga0qj67_29713_c1_2810_3940 346
43 3300009093 Ga0105240_10000404 Ga0105240_1000040433 348
44 3300025913 Ga0207695_10007441 Ga0207695_100074412 348
45 3300014325 Ga0163163_10094424 Ga0163163_100944243 353
46 3300025913 Ga0207695_10025602 Ga0207695_100256026 353
47 3300026095 Ga0207676_10134201 Ga0207676_101342012 353
48 3300005445 Ga0070708_100013214 Ga0070708_1000132143 354
49 3300005467 Ga0070706_100000445 Ga0070706_10000044515 354
50 3300005518 Ga0070699_100126548 Ga0070699_1001265483 354
51 3300005536 Ga0070697_100000400 Ga0070697_10000040010 354
52 3300009177 Ga0105248_10141632 Ga0105248_101416322 354
53 3300013105 Ga0157369_10016299 Ga0157369_100162995 354
54 3300013307 Ga0157372_10010935 Ga0157372_100109356 354
55 3300025910 Ga0207684_10026988 Ga0207684_100269885 354
56 3300046455 Ga0495603_0048416 Ga0495603_0048416_402_1532 354
57 3300046472 Ga0495580_0002445 Ga0495580_0002445_10310_11440 354
58 3300005548 Ga0070665_100090526 Ga0070665_1000905263 355
59 3300005614 Ga0068856_100014449 Ga0068856_1000144493 355
60 3300013105 Ga0157369_10305472 Ga0157369_103054723 355
61 3300013307 Ga0157372_10053496 Ga0157372_100534963 355
62 3300025919 Ga0207657_10019466 Ga0207657_100194665 355
63 3300025929 Ga0207664_10000098 Ga0207664_100000988 355
64 3300025932 Ga0207690_10059813 Ga0207690_100598133 355
65 3300026078 Ga0207702_10007465 Ga0207702_100074654 355
66 3300028379 Ga0268266_10020573 Ga0268266_100205735 355
67 3300035083 Ga0373926_0058539 Ga0373926_0058539_287_1387 355
68 3300046454 Ga0495592_0264924 Ga0495592_0264924_18_1109 355
69 3300046675 Ga0495657_0095800 Ga0495657_0095800_28_1128 355
70 3300005435 Ga0070714_100067483 Ga0070714_1000674832 356
71 3300005436 Ga0070713_100005598 Ga0070713_1000055984 356
72 3300006175 Ga0070712_100002753 Ga0070712_1000027537 356
73 3300009093 Ga0105240_10066337 Ga0105240_100663375 356
74 3300013105 Ga0157369_10115950 Ga0157369_101159503 356
75 3300013307 Ga0157372_10001848 Ga0157372_100018482 356
76 3300025928 Ga0207700_10019265 Ga0207700_100192653 356
77 3300009147 Ga0114129_10019995 Ga0114129_100199957 359
78 3300050507 nmdc:mga05p37_5175_c1 nmdc:mga05p37_5175_c1_11262_12410 359
79 3300014325 Ga0163163_10130171 Ga0163163_101301712 360
80 3300049669 Ga0501235_020182 Ga0501235_020182_92_1204 360
81 3300005840 Ga0068870_10016046 Ga0068870_100160462 361
82 3300009147 Ga0114129_10553859 Ga0114129_105538592 361
83 3300014326 Ga0157380_10047859 Ga0157380_100478593 361
84 3300025908 Ga0207643_10070215 Ga0207643_100702152 361
85 3300050507 nmdc:mga05p37_532460_c1 nmdc:mga05p37_532460_c1_184_1305 361
86 3300005457 Ga0070662_100067296 Ga0070662_1000672962 362
87 3300005548 Ga0070665_100317013 Ga0070665_1003170133 362
88 3300005564 Ga0070664_100004040 Ga0070664_10000404010 362
89 3300005614 Ga0068856_100044831 Ga0068856_1000448315 362
90 3300013105 Ga0157369_10008530 Ga0157369_100085303 362
91 3300013296 Ga0157374_10070102 Ga0157374_100701022 362
92 3300025933 Ga0207706_10047297 Ga0207706_100472974 362
93 3300048918 Ga0496115_0036905 Ga0496115_0036905_1192_2313 362
94 3300005842 Ga0068858_100229372 Ga0068858_1002293722 363
95 3300006871 Ga0075434_100001797 Ga0075434_1000017972 363
96 3300006914 Ga0075436_100038499 Ga0075436_1000384993 363
97 3300007076 Ga0075435_100011410 Ga0075435_1000114103 363
98 3300021384 Ga0213876_10001597 Ga0213876_100015975 363
99 3300026035 Ga0207703_10197740 Ga0207703_101977402 363
100 3300037853 Ga0436364_0576140 Ga0436364_0576140_1236_2357 363
101 3300037853 Ga0436364_0946148 Ga0436364_0946148_1279_2415 363
102 3300039437 Ga0436365_0147581 Ga0436365_0147581_8897_10024 363
103 3300046472 Ga0495580_0033793 Ga0495580_0033793_1920_3041 363
104 3300047315 Ga0495581_0074301 Ga0495581_0074301_339_1460 363
105 3300048929 Ga0496126_0000723 Ga0496126_0000723_12503_13612 363
106 3300050512 nmdc:mga0n895_21279_c1 nmdc:mga0n895_21279_c1_3379_4506 363
107 3300050513 nmdc:mga0rr50_21812_c1 nmdc:mga0rr50_21812_c1_102_1229 363
108 3300005329 Ga0070683_100010625 Ga0070683_1000106253 364
109 3300005336 Ga0070680_100067580 Ga0070680_1000675802 364
110 3300005338 Ga0068868_100006053 Ga0068868_1000060536 364
111 3300005338 Ga0068868_100019540 Ga0068868_1000195404 364
112 3300005338 Ga0068868_100031311 Ga0068868_1000313111 364
113 3300005339 Ga0070660_100004991 Ga0070660_10000499110 364
114 3300005339 Ga0070660_100169443 Ga0070660_1001694432 364
115 3300005340 Ga0070689_100201515 Ga0070689_1002015153 364
116 3300005344 Ga0070661_100034267 Ga0070661_1000342674 364
117 3300005354 Ga0070675_100296634 Ga0070675_1002966342 364
118 3300005364 Ga0070673_100060828 Ga0070673_1000608284 364
119 3300005366 Ga0070659_100009128 Ga0070659_1000091283 364
120 3300005366 Ga0070659_100010419 Ga0070659_1000104196 364
121 3300005366 Ga0070659_100280799 Ga0070659_1002807991 364
122 3300005434 Ga0070709_10000540 Ga0070709_100005409 364
123 3300005435 Ga0070714_100000027 Ga0070714_10000002746 364
124 3300005435 Ga0070714_100078627 Ga0070714_1000786272 364
125 3300005435 Ga0070714_100419077 Ga0070714_1004190771 364
126 3300005436 Ga0070713_100001436 Ga0070713_1000014364 364
127 3300005436 Ga0070713_100003514 Ga0070713_1000035147 364
128 3300005436 Ga0070713_100115522 Ga0070713_1001155222 364
129 3300005437 Ga0070710_10035866 Ga0070710_100358663 364
130 3300005437 Ga0070710_10057217 Ga0070710_100572172 364
131 3300005439 Ga0070711_100002406 Ga0070711_1000024065 364
132 3300005439 Ga0070711_100019403 Ga0070711_1000194033 364
133 3300005445 Ga0070708_100000501 Ga0070708_10000050110 364
134 3300005445 Ga0070708_100060747 Ga0070708_1000607472 364
135 3300005455 Ga0070663_100130008 Ga0070663_1001300082 364
136 3300005458 Ga0070681_10026999 Ga0070681_100269995 364
137 3300005458 Ga0070681_10075692 Ga0070681_100756922 364
138 3300005458 Ga0070681_10114148 Ga0070681_101141482 364
139 3300005458 Ga0070681_10196457 Ga0070681_101964572 364
140 3300005459 Ga0068867_100006371 Ga0068867_1000063713 364
141 3300005467 Ga0070706_100181135 Ga0070706_1001811353 364
142 3300005468 Ga0070707_100003309 Ga0070707_1000033093 364
143 3300005471 Ga0070698_100069578 Ga0070698_1000695783 364
144 3300005530 Ga0070679_100028449 Ga0070679_1000284493 364
145 3300005530 Ga0070679_100043796 Ga0070679_1000437963 364
146 3300005530 Ga0070679_100084649 Ga0070679_1000846494 364
147 3300005530 Ga0070679_100087793 Ga0070679_1000877932 364
148 3300005530 Ga0070679_100148093 Ga0070679_1001480932 364
149 3300005535 Ga0070684_100015433 Ga0070684_1000154334 364
150 3300005535 Ga0070684_100025493 Ga0070684_1000254933 364
151 3300005539 Ga0068853_100029924 Ga0068853_1000299242 364
152 3300005563 Ga0068855_100002907 Ga0068855_10000290713 364
153 3300005563 Ga0068855_100003433 Ga0068855_1000034337 364
154 3300005563 Ga0068855_100047506 Ga0068855_1000475063 364
155 3300005564 Ga0070664_100004168 Ga0070664_1000041687 364
156 3300005564 Ga0070664_100281850 Ga0070664_1002818502 364
157 3300005577 Ga0068857_100001303 Ga0068857_1000013039 364
158 3300005577 Ga0068857_100020666 Ga0068857_1000206662 364
159 3300005577 Ga0068857_100024816 Ga0068857_1000248165 364
160 3300005577 Ga0068857_100055661 Ga0068857_1000556613 364
161 3300005578 Ga0068854_100010526 Ga0068854_1000105264 364
162 3300005578 Ga0068854_100051745 Ga0068854_1000517454 364
163 3300005578 Ga0068854_100170293 Ga0068854_1001702932 364
164 3300005614 Ga0068856_100001061 Ga0068856_10000106115 364
165 3300005614 Ga0068856_100003033 Ga0068856_10000303319 364
166 3300005614 Ga0068856_100003434 Ga0068856_1000034346 364
167 3300005614 Ga0068856_100005358 Ga0068856_1000053583 364
168 3300005616 Ga0068852_100051972 Ga0068852_1000519723 364
169 3300005616 Ga0068852_100285552 Ga0068852_1002855522 364
170 3300005617 Ga0068859_100001375 Ga0068859_1000013756 364
171 3300005618 Ga0068864_100000812 Ga0068864_1000008128 364
172 3300005840 Ga0068870_10013832 Ga0068870_100138322 364
173 3300005842 Ga0068858_100004322 Ga0068858_1000043228 364
174 3300005842 Ga0068858_100036894 Ga0068858_1000368942 364
175 3300005842 Ga0068858_100085283 Ga0068858_1000852832 364
176 3300005843 Ga0068860_100010174 Ga0068860_1000101743 364
177 3300005843 Ga0068860_100296542 Ga0068860_1002965422 364
178 3300005937 Ga0081455_10058501 Ga0081455_100585012 364
179 3300006028 Ga0070717_10002865 Ga0070717_1000286511 364
180 3300006028 Ga0070717_10009093 Ga0070717_100090934 364
181 3300006028 Ga0070717_10060878 Ga0070717_100608782 364
182 3300006173 Ga0070716_100003303 Ga0070716_1000033036 364
183 3300006173 Ga0070716_100009781 Ga0070716_1000097813 364
184 3300006173 Ga0070716_100033830 Ga0070716_1000338303 364
185 3300006175 Ga0070712_100000105 Ga0070712_10000010527 364
186 3300006175 Ga0070712_100001546 Ga0070712_1000015462 364
187 3300006175 Ga0070712_100002207 Ga0070712_1000022073 364
188 3300006175 Ga0070712_100023342 Ga0070712_1000233423 364
189 3300006237 Ga0097621_100002424 Ga0097621_1000024248 364
190 3300006237 Ga0097621_100003366 Ga0097621_1000033663 364
191 3300006237 Ga0097621_100016447 Ga0097621_1000164473 364
192 3300006237 Ga0097621_100048283 Ga0097621_1000482832 364
193 3300006358 Ga0068871_100000026 Ga0068871_10000002656 364
194 3300006358 Ga0068871_100000497 Ga0068871_10000049717 364
195 3300006358 Ga0068871_100005110 Ga0068871_1000051106 364
196 3300006358 Ga0068871_100024873 Ga0068871_1000248733 364
197 3300006852 Ga0075433_10004469 Ga0075433_100044697 364
198 3300006871 Ga0075434_100003010 Ga0075434_1000030104 364
199 3300006881 Ga0068865_100018597 Ga0068865_1000185971 364
200 3300006931 Ga0097620_100001376 Ga0097620_1000013766 364
201 3300007076 Ga0075435_100076731 Ga0075435_1000767313 364
202 3300009093 Ga0105240_10013939 Ga0105240_100139392 364
203 3300009093 Ga0105240_10225869 Ga0105240_102258693 364
204 3300009093 Ga0105240_10286856 Ga0105240_102868562 364
205 3300009098 Ga0105245_10003847 Ga0105245_100038475 364
206 3300009098 Ga0105245_10103767 Ga0105245_101037672 364
207 3300009174 Ga0105241_10034461 Ga0105241_100344613 364
208 3300009177 Ga0105248_10000004 Ga0105248_1000000456 364
209 3300009177 Ga0105248_10059503 Ga0105248_100595033 364
210 3300009177 Ga0105248_10071590 Ga0105248_100715903 364
211 3300009545 Ga0105237_10048516 Ga0105237_100485165 364
212 3300009551 Ga0105238_10000216 Ga0105238_1000021612 364
213 3300009551 Ga0105238_10007682 Ga0105238_100076824 364
214 3300009553 Ga0105249_10180154 Ga0105249_101801542 364
215 3300010375 Ga0105239_10024204 Ga0105239_100242045 364
216 3300010375 Ga0105239_10050510 Ga0105239_100505103 364
217 3300013104 Ga0157370_10027740 Ga0157370_100277406 364
218 3300013104 Ga0157370_10030774 Ga0157370_100307744 364
219 3300013104 Ga0157370_10211143 Ga0157370_102111433 364
220 3300013105 Ga0157369_10000041 Ga0157369_1000004112 364
221 3300013105 Ga0157369_10115767 Ga0157369_101157672 364
222 3300013296 Ga0157374_10000078 Ga0157374_1000007862 364
223 3300013296 Ga0157374_10000238 Ga0157374_1000023821 364
224 3300013297 Ga0157378_10000132 Ga0157378_1000013227 364
225 3300013297 Ga0157378_10000603 Ga0157378_100006037 364
226 3300013297 Ga0157378_10000773 Ga0157378_1000077315 364
227 3300013297 Ga0157378_10018725 Ga0157378_100187253 364
228 3300013307 Ga0157372_10000319 Ga0157372_1000031912 364
229 3300013307 Ga0157372_10000369 Ga0157372_100003695 364
230 3300013307 Ga0157372_10004982 Ga0157372_1000498216 364
231 3300013307 Ga0157372_10007652 Ga0157372_100076526 364
232 3300013307 Ga0157372_10052844 Ga0157372_100528443 364
233 3300014326 Ga0157380_10142261 Ga0157380_101422612 364
234 3300014969 Ga0157376_10043915 Ga0157376_100439153 364
235 3300021388 Ga0213875_10000084 Ga0213875_1000008433 364
236 3300021388 Ga0213875_10106106 Ga0213875_101061062 364
237 3300025898 Ga0207692_10009120 Ga0207692_100091203 364
238 3300025898 Ga0207692_10089692 Ga0207692_100896922 364
239 3300025904 Ga0207647_10003038 Ga0207647_100030389 364
240 3300025904 Ga0207647_10010019 Ga0207647_100100196 364
241 3300025906 Ga0207699_10006900 Ga0207699_100069005 364
242 3300025906 Ga0207699_10033913 Ga0207699_100339133 364
243 3300025908 Ga0207643_10045189 Ga0207643_100451893 364
244 3300025909 Ga0207705_10004104 Ga0207705_1000410412 364
245 3300025910 Ga0207684_10162900 Ga0207684_101629002 364
246 3300025912 Ga0207707_10052048 Ga0207707_100520483 364
247 3300025912 Ga0207707_10094223 Ga0207707_100942232 364
248 3300025912 Ga0207707_10172937 Ga0207707_101729373 364
249 3300025913 Ga0207695_10207896 Ga0207695_102078962 364
250 3300025913 Ga0207695_10270875 Ga0207695_102708753 364
251 3300025914 Ga0207671_10153048 Ga0207671_101530481 364
252 3300025915 Ga0207693_10000065 Ga0207693_1000006540 364
253 3300025915 Ga0207693_10000241 Ga0207693_1000024115 364
254 3300025915 Ga0207693_10040304 Ga0207693_100403044 364
255 3300025916 Ga0207663_10000935 Ga0207663_1000093511 364
256 3300025916 Ga0207663_10005184 Ga0207663_100051843 364
257 3300025916 Ga0207663_10106292 Ga0207663_101062923 364
258 3300025919 Ga0207657_10020895 Ga0207657_100208952 364
259 3300025920 Ga0207649_10016368 Ga0207649_100163684 364
260 3300025921 Ga0207652_10011109 Ga0207652_100111096 364
261 3300025921 Ga0207652_10090845 Ga0207652_100908453 364
262 3300025921 Ga0207652_10299782 Ga0207652_102997822 364
263 3300025924 Ga0207694_10004019 Ga0207694_100040198 364
264 3300025925 Ga0207650_10007687 Ga0207650_100076872 364
265 3300025928 Ga0207700_10001701 Ga0207700_100017018 364
266 3300025928 Ga0207700_10001772 Ga0207700_100017725 364
267 3300025928 Ga0207700_10108400 Ga0207700_101084002 364
268 3300025928 Ga0207700_10113200 Ga0207700_101132002 364
269 3300025928 Ga0207700_10231013 Ga0207700_102310133 364
270 3300025929 Ga0207664_10017221 Ga0207664_100172212 364
271 3300025931 Ga0207644_10056599 Ga0207644_100565992 364
272 3300025932 Ga0207690_10098118 Ga0207690_100981182 364
273 3300025938 Ga0207704_10007986 Ga0207704_100079865 364
274 3300025939 Ga0207665_10010664 Ga0207665_100106643 364
275 3300025939 Ga0207665_10010856 Ga0207665_100108565 364
276 3300025939 Ga0207665_10048755 Ga0207665_100487552 364
277 3300025939 Ga0207665_10055401 Ga0207665_100554012 364
278 3300025941 Ga0207711_10000008 Ga0207711_10000008148 364
279 3300025941 Ga0207711_10000010 Ga0207711_10000010329 364
280 3300025944 Ga0207661_10060531 Ga0207661_100605313 364
281 3300025945 Ga0207679_10002250 Ga0207679_100022506 364
282 3300025945 Ga0207679_10232447 Ga0207679_102324472 364
283 3300025949 Ga0207667_10008195 Ga0207667_100081956 364
284 3300025949 Ga0207667_10008385 Ga0207667_100083856 364
285 3300025949 Ga0207667_10047755 Ga0207667_100477553 364
286 3300025949 Ga0207667_10052121 Ga0207667_100521213 364
287 3300025949 Ga0207667_10127757 Ga0207667_101277573 364
288 3300025960 Ga0207651_10158509 Ga0207651_101585093 364
289 3300025981 Ga0207640_10003211 Ga0207640_100032116 364
290 3300025981 Ga0207640_10006461 Ga0207640_100064613 364
291 3300025981 Ga0207640_10015750 Ga0207640_100157503 364
292 3300026023 Ga0207677_10019675 Ga0207677_100196753 364
293 3300026023 Ga0207677_10033633 Ga0207677_100336334 364
294 3300026023 Ga0207677_10046018 Ga0207677_100460183 364
295 3300026035 Ga0207703_10018886 Ga0207703_100188865 364
296 3300026035 Ga0207703_10023988 Ga0207703_100239882 364
297 3300026035 Ga0207703_10059418 Ga0207703_100594182 364
298 3300026067 Ga0207678_10012805 Ga0207678_100128052 364
299 3300026078 Ga0207702_10001327 Ga0207702_1000132721 364
300 3300026078 Ga0207702_10001798 Ga0207702_1000179810 364
301 3300026078 Ga0207702_10002870 Ga0207702_1000287015 364
302 3300026078 Ga0207702_10019846 Ga0207702_100198463 364
303 3300026078 Ga0207702_10123469 Ga0207702_101234692 364
304 3300026088 Ga0207641_10069854 Ga0207641_100698543 364
305 3300026088 Ga0207641_10282348 Ga0207641_102823482 364
306 3300026089 Ga0207648_10008078 Ga0207648_100080786 364
307 3300026095 Ga0207676_10003613 Ga0207676_100036137 364
308 3300026116 Ga0207674_10001561 Ga0207674_1000156115 364
309 3300026116 Ga0207674_10006365 Ga0207674_100063652 364
310 3300026116 Ga0207674_10007367 Ga0207674_1000736716 364
311 3300026116 Ga0207674_10045026 Ga0207674_100450263 364
312 3300026142 Ga0207698_10142588 Ga0207698_101425882 364
313 3300026142 Ga0207698_10237122 Ga0207698_102371222 364
314 3300028017 Ga0265356_1000024 Ga0265356_100002415 364
315 3300028381 Ga0268264_10050652 Ga0268264_100506523 364
316 3300028666 Ga0265336_10030600 Ga0265336_100306002 364
317 3300028800 Ga0265338_10002211 Ga0265338_1000221114 364
318 3300030760 Ga0265762_1000326 Ga0265762_10003264 364
319 3300031090 Ga0265760_10000017 Ga0265760_1000001716 364
320 3300031090 Ga0265760_10009357 Ga0265760_100093573 364
321 3300031247 Ga0265340_10047438 Ga0265340_100474381 364
322 3300031249 Ga0265339_10011904 Ga0265339_100119042 364
323 3300031344 Ga0265316_10033368 Ga0265316_100333682 364
324 3300035111 Ga0373923_0001166 Ga0373923_0001166_5690_6820 364
325 3300035113 Ga0373936_0006973 Ga0373936_0006973_569_1699 364
326 3300035113 Ga0373936_0012804 Ga0373936_0012804_1170_2303 364
327 3300035116 Ga0373945_0029032 Ga0373945_0029032_499_1629 364
328 3300035118 Ga0373954_0041617 Ga0373954_0041617_139_1269 364
329 3300035119 Ga0373956_0042667 Ga0373956_0042667_297_1427 364
330 3300035170 Ga0373943_0000281 Ga0373943_0000281_2315_3445 364
331 3300035170 Ga0373943_0013298 Ga0373943_0013298_318_1451 364
332 3300035410 Ga0373924_0035407 Ga0373924_0035407_36_1166 364
333 3300035691 Ga0373931_0032492 Ga0373931_0032492_1135_2268 364
334 3300035692 Ga0373935_0003233 Ga0373935_0003233_2680_3810 364
335 3300035692 Ga0373935_0031293 Ga0373935_0031293_956_2086 364
336 3300035692 Ga0373935_0263427 Ga0373935_0263427_49_1179 364
337 3300035695 Ga0373927_0000219 Ga0373927_0000219_19034_20164 364
338 3300035724 Ga0373933_0080872 Ga0373933_0080872_708_1838 364
339 3300035725 Ga0373947_0000085 Ga0373947_0000085_15380_16510 364
340 3300035725 Ga0373947_0030797 Ga0373947_0030797_1428_2558 364
341 3300036401 Ga0373937_0056267 Ga0373937_0056267_1535_2668 364
342 3300037068 Ga0373925_0001397 Ga0373925_0001397_15590_16720 364
343 3300037068 Ga0373925_0010038 Ga0373925_0010038_4945_6078 364
344 3300037068 Ga0373925_0090766 Ga0373925_0090766_330_1460 364
345 3300037853 Ga0436364_0880534 Ga0436364_0880534_89778_90902 364
346 3300037853 Ga0436364_1121302 Ga0436364_1121302_133_1260 364
347 3300039437 Ga0436365_1824253 Ga0436365_1824253_39_1166 364
348 3300039450 Ga0436363_0440558 Ga0436363_0440558_2685_3812 364
349 3300039450 Ga0436363_0719219 Ga0436363_0719219_762_1889 364
350 3300044694 Ga0466963_0025462 Ga0466963_0025462_757_1890 364
351 3300046455 Ga0495603_0059384 Ga0495603_0059384_424_1554 364
352 3300046459 Ga0495629_0008230 Ga0495629_0008230_3847_4977 364
353 3300046463 Ga0495653_0031072 Ga0495653_0031072_2136_3266 364
354 3300046472 Ga0495580_0000243 Ga0495580_0000243_39136_40266 364
355 3300046472 Ga0495580_0003947 Ga0495580_0003947_7233_8363 364
356 3300046472 Ga0495580_0069887 Ga0495580_0069887_437_1567 364
357 3300046473 Ga0495582_0033985 Ga0495582_0033985_487_1617 364
358 3300046477 Ga0495664_0007432 Ga0495664_0007432_2505_3635 364
359 3300046477 Ga0495664_0091001 Ga0495664_0091001_629_1762 364
360 3300046491 Ga0495584_0033774 Ga0495584_0033774_853_1983 364
361 3300046536 Ga0495587_0141650 Ga0495587_0141650_21_1154 364
362 3300046559 Ga0495667_0148476 Ga0495667_0148476_262_1395 364
363 3300046679 Ga0495623_0038545 Ga0495623_0038545_55_1188 364
364 3300047319 Ga0495674_0124707 Ga0495674_0124707_619_1749 364
365 3300047444 Ga0495675_0027189 Ga0495675_0027189_273_1406 364
366 3300047471 Ga0495684_0146155 Ga0495684_0146155_492_1622 364
367 3300048088 Ga0495602_0099025 Ga0495602_0099025_1142_2275 364
368 3300048905 Ga0496102_0077172 Ga0496102_0077172_922_2055 364
369 3300048908 Ga0496105_0086333 Ga0496105_0086333_116_1246 364
370 3300048915 Ga0496112_0001064 Ga0496112_0001064_986_2119 364
371 3300048915 Ga0496112_0059621 Ga0496112_0059621_1922_3055 364
372 3300048918 Ga0496115_0079363 Ga0496115_0079363_966_2096 364
373 3300049570 Ga0501033_0111379 Ga0501033_0111379_822_1964 364
374 3300049581 Ga0501047_0030544 Ga0501047_0030544_693_1835 364
375 3300049586 Ga0501070_0130986 Ga0501070_0130986_389_1531 364
376 3300050507 nmdc:mga05p37_129961_c1 nmdc:mga05p37_129961_c1_1225_2358 364
377 3300050513 nmdc:mga0rr50_154534_c1 nmdc:mga0rr50_154534_c1_451_1584 364
378 3300050515 nmdc:mga0a205_147276_c1 nmdc:mga0a205_147276_c1_697_1845 364
379 3300005329 Ga0070683_100000048 Ga0070683_10000004860 365
380 3300005347 Ga0070668_100009861 Ga0070668_1000098612 365
381 3300005457 Ga0070662_100000890 Ga0070662_10000089010 365
382 3300005459 Ga0068867_100029954 Ga0068867_1000299543 365
383 3300005535 Ga0070684_100000038 Ga0070684_10000003825 365
384 3300005546 Ga0070696_100015429 Ga0070696_1000154294 365
385 3300005547 Ga0070693_100085487 Ga0070693_1000854872 365
386 3300005548 Ga0070665_100011150 Ga0070665_1000111504 365
387 3300005563 Ga0068855_100034584 Ga0068855_1000345843 365
388 3300005578 Ga0068854_100003344 Ga0068854_1000033449 365
389 3300005614 Ga0068856_100006511 Ga0068856_10000651110 365
390 3300005617 Ga0068859_100010999 Ga0068859_1000109993 365
391 3300005719 Ga0068861_100045585 Ga0068861_1000455853 365
392 3300005841 Ga0068863_100250884 Ga0068863_1002508842 365
393 3300006914 Ga0075436_100096631 Ga0075436_1000966312 365
394 3300006931 Ga0097620_100010998 Ga0097620_1000109983 365
395 3300009093 Ga0105240_10169177 Ga0105240_101691772 365
396 3300009176 Ga0105242_10310867 Ga0105242_103108672 365
397 3300009177 Ga0105248_10040393 Ga0105248_100403934 365
398 3300009545 Ga0105237_10145226 Ga0105237_101452262 365
399 3300010375 Ga0105239_10505457 Ga0105239_105054572 365
400 3300013296 Ga0157374_10007667 Ga0157374_100076672 365
401 3300013306 Ga0163162_10002552 Ga0163162_100025524 365
402 3300013307 Ga0157372_10132805 Ga0157372_101328054 365
403 3300025903 Ga0207680_10105213 Ga0207680_101052132 365
404 3300025911 Ga0207654_10003745 Ga0207654_100037452 365
405 3300025912 Ga0207707_10109425 Ga0207707_101094252 365
406 3300025919 Ga0207657_10006692 Ga0207657_100066922 365
407 3300025921 Ga0207652_10047802 Ga0207652_100478024 365
408 3300025927 Ga0207687_10055116 Ga0207687_100551162 365
409 3300025933 Ga0207706_10002906 Ga0207706_100029063 365
410 3300025934 Ga0207686_10047768 Ga0207686_100477683 365
411 3300025936 Ga0207670_10167492 Ga0207670_101674922 365
412 3300025941 Ga0207711_10001821 Ga0207711_1000182113 365
413 3300025944 Ga0207661_10000049 Ga0207661_1000004924 365
414 3300025949 Ga0207667_10022358 Ga0207667_100223584 365
415 3300025972 Ga0207668_10009024 Ga0207668_100090244 365
416 3300025986 Ga0207658_10104427 Ga0207658_101044272 365
417 3300026023 Ga0207677_10007354 Ga0207677_100073545 365
418 3300026078 Ga0207702_10007962 Ga0207702_100079626 365
419 3300026118 Ga0207675_100025623 Ga0207675_1000256235 365
420 3300028379 Ga0268266_10025754 Ga0268266_100257543 365
421 3300035691 Ga0373931_0043980 Ga0373931_0043980_199_1368 365
422 3300048905 Ga0496102_0043943 Ga0496102_0043943_1533_2702 365
423 3300048907 Ga0496104_0289519 Ga0496104_0289519_90_1259 365
424 3300048910 Ga0496107_0021097 Ga0496107_0021097_2567_3736 365

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01266

DAO

FAD dependent oxidoreductase

31

375

0.88

PF00890

FAD_binding_2

FAD binding domain

31

196

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fqz-assembly1.cif.gz_B plasmodium falciparum 6-phosphogluconate dehydrogenase in its apo form, in complex with its cofactor nadp+ and in complex with its substrate 6-phosphogluconate 0.9403 5 35
8a5z-assembly1.cif.gz_A imine reductase from ensifer adhaerens a208n mutant in complex with nadp+ 0.9311 5 33
5ocm-assembly1.cif.gz_A imine reductase from streptosporangium roseum in complex with nadp+ and 2,2,2-trifluoroacetophenone hydrate 0.9231 4 33
5a9r-assembly1.cif.gz_A apo form of imine reductase from amycolatopsis orientalis 0.9208 7 37
6eod-assembly1.cif.gz_H structure of reductive aminase from aspergillus terreus in complex with nadph 0.9054 5 33
ID Description Score Start End Superfamily
4bjyA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9584 7 37 3.50.50.60
6fqxH01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9296 5 35 3.40.50.720
af_Q4D0X5_1_185_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9291 6 33 3.40.50.720
3gg2D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9221 6 35 3.40.50.720
af_A0A1D6EP38_13_160_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9163 7 35 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7L9BJE3-F1-model_v4 FAD-binding oxidoreductase 0.9712 1 358 GO:0005737
GO:0016020
AF-A0A2V9P3C1-F1-model_v4 D-amino-acid oxidase 0.9696 1 344 GO:0005737
AF-A0A2V9YRD2-F1-model_v4 D-amino-acid oxidase 0.9635 133 365 GO:0005737
AF-A0A7V9B9B9-F1-model_v4 FAD-dependent oxidoreductase 0.9605 1 365 GO:0005737
AF-A0A399X104-F1-model_v4 D-amino-acid oxidase 0.9605 1 358 GO:0005737

Feature Viewer

pLDDT pTM Quality
90.4 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map