F440497

General Info

Members Datasets Scaffolds Average Seq Length
423 200 846 148

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100571775|Ga0075436_1005717752
Length 147
Sequence VKKVQLITDGACLGNPGPGGWAVILRHNARVREIFGCASVTTNNRMELTAAIEGLRAVKEPCEVEVVTDSEYVKNGITQWIHGWKRNDKKPVLNVDLWQALDEEVSRHKTTWTWTKGHASHSDNNRADELANLAAREQRSGDRVVDS

Samples

Sample ID Description Type Environment
1 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
111 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
112 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
113 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
118 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
120 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
121 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
122 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
123 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
137 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
167 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
192 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.18
Rhizosphere 96.22
Stem 0
Stem Tuber 0
Unclassified 6.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075436_100571775 3300006914 Bacteria 831
2 Ga0070658_10003688 3300005327 Bacteria 12530
3 Ga0070658_10242377 3300005327 Bacteria 1528
4 Ga0070658_10547981 3300005327 Bacteria 1001
5 Ga0070683_100930559 3300005329 Bacteria 834
6 Ga0070683_101215294 3300005329 Bacteria 724
7 Ga0070666_10229125 3300005335 Bacteria 1312
8 Ga0070666_10531747 3300005335 Bacteria 854
9 Ga0070666_10881226 3300005335 Bacteria 661
10 Ga0070680_100003272 3300005336 Bacteria 12075
11 Ga0070680_100169295 3300005336 Bacteria 1838
12 Ga0070680_100440263 3300005336 Bacteria 1113
13 Ga0070680_101749350 3300005336 Bacteria 539
14 Ga0068868_100683748 3300005338 Bacteria 917
15 Ga0070660_100012789 3300005339 Bacteria 6001
16 Ga0070660_100372102 3300005339 Bacteria 1179
17 Ga0070660_100486665 3300005339 Bacteria 1025
18 Ga0070689_101195874 3300005340 Bacteria 682
19 Ga0070661_100351598 3300005344 Bacteria 1156
20 Ga0070692_10173212 3300005345 Bacteria 1245
21 Ga0070668_100152662 3300005347 Bacteria 1869
22 Ga0070671_100161152 3300005355 Bacteria 1896
23 Ga0070673_100047234 3300005364 Bacteria 3349
24 Ga0070673_101919543 3300005364 Bacteria 562
25 Ga0070659_100860015 3300005366 Bacteria 791
26 Ga0070667_100068059 3300005367 Bacteria 3029
27 Ga0070667_100531909 3300005367 Bacteria 1079
28 Ga0070667_101416868 3300005367 Bacteria 652
29 Ga0070713_100153790 3300005436 Bacteria 2048
30 Ga0070713_100351189 3300005436 Bacteria 1368
31 Ga0070713_100805016 3300005436 Bacteria 901
32 Ga0070663_100823760 3300005455 Bacteria 797
33 Ga0070681_10084953 3300005458 Bacteria 3117
34 Ga0070681_10091257 3300005458 Bacteria 2997
35 Ga0070681_10161135 3300005458 Bacteria 2167
36 Ga0070681_10572137 3300005458 Unclassified 1044
37 Ga0068867_100293126 3300005459 Bacteria 1338
38 Ga0070679_100148537 3300005530 Bacteria 2321
39 Ga0070679_100262472 3300005530 Unclassified 1682
40 Ga0070679_100386036 3300005530 Bacteria 1347
41 Ga0070684_100305569 3300005535 Bacteria 1460
42 Ga0070684_100816245 3300005535 Bacteria 872
43 Ga0068853_100521645 3300005539 Bacteria 1123
44 Ga0068853_100897904 3300005539 Bacteria 851
45 Ga0070695_100100706 3300005545 Bacteria 1945
46 Ga0070665_100123579 3300005548 Bacteria 2590
47 Ga0070665_100315828 3300005548 Bacteria 1566
48 Ga0070665_101005763 3300005548 Bacteria 846
49 Ga0068855_100029271 3300005563 Bacteria 6586
50 Ga0068855_100058684 3300005563 Bacteria 4505
51 Ga0068855_100068167 3300005563 Bacteria 4142
52 Ga0068855_100326530 3300005563 Bacteria 1695
53 Ga0068855_102083951 3300005563 Bacteria 571
54 Ga0070664_100320079 3300005564 Bacteria 1405
55 Ga0068857_100011373 3300005577 Bacteria 7743
56 Ga0068854_100136982 3300005578 Bacteria 1875
57 Ga0068856_100054000 3300005614 Bacteria 3962
58 Ga0068856_100064454 3300005614 Bacteria 3620
59 Ga0068856_100113548 3300005614 Bacteria 2707
60 Ga0068856_100384661 3300005614 Bacteria 1423
61 Ga0068852_100018445 3300005616 Bacteria 5497
62 Ga0068852_100317391 3300005616 Bacteria 1512
63 Ga0068859_102079876 3300005617 Bacteria 627
64 Ga0068864_100059486 3300005618 Bacteria 3306
65 Ga0068864_101356105 3300005618 Bacteria 712
66 Ga0068864_101555395 3300005618 Bacteria 665
67 Ga0068866_10209376 3300005718 Bacteria 1170
68 Ga0068870_10474291 3300005840 Bacteria 829
69 Ga0068863_100045781 3300005841 Bacteria 4153
70 Ga0068863_100061632 3300005841 Bacteria 3547
71 Ga0068863_100091945 3300005841 Bacteria 2878
72 Ga0068863_100933410 3300005841 Unclassified 869
73 Ga0068858_100051109 3300005842 Bacteria 3824
74 Ga0068860_101207758 3300005843 Bacteria 776
75 Ga0070717_10156448 3300006028 Bacteria 1975
76 Ga0070712_101127626 3300006175 Bacteria 681
77 Ga0097621_100272010 3300006237 Bacteria 1489
78 Ga0097621_100354711 3300006237 Bacteria 1305
79 Ga0097621_101226452 3300006237 Bacteria 707
80 Ga0068871_100010168 3300006358 Bacteria 6852
81 Ga0068871_100244895 3300006358 Bacteria 1560
82 Ga0068871_100529757 3300006358 Bacteria 1065
83 Ga0075434_100825359 3300006871 Bacteria 943
84 Ga0068865_100601668 3300006881 Bacteria 929
85 Ga0097620_102079634 3300006931 Bacteria 627
86 Ga0099794_10055800 3300007265 Bacteria 1910
87 Ga0105240_10000974 3300009093 Bacteria 51020
88 Ga0105240_10021101 3300009093 Bacteria 8671
89 Ga0105240_10139014 3300009093 Bacteria 2906
90 Ga0105240_10147016 3300009093 Bacteria 2811
91 Ga0105240_10607395 3300009093 Bacteria 1203
92 Ga0105240_10850042 3300009093 Bacteria 985
93 Ga0105240_10897912 3300009093 Bacteria 953
94 Ga0105240_10958147 3300009093 Bacteria 917
95 Ga0105240_11037920 3300009093 Bacteria 875
96 Ga0105240_11363533 3300009093 Bacteria 746
97 Ga0111539_10841781 3300009094 Bacteria 1067
98 Ga0105245_10004907 3300009098 Bacteria 11767
99 Ga0105245_10071348 3300009098 Bacteria 3154
100 Ga0105245_10538529 3300009098 Bacteria 1188
101 Ga0105245_11474063 3300009098 Bacteria 731
102 Ga0105245_11937486 3300009098 Bacteria 642
103 Ga0105247_10246677 3300009101 Bacteria 1219
104 Ga0114129_10275327 3300009147 Bacteria 2250
105 Ga0105241_10054277 3300009174 Bacteria 3067
106 Ga0105241_10094403 3300009174 Bacteria 2366
107 Ga0105241_10190003 3300009174 Bacteria 1709
108 Ga0105241_10258024 3300009174 Bacteria 1480
109 Ga0105241_10363462 3300009174 Bacteria 1260
110 Ga0105241_10965924 3300009174 Bacteria 795
111 Ga0105242_11172309 3300009176 Bacteria 786
112 Ga0105242_11497371 3300009176 Bacteria 705
113 Ga0105248_10037558 3300009177 Bacteria 5419
114 Ga0105248_10069890 3300009177 Bacteria 3943
115 Ga0105248_10182852 3300009177 Bacteria 2362
116 Ga0105248_10222909 3300009177 Bacteria 2123
117 Ga0105248_10409858 3300009177 Bacteria 1526
118 Ga0105248_10631595 3300009177 Bacteria 1208
119 Ga0105248_11030419 3300009177 Unclassified 930
120 Ga0105237_10018552 3300009545 Bacteria 7199
121 Ga0105237_10434268 3300009545 Bacteria 1319
122 Ga0105237_10682390 3300009545 Bacteria 1034
123 Ga0105237_10968686 3300009545 Bacteria 858
124 Ga0105237_11123811 3300009545 Bacteria 792
125 Ga0105238_10046549 3300009551 Bacteria 4376
126 Ga0105238_10205636 3300009551 Bacteria 1945
127 Ga0105238_10242909 3300009551 Bacteria 1778
128 Ga0105238_10310911 3300009551 Bacteria 1561
129 Ga0105238_12153665 3300009551 Bacteria 592
130 Ga0105249_10165560 3300009553 Bacteria 2140
131 Ga0105249_10686663 3300009553 Bacteria 1083
132 Ga0105249_11509377 3300009553 Bacteria 744
133 Ga0105239_10012453 3300010375 Bacteria 9472
134 Ga0105239_10049326 3300010375 Bacteria 4617
135 Ga0105239_10088680 3300010375 Bacteria 3411
136 Ga0105239_10106998 3300010375 Bacteria 3098
137 Ga0105239_10582803 3300010375 Unclassified 1275
138 Ga0105239_11280832 3300010375 Bacteria 845
139 Ga0105246_10459731 3300011119 Bacteria 1072
140 Ga0105246_10703223 3300011119 Bacteria 886
141 Ga0157373_10084735 3300013100 Bacteria 2234
142 Ga0157370_10006734 3300013104 Bacteria 12606
143 Ga0157370_10343096 3300013104 Bacteria 1377
144 Ga0157370_10604791 3300013104 Bacteria 1004
145 Ga0157369_10013991 3300013105 Bacteria 9068
146 Ga0157369_10038888 3300013105 Bacteria 5200
147 Ga0157369_10055508 3300013105 Bacteria 4276
148 Ga0157369_10119556 3300013105 Bacteria 2796
149 Ga0157369_10288977 3300013105 Bacteria 1707
150 Ga0157369_10620716 3300013105 Bacteria 1115
151 Ga0157374_10098476 3300013296 Unclassified 2800
152 Ga0157374_10120722 3300013296 Bacteria 2529
153 Ga0157374_10926490 3300013296 Bacteria 889
154 Ga0157374_11434428 3300013296 Bacteria 713
155 Ga0157374_11877405 3300013296 Bacteria 625
156 Ga0157378_10456050 3300013297 Bacteria 1270
157 Ga0157378_10466020 3300013297 Bacteria 1256
158 Ga0157378_10796374 3300013297 Bacteria 971
159 Ga0163162_10096727 3300013306 Bacteria 3041
160 Ga0163162_10192907 3300013306 Bacteria 2165
161 Ga0163162_10865358 3300013306 Bacteria 1018
162 Ga0163162_11631460 3300013306 Bacteria 736
163 Ga0157372_10099378 3300013307 Bacteria 3319
164 Ga0157372_10141145 3300013307 Bacteria 2775
165 Ga0157372_10143877 3300013307 Bacteria 2749
166 Ga0157372_10174430 3300013307 Bacteria 2488
167 Ga0157375_10126665 3300013308 Bacteria 2669
168 Ga0157379_10002170 3300014968 Bacteria 16310
169 Ga0157379_10054750 3300014968 Bacteria 3564
170 Ga0157376_10332383 3300014969 Bacteria 1448
171 Ga0157376_10428507 3300014969 Bacteria 1285
172 Ga0157376_10477675 3300014969 Bacteria 1221
173 Ga0157376_10764353 3300014969 Bacteria 976
174 Ga0157376_10828017 3300014969 Bacteria 940
175 Ga0157376_11018085 3300014969 Bacteria 851
176 Ga0213876_10091403 3300021384 Bacteria 1612
177 Ga0213875_10029324 3300021388 Bacteria 2610
178 Ga0207642_10065905 3300025899 Bacteria 1703
179 Ga0207680_10205348 3300025903 Bacteria 1345
180 Ga0207680_10307460 3300025903 Bacteria 1106
181 Ga0207680_10505556 3300025903 Bacteria 861
182 Ga0207643_10450023 3300025908 Bacteria 819
183 Ga0207705_10023531 3300025909 Bacteria 4394
184 Ga0207705_10195106 3300025909 Bacteria 1533
185 Ga0207654_10087432 3300025911 Bacteria 1891
186 Ga0207654_10128266 3300025911 Bacteria 1602
187 Ga0207654_10370487 3300025911 Bacteria 990
188 Ga0207654_10447356 3300025911 Bacteria 905
189 Ga0207654_10491490 3300025911 Bacteria 865
190 Ga0207707_10045612 3300025912 Bacteria 3819
191 Ga0207707_10053408 3300025912 Bacteria 3518
192 Ga0207707_10372382 3300025912 Unclassified 1229
193 Ga0207695_10002216 3300025913 Bacteria 29237
194 Ga0207695_10014027 3300025913 Bacteria 9515
195 Ga0207695_10020131 3300025913 Bacteria 7653
196 Ga0207695_10026379 3300025913 Bacteria 6485
197 Ga0207695_10071765 3300025913 Bacteria 3536
198 Ga0207695_10139407 3300025913 Bacteria 2375
199 Ga0207695_10253199 3300025913 Bacteria 1660
200 Ga0207695_10773780 3300025913 Unclassified 840
201 Ga0207671_10084349 3300025914 Unclassified 2386
202 Ga0207671_10768490 3300025914 Bacteria 765
203 Ga0207660_10007236 3300025917 Bacteria 7183
204 Ga0207657_10017672 3300025919 Bacteria 6835
205 Ga0207657_10491574 3300025919 Bacteria 961
206 Ga0207657_10954561 3300025919 Bacteria 659
207 Ga0207649_10517860 3300025920 Bacteria 909
208 Ga0207652_10203705 3300025921 Unclassified 1781
209 Ga0207652_10688215 3300025921 Bacteria 913
210 Ga0207652_11109327 3300025921 Bacteria 692
211 Ga0207681_10526304 3300025923 Bacteria 971
212 Ga0207694_10041202 3300025924 Bacteria 3558
213 Ga0207694_10367151 3300025924 Bacteria 1193
214 Ga0207694_10421966 3300025924 Bacteria 1111
215 Ga0207687_10077757 3300025927 Bacteria 2387
216 Ga0207687_10522125 3300025927 Bacteria 993
217 Ga0207687_10728177 3300025927 Bacteria 843
218 Ga0207700_10184139 3300025928 Bacteria 1751
219 Ga0207644_10029039 3300025931 Bacteria 3834
220 Ga0207711_10013647 3300025941 Bacteria 6747
221 Ga0207711_10021334 3300025941 Bacteria 5412
222 Ga0207711_10676295 3300025941 Bacteria 963
223 Ga0207711_10785346 3300025941 Bacteria 887
224 Ga0207711_10789885 3300025941 Bacteria 884
225 Ga0207711_10984037 3300025941 Bacteria 783
226 Ga0207711_11340174 3300025941 Bacteria 658
227 Ga0207661_10208778 3300025944 Unclassified 1720
228 Ga0207679_10227061 3300025945 Bacteria 1574
229 Ga0207667_10063954 3300025949 Bacteria 3843
230 Ga0207667_10087772 3300025949 Bacteria 3217
231 Ga0207667_10177243 3300025949 Bacteria 2190
232 Ga0207667_10528758 3300025949 Bacteria 1194
233 Ga0207667_10554800 3300025949 Bacteria 1162
234 Ga0207651_10083675 3300025960 Bacteria 2308
235 Ga0207651_12054163 3300025960 Bacteria 513
236 Ga0207668_10428867 3300025972 Unclassified 1124
237 Ga0207658_10085633 3300025986 Bacteria 2428
238 Ga0207658_10232875 3300025986 Bacteria 1556
239 Ga0207658_10444521 3300025986 Bacteria 1147
240 Ga0207677_11030010 3300026023 Bacteria 748
241 Ga0207703_10020030 3300026035 Bacteria 5227
242 Ga0207703_10460275 3300026035 Bacteria 1190
243 Ga0207639_10479559 3300026041 Bacteria 1133
244 Ga0207678_10138085 3300026067 Bacteria 2080
245 Ga0207702_10062660 3300026078 Bacteria 3177
246 Ga0207702_10166179 3300026078 Bacteria 2019
247 Ga0207702_10197731 3300026078 Bacteria 1862
248 Ga0207702_10221103 3300026078 Bacteria 1765
249 Ga0207702_11518434 3300026078 Bacteria 663
250 Ga0207641_10021525 3300026088 Bacteria 5299
251 Ga0207641_10023776 3300026088 Bacteria 5050
252 Ga0207641_10326505 3300026088 Bacteria 1456
253 Ga0207641_11097811 3300026088 Bacteria 794
254 Ga0207648_10834957 3300026089 Bacteria 859
255 Ga0207676_10168471 3300026095 Bacteria 1906
256 Ga0207676_10281395 3300026095 Bacteria 1510
257 Ga0207674_10009575 3300026116 Bacteria 11052
258 Ga0207674_10329501 3300026116 Unclassified 1476
259 Ga0207683_10092951 3300026121 Bacteria 2688
260 Ga0207698_10018082 3300026142 Bacteria 4796
261 Ga0207698_10039879 3300026142 Bacteria 3483
262 Ga0207698_10631571 3300026142 Bacteria 1059
263 Ga0207698_10971630 3300026142 Bacteria 859
264 Ga0209588_1006508 3300027671 Unclassified 3399
265 Ga0268266_10025936 3300028379 Bacteria 4986
266 Ga0268266_10244505 3300028379 Bacteria 1657
267 Ga0268266_10399142 3300028379 Bacteria 1300
268 Ga0268266_10413072 3300028379 Bacteria 1278
269 Ga0268264_11114254 3300028381 Bacteria 798
270 Ga0265762_1073755 3300030760 Bacteria 720
271 Ga0265328_10198856 3300031239 Bacteria 761
272 Ga0265325_10011086 3300031241 Bacteria 5187
273 Ga0265340_10095883 3300031247 Bacteria 1382
274 Ga0265339_10290672 3300031249 Bacteria 781
275 Ga0265339_10392793 3300031249 Bacteria 649
276 Ga0265316_10022478 3300031344 Bacteria 5315
277 Ga0265316_10232524 3300031344 Bacteria 1357
278 Ga0265316_10422304 3300031344 Bacteria 958
279 Ga0265316_10584015 3300031344 Bacteria 793
280 Ga0265316_10834189 3300031344 Bacteria 646
281 Ga0265313_10095393 3300031595 Bacteria 1328
282 Ga0265313_10128878 3300031595 Bacteria 1098
283 Ga0265314_10002799 3300031711 Bacteria 17410
284 Ga0265314_10114156 3300031711 Bacteria 1711
285 Ga0265342_10194535 3300031712 Bacteria 1105
286 Ga0373923_0208078 3300035111 Bacteria 906
287 Ga0373953_0079359 3300035117 Bacteria 1362
288 Ga0373954_0003791 3300035118 Bacteria 6451
289 Ga0373954_0186541 3300035118 Bacteria 1018
290 Ga0373956_0092429 3300035119 Unclassified 1397
291 Ga0373946_0163105 3300035171 Bacteria 1048
292 Ga0373955_0192106 3300035172 Bacteria 1214
293 Ga0373955_0264542 3300035172 Bacteria 1033
294 Ga0373955_0370375 3300035172 Bacteria 869
295 Ga0373931_0512083 3300035691 Bacteria 775
296 Ga0373935_0006812 3300035692 Bacteria 6827
297 Ga0373935_0596341 3300035692 Bacteria 808
298 Ga0373927_0006046 3300035695 Bacteria 8292
299 Ga0373927_0215716 3300035695 Bacteria 1261
300 Ga0373927_0282967 3300035695 Bacteria 1091
301 Ga0373927_0325811 3300035695 Bacteria 1012
302 Ga0373933_0219871 3300035724 Unclassified 1218
303 Ga0373947_0017661 3300035725 Bacteria 4105
304 Ga0373937_0042971 3300036401 Bacteria 4125
305 Ga0373937_0072706 3300036401 Bacteria 3172
306 Ga0373937_0435122 3300036401 Bacteria 1245
307 Ga0373937_0457110 3300036401 Bacteria 1213
308 Ga0373937_0557056 3300036401 Bacteria 1089
309 Ga0373937_0619183 3300036401 Bacteria 1027
310 Ga0373925_0037210 3300037068 Bacteria 3592
311 Ga0395899_0804154 3300037312 Bacteria 581
312 Ga0395900_0331528 3300037418 Bacteria 1500
313 Ga0395898_0103999 3300037466 Bacteria 2724
314 Ga0436364_0023509 3300037853 Bacteria 13990
315 Ga0436364_1254201 3300037853 Bacteria 667
316 Ga0436364_1279876 3300037853 Bacteria 1192
317 Ga0436364_1365345 3300037853 Bacteria 6392
318 Ga0436365_0582833 3300039437 Bacteria 731
319 Ga0436365_1077271 3300039437 Bacteria 4329
320 Ga0436365_1306097 3300039437 Bacteria 2137
321 Ga0436365_1668463 3300039437 Bacteria 2601
322 Ga0436365_1742548 3300039437 Unclassified 686
323 Ga0436360_0205492 3300039438 Bacteria 552
324 Ga0436362_0823124 3300039453 Unclassified 1146
325 Ga0466963_0533213 3300044694 Bacteria 829
326 Ga0466971_0140732 3300044719 Bacteria 1123
327 Ga0451576_0558579 3300045051 Bacteria 1203
328 Ga0466958_0081724 3300045836 Bacteria 1989
329 Ga0466967_0623109 3300045976 Bacteria 1066
330 Ga0495651_0017711 3300046462 Bacteria 5516
331 Ga0495651_0028518 3300046462 Bacteria 4349
332 Ga0495651_0425841 3300046462 Bacteria 862
333 Ga0495580_0005136 3300046472 Bacteria 10889
334 Ga0495580_0025460 3300046472 Bacteria 4324
335 Ga0495580_0262113 3300046472 Bacteria 1182
336 Ga0495580_0732760 3300046472 Bacteria 645
337 Ga0495662_0100284 3300046476 Bacteria 1416
338 Ga0495662_0290415 3300046476 Bacteria 805
339 Ga0495664_0010500 3300046477 Bacteria 5196
340 Ga0495594_0255630 3300046499 Bacteria 998
341 Ga0495608_0069611 3300046511 Bacteria 2298
342 Ga0495608_0140956 3300046511 Bacteria 1539
343 Ga0495618_0038910 3300046514 Bacteria 2990
344 Ga0495628_0019316 3300046516 Bacteria 5635
345 Ga0495630_0535130 3300046517 Bacteria 898
346 Ga0495630_0566908 3300046517 Bacteria 871
347 Ga0495630_0625606 3300046517 Bacteria 825
348 Ga0495652_0116958 3300046529 Bacteria 2134
349 Ga0495665_0098860 3300046531 Bacteria 1532
350 Ga0495665_0177121 3300046531 Bacteria 1109
351 Ga0495640_0503676 3300046533 Bacteria 737
352 Ga0495640_0554356 3300046533 Bacteria 696
353 Ga0495587_0030474 3300046536 Bacteria 3271
354 Ga0495587_0059869 3300046536 Bacteria 2234
355 Ga0495587_0173844 3300046536 Bacteria 1223
356 Ga0495645_0069969 3300046543 Bacteria 2533
357 Ga0495645_0075236 3300046543 Bacteria 2430
358 Ga0495667_0014188 3300046559 Bacteria 5380
359 Ga0495667_0078178 3300046559 Bacteria 2151
360 Ga0495634_0018064 3300046642 Bacteria 5025
361 Ga0495634_0252600 3300046642 Bacteria 1078
362 Ga0495635_0068297 3300046663 Bacteria 2438
363 Ga0495635_0247675 3300046663 Bacteria 1201
364 Ga0495623_0007709 3300046679 Bacteria 6996
365 Ga0495646_0102045 3300046680 Bacteria 1644
366 Ga0495613_0075362 3300046689 Bacteria 2456
367 Ga0495613_0187603 3300046689 Bacteria 1462
368 Ga0495600_0068272 3300046809 Bacteria 2323
369 Ga0495600_0170756 3300046809 Bacteria 1404
370 Ga0495604_0564357 3300047317 Bacteria 733
371 Ga0495674_0008147 3300047319 Bacteria 9996
372 Ga0495674_0319845 3300047319 Bacteria 1264
373 Ga0495674_0354975 3300047319 Bacteria 1189
374 Ga0495680_0252491 3300047322 Bacteria 1250
375 Ga0495675_0030835 3300047444 Bacteria 3421
376 Ga0495675_0095775 3300047444 Bacteria 1861
377 Ga0495675_0301937 3300047444 Bacteria 951
378 Ga0495684_0079275 3300047471 Bacteria 2493
379 Ga0495684_0092808 3300047471 Bacteria 2286
380 Ga0495684_0552749 3300047471 Bacteria 783
381 Ga0495593_0049707 3300047673 Bacteria 2224
382 Ga0495593_0322296 3300047673 Bacteria 772
383 Ga0495602_0045385 3300048088 Bacteria 3977
384 Ga0496100_0931607 3300048903 Bacteria 683
385 Ga0496101_1272640 3300048904 Unclassified 575
386 Ga0496112_0377534 3300048915 Bacteria 1359
387 Ga0496115_0066290 3300048918 Bacteria 2918
388 Ga0496115_0118259 3300048918 Bacteria 2180
389 Ga0501031_0072419 3300049568 Unclassified 2243
390 Ga0501033_0003669 3300049570 Bacteria 12510
391 Ga0501033_0045810 3300049570 Unclassified 3254
392 Ga0501034_0006894 3300049571 Bacteria 12147
393 Ga0501034_0308955 3300049571 Bacteria 1516
394 Ga0501036_0265808 3300049572 Bacteria 1437
395 Ga0501037_0012229 3300049573 Bacteria 6317
396 Ga0501037_0049781 3300049573 Bacteria 3068
397 Ga0501039_0004974 3300049575 Bacteria 10083
398 Ga0501043_0009612 3300049579 Bacteria 7575
399 Ga0501043_0333915 3300049579 Unclassified 1154
400 Ga0501046_0022418 3300049580 Bacteria 5203
401 Ga0501046_0070306 3300049580 Bacteria 2721
402 Ga0501046_0416302 3300049580 Unclassified 969
403 Ga0501048_0047083 3300049582 Bacteria 3077
404 Ga0501067_0001843 3300049583 Bacteria 11666
405 Ga0501068_0032234 3300049584 Bacteria 3115
406 Ga0501069_0000772 3300049585 Bacteria 14985
407 Ga0501069_0415808 3300049585 Bacteria 797
408 Ga0501070_0010777 3300049586 Bacteria 7723
409 Ga0501074_0070097 3300049590 Unclassified 2520
410 Ga0501074_0328808 3300049590 Bacteria 1085
411 Ga0501076_0038201 3300049592 Bacteria 3769
412 Ga0501077_0085098 3300049593 Unclassified 2004
413 Ga0501253_019464 3300049683 Bacteria 1172
414 Ga0501083_0574349 3300049744 Unclassified 734
415 Ga0501035_0005246 3300049822 Bacteria 12268
416 Ga0501035_0067536 3300049822 Unclassified 3171
417 Ga0501044_0057435 3300049823 Bacteria 3993
418 nmdc:mga05p37_2141529_c1 3300050507 Unclassified 522
419 nmdc:mga0qj67_952570_c1 3300050509 Bacteria 675
420 nmdc:mga06r32_22382_c1 3300050510 Bacteria 5843
421 nmdc:mga0n895_781745_c1 3300050512 Bacteria 946
422 Ga0495595_0272147 3300053084 Unclassified 850
423 Ga0501082_0001311 3300060353 Bacteria 21804
424 Ga0075436_100571775
425 Ga0070658_10003688
426 Ga0070658_10242377
427 Ga0070658_10547981
428 Ga0070683_100930559
429 Ga0070683_101215294
430 Ga0070666_10229125
431 Ga0070666_10531747
432 Ga0070666_10881226
433 Ga0070680_100003272
434 Ga0070680_100169295
435 Ga0070680_100440263
436 Ga0070680_101749350
437 Ga0068868_100683748
438 Ga0070660_100012789
439 Ga0070660_100372102
440 Ga0070660_100486665
441 Ga0070689_101195874
442 Ga0070661_100351598
443 Ga0070692_10173212
444 Ga0070668_100152662
445 Ga0070671_100161152
446 Ga0070673_100047234
447 Ga0070673_101919543
448 Ga0070659_100860015
449 Ga0070667_100068059
450 Ga0070667_100531909
451 Ga0070667_101416868
452 Ga0070713_100153790
453 Ga0070713_100351189
454 Ga0070713_100805016
455 Ga0070663_100823760
456 Ga0070681_10084953
457 Ga0070681_10091257
458 Ga0070681_10161135
459 Ga0070681_10572137
460 Ga0068867_100293126
461 Ga0070679_100148537
462 Ga0070679_100262472
463 Ga0070679_100386036
464 Ga0070684_100305569
465 Ga0070684_100816245
466 Ga0068853_100521645
467 Ga0068853_100897904
468 Ga0070695_100100706
469 Ga0070665_100123579
470 Ga0070665_100315828
471 Ga0070665_101005763
472 Ga0068855_100029271
473 Ga0068855_100058684
474 Ga0068855_100068167
475 Ga0068855_100326530
476 Ga0068855_102083951
477 Ga0070664_100320079
478 Ga0068857_100011373
479 Ga0068854_100136982
480 Ga0068856_100054000
481 Ga0068856_100064454
482 Ga0068856_100113548
483 Ga0068856_100384661
484 Ga0068852_100018445
485 Ga0068852_100317391
486 Ga0068859_102079876
487 Ga0068864_100059486
488 Ga0068864_101356105
489 Ga0068864_101555395
490 Ga0068866_10209376
491 Ga0068870_10474291
492 Ga0068863_100045781
493 Ga0068863_100061632
494 Ga0068863_100091945
495 Ga0068863_100933410
496 Ga0068858_100051109
497 Ga0068860_101207758
498 Ga0070717_10156448
499 Ga0070712_101127626
500 Ga0097621_100272010
501 Ga0097621_100354711
502 Ga0097621_101226452
503 Ga0068871_100010168
504 Ga0068871_100244895
505 Ga0068871_100529757
506 Ga0075434_100825359
507 Ga0068865_100601668
508 Ga0097620_102079634
509 Ga0099794_10055800
510 Ga0105240_10000974
511 Ga0105240_10021101
512 Ga0105240_10139014
513 Ga0105240_10147016
514 Ga0105240_10607395
515 Ga0105240_10850042
516 Ga0105240_10897912
517 Ga0105240_10958147
518 Ga0105240_11037920
519 Ga0105240_11363533
520 Ga0111539_10841781
521 Ga0105245_10004907
522 Ga0105245_10071348
523 Ga0105245_10538529
524 Ga0105245_11474063
525 Ga0105245_11937486
526 Ga0105247_10246677
527 Ga0114129_10275327
528 Ga0105241_10054277
529 Ga0105241_10094403
530 Ga0105241_10190003
531 Ga0105241_10258024
532 Ga0105241_10363462
533 Ga0105241_10965924
534 Ga0105242_11172309
535 Ga0105242_11497371
536 Ga0105248_10037558
537 Ga0105248_10069890
538 Ga0105248_10182852
539 Ga0105248_10222909
540 Ga0105248_10409858
541 Ga0105248_10631595
542 Ga0105248_11030419
543 Ga0105237_10018552
544 Ga0105237_10434268
545 Ga0105237_10682390
546 Ga0105237_10968686
547 Ga0105237_11123811
548 Ga0105238_10046549
549 Ga0105238_10205636
550 Ga0105238_10242909
551 Ga0105238_10310911
552 Ga0105238_12153665
553 Ga0105249_10165560
554 Ga0105249_10686663
555 Ga0105249_11509377
556 Ga0105239_10012453
557 Ga0105239_10049326
558 Ga0105239_10088680
559 Ga0105239_10106998
560 Ga0105239_10582803
561 Ga0105239_11280832
562 Ga0105246_10459731
563 Ga0105246_10703223
564 Ga0157373_10084735
565 Ga0157370_10006734
566 Ga0157370_10343096
567 Ga0157370_10604791
568 Ga0157369_10013991
569 Ga0157369_10038888
570 Ga0157369_10055508
571 Ga0157369_10119556
572 Ga0157369_10288977
573 Ga0157369_10620716
574 Ga0157374_10098476
575 Ga0157374_10120722
576 Ga0157374_10926490
577 Ga0157374_11434428
578 Ga0157374_11877405
579 Ga0157378_10456050
580 Ga0157378_10466020
581 Ga0157378_10796374
582 Ga0163162_10096727
583 Ga0163162_10192907
584 Ga0163162_10865358
585 Ga0163162_11631460
586 Ga0157372_10099378
587 Ga0157372_10141145
588 Ga0157372_10143877
589 Ga0157372_10174430
590 Ga0157375_10126665
591 Ga0157379_10002170
592 Ga0157379_10054750
593 Ga0157376_10332383
594 Ga0157376_10428507
595 Ga0157376_10477675
596 Ga0157376_10764353
597 Ga0157376_10828017
598 Ga0157376_11018085
599 Ga0213876_10091403
600 Ga0213875_10029324
601 Ga0207642_10065905
602 Ga0207680_10205348
603 Ga0207680_10307460
604 Ga0207680_10505556
605 Ga0207643_10450023
606 Ga0207705_10023531
607 Ga0207705_10195106
608 Ga0207654_10087432
609 Ga0207654_10128266
610 Ga0207654_10370487
611 Ga0207654_10447356
612 Ga0207654_10491490
613 Ga0207707_10045612
614 Ga0207707_10053408
615 Ga0207707_10372382
616 Ga0207695_10002216
617 Ga0207695_10014027
618 Ga0207695_10020131
619 Ga0207695_10026379
620 Ga0207695_10071765
621 Ga0207695_10139407
622 Ga0207695_10253199
623 Ga0207695_10773780
624 Ga0207671_10084349
625 Ga0207671_10768490
626 Ga0207660_10007236
627 Ga0207657_10017672
628 Ga0207657_10491574
629 Ga0207657_10954561
630 Ga0207649_10517860
631 Ga0207652_10203705
632 Ga0207652_10688215
633 Ga0207652_11109327
634 Ga0207681_10526304
635 Ga0207694_10041202
636 Ga0207694_10367151
637 Ga0207694_10421966
638 Ga0207687_10077757
639 Ga0207687_10522125
640 Ga0207687_10728177
641 Ga0207700_10184139
642 Ga0207644_10029039
643 Ga0207711_10013647
644 Ga0207711_10021334
645 Ga0207711_10676295
646 Ga0207711_10785346
647 Ga0207711_10789885
648 Ga0207711_10984037
649 Ga0207711_11340174
650 Ga0207661_10208778
651 Ga0207679_10227061
652 Ga0207667_10063954
653 Ga0207667_10087772
654 Ga0207667_10177243
655 Ga0207667_10528758
656 Ga0207667_10554800
657 Ga0207651_10083675
658 Ga0207651_12054163
659 Ga0207668_10428867
660 Ga0207658_10085633
661 Ga0207658_10232875
662 Ga0207658_10444521
663 Ga0207677_11030010
664 Ga0207703_10020030
665 Ga0207703_10460275
666 Ga0207639_10479559
667 Ga0207678_10138085
668 Ga0207702_10062660
669 Ga0207702_10166179
670 Ga0207702_10197731
671 Ga0207702_10221103
672 Ga0207702_11518434
673 Ga0207641_10021525
674 Ga0207641_10023776
675 Ga0207641_10326505
676 Ga0207641_11097811
677 Ga0207648_10834957
678 Ga0207676_10168471
679 Ga0207676_10281395
680 Ga0207674_10009575
681 Ga0207674_10329501
682 Ga0207683_10092951
683 Ga0207698_10018082
684 Ga0207698_10039879
685 Ga0207698_10631571
686 Ga0207698_10971630
687 Ga0209588_1006508
688 Ga0268266_10025936
689 Ga0268266_10244505
690 Ga0268266_10399142
691 Ga0268266_10413072
692 Ga0268264_11114254
693 Ga0265762_1073755
694 Ga0265328_10198856
695 Ga0265325_10011086
696 Ga0265340_10095883
697 Ga0265339_10290672
698 Ga0265339_10392793
699 Ga0265316_10022478
700 Ga0265316_10232524
701 Ga0265316_10422304
702 Ga0265316_10584015
703 Ga0265316_10834189
704 Ga0265313_10095393
705 Ga0265313_10128878
706 Ga0265314_10002799
707 Ga0265314_10114156
708 Ga0265342_10194535
709 Ga0373923_0208078
710 Ga0373953_0079359
711 Ga0373954_0003791
712 Ga0373954_0186541
713 Ga0373956_0092429
714 Ga0373946_0163105
715 Ga0373955_0192106
716 Ga0373955_0264542
717 Ga0373955_0370375
718 Ga0373931_0512083
719 Ga0373935_0006812
720 Ga0373935_0596341
721 Ga0373927_0006046
722 Ga0373927_0215716
723 Ga0373927_0282967
724 Ga0373927_0325811
725 Ga0373933_0219871
726 Ga0373947_0017661
727 Ga0373937_0042971
728 Ga0373937_0072706
729 Ga0373937_0435122
730 Ga0373937_0457110
731 Ga0373937_0557056
732 Ga0373937_0619183
733 Ga0373925_0037210
734 Ga0395899_0804154
735 Ga0395900_0331528
736 Ga0395898_0103999
737 Ga0436364_0023509
738 Ga0436364_1254201
739 Ga0436364_1279876
740 Ga0436364_1365345
741 Ga0436365_0582833
742 Ga0436365_1077271
743 Ga0436365_1306097
744 Ga0436365_1668463
745 Ga0436365_1742548
746 Ga0436360_0205492
747 Ga0436362_0823124
748 Ga0466963_0533213
749 Ga0466971_0140732
750 Ga0451576_0558579
751 Ga0466958_0081724
752 Ga0466967_0623109
753 Ga0495651_0017711
754 Ga0495651_0028518
755 Ga0495651_0425841
756 Ga0495580_0005136
757 Ga0495580_0025460
758 Ga0495580_0262113
759 Ga0495580_0732760
760 Ga0495662_0100284
761 Ga0495662_0290415
762 Ga0495664_0010500
763 Ga0495594_0255630
764 Ga0495608_0069611
765 Ga0495608_0140956
766 Ga0495618_0038910
767 Ga0495628_0019316
768 Ga0495630_0535130
769 Ga0495630_0566908
770 Ga0495630_0625606
771 Ga0495652_0116958
772 Ga0495665_0098860
773 Ga0495665_0177121
774 Ga0495640_0503676
775 Ga0495640_0554356
776 Ga0495587_0030474
777 Ga0495587_0059869
778 Ga0495587_0173844
779 Ga0495645_0069969
780 Ga0495645_0075236
781 Ga0495667_0014188
782 Ga0495667_0078178
783 Ga0495634_0018064
784 Ga0495634_0252600
785 Ga0495635_0068297
786 Ga0495635_0247675
787 Ga0495623_0007709
788 Ga0495646_0102045
789 Ga0495613_0075362
790 Ga0495613_0187603
791 Ga0495600_0068272
792 Ga0495600_0170756
793 Ga0495604_0564357
794 Ga0495674_0008147
795 Ga0495674_0319845
796 Ga0495674_0354975
797 Ga0495680_0252491
798 Ga0495675_0030835
799 Ga0495675_0095775
800 Ga0495675_0301937
801 Ga0495684_0079275
802 Ga0495684_0092808
803 Ga0495684_0552749
804 Ga0495593_0049707
805 Ga0495593_0322296
806 Ga0495602_0045385
807 Ga0496100_0931607
808 Ga0496101_1272640
809 Ga0496112_0377534
810 Ga0496115_0066290
811 Ga0496115_0118259
812 Ga0501031_0072419
813 Ga0501033_0003669
814 Ga0501033_0045810
815 Ga0501034_0006894
816 Ga0501034_0308955
817 Ga0501036_0265808
818 Ga0501037_0012229
819 Ga0501037_0049781
820 Ga0501039_0004974
821 Ga0501043_0009612
822 Ga0501043_0333915
823 Ga0501046_0022418
824 Ga0501046_0070306
825 Ga0501046_0416302
826 Ga0501048_0047083
827 Ga0501067_0001843
828 Ga0501068_0032234
829 Ga0501069_0000772
830 Ga0501069_0415808
831 Ga0501070_0010777
832 Ga0501074_0070097
833 Ga0501074_0328808
834 Ga0501076_0038201
835 Ga0501077_0085098
836 Ga0501253_019464
837 Ga0501083_0574349
838 Ga0501035_0005246
839 Ga0501035_0067536
840 Ga0501044_0057435
841 nmdc:mga05p37_2141529_c1
842 nmdc:mga0qj67_952570_c1
843 nmdc:mga06r32_22382_c1
844 nmdc:mga0n895_781745_c1
845 Ga0495595_0272147
846 Ga0501082_0001311

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00075

RNase_H

RNase H

1

136

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wsj-assembly3.cif.gz_C crystal structure of e.coli rnase hi active site mutant (k87a/h124a) 0.9727 1 141
2z1j-assembly1.cif.gz_A crystal structure of e.coli rnase hi surface charged mutant(q4r/t40e/q72h/q76k/q80e/t92k/q105k/q113r/q115k/n143k/t145k) 0.9708 1 142
3h08-assembly2.cif.gz_B crystal structure of the ribonuclease h1 from chlorobium tepidum 0.9692 1 142
1wsj-assembly5.cif.gz_E crystal structure of e.coli rnase hi active site mutant (k87a/h124a) 0.9681 1 141
2zqb-assembly1.cif.gz_C crystal structure of a psychrotrophic rnasehi variant with sextuple thermostabilizing mutations 0.9669 1 141
ID Description Score Start End Superfamily
af_A0A0R0EHL2_85_153_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9674 4 57 3.30.420.10
1jl2C00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9657 2 141 3.30.420.10
2zqbB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9327 1 146 3.30.420.10
4ibnA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.906 1 146 3.30.420.10
2zqbB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9019 1 146 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A348UQL9-F1-model_v4 Ribonuclease HI 1.002 4 72 GO:0003676
GO:0004523
AF-A0A3D0SPW7-F1-model_v4 RNase H type-1 domain-containing protein 1.001 3 71 GO:0003676
GO:0004523
AF-A0A3D0XTL9-F1-model_v4 Ribonuclease HI 1.001 1 64 GO:0003676
GO:0004523
AF-A0A3R7UMV9-F1-model_v4 Ribonuclease H (RNase H) (EC 3.1.26.4) 0.9951 3 138 GO:0000287
GO:0003676
GO:0004523
GO:0005737
GO:0043137
AF-A0A527HH28-F1-model_v4 deleted 0.9945 2 72

Map