F440249

General Info

Members Datasets Scaffolds Average Seq Length
422 178 844 560

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10017521|Ga0111539_100175212
Length 604
Sequence MTGLEIFTDIQSFRRVPALKALAPAAVMAFMLVAWTSMVIAQNKPLDPAQGKPFVPVTDEMLWKPNPADWLTWRRTLDSWGFSPLNQINKSNVAQMKMAWTRGMGPGNVQEATPLIYNGVMYLPNPSDLVQALDARTGDLLWQYQRKLPTDLGKFMPVFAINRNLAIYGDKIIDTSADDYVFALDAKTGALAWETKILDYQKGAQQTSGPIIANGKIISGRGCEPEGGPDACVITAHDAVTGKEIWRTRTIPKPGEPGYETWGNVPEEKRIHVGTWMVPSYDPQLNMVYIGTSVTSPAPKYMLAGNDKRYLYHNSTLALNADTGKIEWYYQHLVDHWDLDHPFERLLLETAVAPDPKQVAWINPKIKPGEKRRVITGIPGKTGIVYTLDRRTGEFLWARPTVQQNVISKIDGATGAVTGNPDVLFSAKGQEKLICPSVNGGKNWPAGAYSPQTNAMYYPLQNMCMKVTTQEPDASLYAVNMQPELAAGTDKVGTVFAISAETGRTLWKYEQRAGILSLVATGGGLILVGDAVGHFRALDDASGRVLFDVNLGSPVSGYPITFAVNGKQYVAVSTGPSLVAGGVGRLTPELKPGSANQMFVFALP

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
133 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 0
Rhizoplane 2.37
Rhizosphere 97.16
Stem 0
Stem Tuber 0
Unclassified 4.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10017521 3300009094 Bacteria 8867
2 JGI24746J21847_1004889 3300001977 Unclassified 2101
3 JGI25406J46586_10000393 3300003203 Bacteria 20038
4 JGI25406J46586_10002342 3300003203 Bacteria 8949
5 Ga0065712_10000378 3300005290 Bacteria 12537
6 Ga0065712_10002792 3300005290 Bacteria 4460
7 Ga0065712_10007244 3300005290 Bacteria 2884
8 Ga0065712_10103415 3300005290 Bacteria 1983
9 Ga0065715_10108547 3300005293 Bacteria 2713
10 Ga0065715_10135307 3300005293 Bacteria 1927
11 Ga0070658_10022095 3300005327 Bacteria 5104
12 Ga0070676_10017603 3300005328 Bacteria 3954
13 Ga0070676_10018175 3300005328 Bacteria 3893
14 Ga0070690_100003639 3300005330 Bacteria 8482
15 Ga0070690_100022240 3300005330 Bacteria 3878
16 Ga0070670_100010669 3300005331 Bacteria 7848
17 Ga0068869_100009749 3300005334 Bacteria 6237
18 Ga0068869_100012485 3300005334 Bacteria 5616
19 Ga0068869_100021711 3300005334 Bacteria 4418
20 Ga0068869_100024956 3300005334 Bacteria 4146
21 Ga0068869_100049122 3300005334 Bacteria 3053
22 Ga0070666_10030156 3300005335 Bacteria 3571
23 Ga0070682_100023253 3300005337 Bacteria 3679
24 Ga0070682_100047649 3300005337 Bacteria 2665
25 Ga0068868_100015352 3300005338 Bacteria 5663
26 Ga0068868_100027264 3300005338 Bacteria 4359
27 Ga0068868_100033474 3300005338 Bacteria 3961
28 Ga0068868_100035239 3300005338 Bacteria 3868
29 Ga0070689_100031724 3300005340 Bacteria 4016
30 Ga0070689_100110382 3300005340 Bacteria 2187
31 Ga0070687_100009547 3300005343 Bacteria 4163
32 Ga0070668_100131818 3300005347 Bacteria 2007
33 Ga0070669_100002774 3300005353 Bacteria 12639
34 Ga0070669_100005111 3300005353 Bacteria 9488
35 Ga0070669_100012855 3300005353 Bacteria 5945
36 Ga0070669_100027658 3300005353 Bacteria 4082
37 Ga0070669_100055898 3300005353 Unclassified 2892
38 Ga0070675_100003977 3300005354 Bacteria 11210
39 Ga0070675_100007116 3300005354 Bacteria 8615
40 Ga0070675_100013835 3300005354 Bacteria 6353
41 Ga0070675_100018573 3300005354 Bacteria 5536
42 Ga0070675_100030724 3300005354 Bacteria 4338
43 Ga0070671_100083270 3300005355 Unclassified 2675
44 Ga0070674_100000561 3300005356 Bacteria 18680
45 Ga0070674_100001192 3300005356 Bacteria 13654
46 Ga0070674_100021841 3300005356 Bacteria 4118
47 Ga0070674_100030425 3300005356 Bacteria 3567
48 Ga0070673_100014093 3300005364 Bacteria 5554
49 Ga0070673_100023022 3300005364 Bacteria 4545
50 Ga0070673_100026976 3300005364 Bacteria 4252
51 Ga0070673_100044916 3300005364 Unclassified 3423
52 Ga0070673_100054403 3300005364 Bacteria 3148
53 Ga0070673_100055252 3300005364 Bacteria 3128
54 Ga0070688_100007832 3300005365 Bacteria 5775
55 Ga0070688_100037447 3300005365 Bacteria 2956
56 Ga0070667_100089028 3300005367 Bacteria 2651
57 Ga0070709_10008166 3300005434 Bacteria 5747
58 Ga0070701_10002227 3300005438 Bacteria 7414
59 Ga0070701_10023264 3300005438 Bacteria 2982
60 Ga0070700_100002614 3300005441 Bacteria 9206
61 Ga0070700_100014827 3300005441 Bacteria 4404
62 Ga0070694_100029158 3300005444 Bacteria 3599
63 Ga0070694_100033505 3300005444 Bacteria 3381
64 Ga0070694_100109788 3300005444 Bacteria 1964
65 Ga0070708_100166870 3300005445 Bacteria 2054
66 Ga0070678_100114609 3300005456 Bacteria 2115
67 Ga0070678_100149000 3300005456 Bacteria 1882
68 Ga0070662_100047596 3300005457 Bacteria 3085
69 Ga0070662_100111738 3300005457 Bacteria 2082
70 Ga0068867_100001665 3300005459 Bacteria 15488
71 Ga0068867_100004975 3300005459 Bacteria 9363
72 Ga0068867_100019390 3300005459 Bacteria 4847
73 Ga0068867_100020353 3300005459 Bacteria 4728
74 Ga0068867_100027957 3300005459 Bacteria 4058
75 Ga0068867_100085343 3300005459 Unclassified 2387
76 Ga0070685_10001943 3300005466 Bacteria 10736
77 Ga0070685_10016202 3300005466 Bacteria 3968
78 Ga0070685_10021117 3300005466 Bacteria 3535
79 Ga0070684_100099409 3300005535 Bacteria 2597
80 Ga0070672_100004887 3300005543 Bacteria 8814
81 Ga0070672_100008743 3300005543 Bacteria 6951
82 Ga0070672_100025925 3300005543 Bacteria 4355
83 Ga0070672_100053238 3300005543 Unclassified 3164
84 Ga0070686_100009347 3300005544 Bacteria 5508
85 Ga0070686_100014828 3300005544 Bacteria 4499
86 Ga0070686_100015962 3300005544 Bacteria 4361
87 Ga0070686_100079209 3300005544 Bacteria 2171
88 Ga0070695_100087116 3300005545 Bacteria 2077
89 Ga0070696_100070456 3300005546 Bacteria 2459
90 Ga0070665_100086023 3300005548 Bacteria 3150
91 Ga0070665_100089298 3300005548 Bacteria 3088
92 Ga0070704_100014273 3300005549 Bacteria 4959
93 Ga0070704_100141113 3300005549 Bacteria 1881
94 Ga0070664_100014829 3300005564 Bacteria 6362
95 Ga0070664_100030635 3300005564 Bacteria 4490
96 Ga0070664_100097382 3300005564 Bacteria 2554
97 Ga0068857_100003848 3300005577 Bacteria 12629
98 Ga0068857_100163802 3300005577 Bacteria 2018
99 Ga0070702_100023782 3300005615 Bacteria 3260
100 Ga0070702_100035701 3300005615 Bacteria 2748
101 Ga0068859_100004353 3300005617 Bacteria 14451
102 Ga0068859_100030208 3300005617 Bacteria 5437
103 Ga0068859_100079909 3300005617 Bacteria 3311
104 Ga0068859_100120652 3300005617 Bacteria 2689
105 Ga0068859_100136974 3300005617 Bacteria 2521
106 Ga0068859_100198051 3300005617 Bacteria 2093
107 Ga0068864_100028152 3300005618 Bacteria 4748
108 Ga0068864_100063538 3300005618 Bacteria 3199
109 Ga0068866_10003094 3300005718 Bacteria 6858
110 Ga0068861_100008246 3300005719 Bacteria 7169
111 Ga0068861_100027913 3300005719 Bacteria 4116
112 Ga0068861_100037332 3300005719 Bacteria 3612
113 Ga0068861_100117844 3300005719 Bacteria 2138
114 Ga0068861_100117914 3300005719 Bacteria 2137
115 Ga0068870_10001328 3300005840 Bacteria 9957
116 Ga0068870_10019041 3300005840 Bacteria 3325
117 Ga0068863_100000973 3300005841 Bacteria 28792
118 Ga0068863_100006940 3300005841 Bacteria 11103
119 Ga0068863_100025314 3300005841 Bacteria 5657
120 Ga0068863_100104509 3300005841 Bacteria 2694
121 Ga0068863_100122660 3300005841 Bacteria 2479
122 Ga0068858_100008883 3300005842 Bacteria 9633
123 Ga0068858_100030634 3300005842 Bacteria 4996
124 Ga0068858_100031601 3300005842 Bacteria 4918
125 Ga0068858_100036060 3300005842 Bacteria 4586
126 Ga0068858_100095389 3300005842 Bacteria 2772
127 Ga0068860_100076590 3300005843 Bacteria 3181
128 Ga0068860_100205082 3300005843 Bacteria 1912
129 Ga0068862_100024613 3300005844 Bacteria 5053
130 Ga0068862_100092734 3300005844 Bacteria 2633
131 Ga0081455_10099819 3300005937 Bacteria 2334
132 Ga0081539_10000047 3300005985 Bacteria 275235
133 Ga0081539_10001878 3300005985 Bacteria 32925
134 Ga0081539_10005549 3300005985 Bacteria 12785
135 Ga0081539_10008461 3300005985 Bacteria 8951
136 Ga0081539_10025952 3300005985 Bacteria 3754
137 Ga0097621_100011182 3300006237 Bacteria 6606
138 Ga0097621_100030097 3300006237 Bacteria 4295
139 Ga0097621_100033488 3300006237 Bacteria 4092
140 Ga0068871_100045758 3300006358 Bacteria 3523
141 Ga0075428_100002991 3300006844 Bacteria 18429
142 Ga0075428_100003502 3300006844 Bacteria 17192
143 Ga0075428_100004145 3300006844 Bacteria 15957
144 Ga0075428_100050210 3300006844 Bacteria 4576
145 Ga0075428_100118476 3300006844 Bacteria 2883
146 Ga0075430_100019357 3300006846 Bacteria 5788
147 Ga0075430_100039899 3300006846 Bacteria 3974
148 Ga0075430_100045881 3300006846 Bacteria 3691
149 Ga0075430_100089096 3300006846 Unclassified 2582
150 Ga0075430_100090639 3300006846 Bacteria 2557
151 Ga0075431_100000792 3300006847 Bacteria 27592
152 Ga0075431_100024848 3300006847 Bacteria 6143
153 Ga0075431_100027436 3300006847 Bacteria 5842
154 Ga0075433_10007983 3300006852 Bacteria 8425
155 Ga0075434_100000984 3300006871 Bacteria 23029
156 Ga0075434_100067139 3300006871 Bacteria 3573
157 Ga0075434_100131076 3300006871 Bacteria 2526
158 Ga0075429_100000997 3300006880 Bacteria 22515
159 Ga0075429_100058141 3300006880 Bacteria 3367
160 Ga0075429_100061234 3300006880 Bacteria 3279
161 Ga0068865_100005703 3300006881 Bacteria 7564
162 Ga0068865_100024432 3300006881 Bacteria 3965
163 Ga0068865_100025894 3300006881 Bacteria 3864
164 Ga0097620_100004352 3300006931 Bacteria 14451
165 Ga0097620_100030207 3300006931 Bacteria 5437
166 Ga0097620_100079909 3300006931 Bacteria 3311
167 Ga0097620_100120648 3300006931 Bacteria 2689
168 Ga0097620_100136965 3300006931 Bacteria 2521
169 Ga0097620_100198057 3300006931 Bacteria 2093
170 Ga0075435_100013886 3300007076 Bacteria 6006
171 Ga0105240_10094101 3300009093 Bacteria 3656
172 Ga0111539_10001820 3300009094 Bacteria 28388
173 Ga0111539_10002166 3300009094 Bacteria 26275
174 Ga0111539_10002182 3300009094 Bacteria 26129
175 Ga0111539_10005765 3300009094 Bacteria 16006
176 Ga0111539_10007916 3300009094 Bacteria 13552
177 Ga0111539_10009050 3300009094 Bacteria 12604
178 Ga0111539_10015316 3300009094 Bacteria 9549
179 Ga0111539_10051698 3300009094 Bacteria 4893
180 Ga0111539_10195762 3300009094 Bacteria 2358
181 Ga0105245_10019637 3300009098 Bacteria 5920
182 Ga0105245_10063389 3300009098 Bacteria 3337
183 Ga0105247_10002442 3300009101 Bacteria 12640
184 Ga0105247_10013636 3300009101 Bacteria 4875
185 Ga0105247_10019502 3300009101 Bacteria 4072
186 Ga0114129_10016062 3300009147 Bacteria 10650
187 Ga0114129_10076555 3300009147 Bacteria 4658
188 Ga0114129_10140136 3300009147 Bacteria 3316
189 Ga0105243_10015764 3300009148 Bacteria 5716
190 Ga0105243_10034803 3300009148 Bacteria 3903
191 Ga0105243_10099756 3300009148 Bacteria 2408
192 Ga0105242_10003718 3300009176 Bacteria 11860
193 Ga0105242_10062173 3300009176 Bacteria 3072
194 Ga0105242_10096718 3300009176 Bacteria 2495
195 Ga0105248_10002184 3300009177 Bacteria 21641
196 Ga0105248_10026721 3300009177 Bacteria 6419
197 Ga0105248_10105062 3300009177 Bacteria 3184
198 Ga0105248_10179707 3300009177 Bacteria 2384
199 Ga0105238_10004165 3300009551 Bacteria 14348
200 Ga0105238_10007860 3300009551 Bacteria 10668
201 Ga0105238_10011880 3300009551 Bacteria 8772
202 Ga0105238_10014663 3300009551 Bacteria 7924
203 Ga0105249_10007086 3300009553 Bacteria 9786
204 Ga0105246_10012754 3300011119 Bacteria 5253
205 Ga0105246_10100287 3300011119 Bacteria 2107
206 Ga0157374_10026112 3300013296 Bacteria 5252
207 Ga0163162_10007700 3300013306 Bacteria 10494
208 Ga0163162_10008759 3300013306 Bacteria 9841
209 Ga0163162_10010247 3300013306 Bacteria 9105
210 Ga0163162_10065268 3300013306 Bacteria 3687
211 Ga0157375_10001084 3300013308 Bacteria 23634
212 Ga0157375_10002923 3300013308 Bacteria 14815
213 Ga0157375_10014358 3300013308 Bacteria 7062
214 Ga0157375_10115854 3300013308 Bacteria 2783
215 Ga0163163_10000522 3300014325 Bacteria 34276
216 Ga0163163_10041659 3300014325 Bacteria 4492
217 Ga0163163_10045105 3300014325 Bacteria 4327
218 Ga0163163_10076048 3300014325 Bacteria 3352
219 Ga0163163_10086137 3300014325 Bacteria 3150
220 Ga0163163_10087554 3300014325 Bacteria 3125
221 Ga0157380_10001264 3300014326 Bacteria 16407
222 Ga0157380_10001966 3300014326 Bacteria 13683
223 Ga0157380_10002044 3300014326 Bacteria 13493
224 Ga0157380_10002890 3300014326 Bacteria 11674
225 Ga0157380_10008303 3300014326 Bacteria 7400
226 Ga0157380_10008590 3300014326 Bacteria 7302
227 Ga0157380_10012613 3300014326 Bacteria 6132
228 Ga0157377_10015373 3300014745 Bacteria 3915
229 Ga0157377_10020241 3300014745 Bacteria 3484
230 Ga0157379_10007582 3300014968 Bacteria 9396
231 Ga0157379_10015885 3300014968 Bacteria 6617
232 Ga0157379_10165694 3300014968 Bacteria 1994
233 Ga0157376_10014864 3300014969 Bacteria 5859
234 Ga0157376_10026209 3300014969 Bacteria 4604
235 Ga0157376_10073859 3300014969 Bacteria 2905
236 Ga0163161_10030393 3300017792 Bacteria 3844
237 Ga0207682_10001490 3300025893 Bacteria 10808
238 Ga0207682_10006069 3300025893 Bacteria 4887
239 Ga0207642_10005539 3300025899 Bacteria 4127
240 Ga0207642_10037076 3300025899 Unclassified 2098
241 Ga0207688_10000527 3300025901 Bacteria 18549
242 Ga0207685_10023867 3300025905 Bacteria 2088
243 Ga0207645_10004987 3300025907 Bacteria 9729
244 Ga0207645_10008961 3300025907 Bacteria 6947
245 Ga0207645_10035009 3300025907 Bacteria 3225
246 Ga0207645_10046664 3300025907 Bacteria 2767
247 Ga0207645_10054015 3300025907 Bacteria 2566
248 Ga0207643_10017822 3300025908 Bacteria 3888
249 Ga0207662_10056305 3300025918 Bacteria 2348
250 Ga0207681_10014355 3300025923 Bacteria 4921
251 Ga0207681_10017345 3300025923 Bacteria 4521
252 Ga0207681_10086496 3300025923 Bacteria 2227
253 Ga0207694_10006426 3300025924 Bacteria 8957
254 Ga0207694_10036508 3300025924 Bacteria 3772
255 Ga0207650_10039583 3300025925 Bacteria 3444
256 Ga0207659_10002473 3300025926 Bacteria 11016
257 Ga0207659_10003593 3300025926 Bacteria 9335
258 Ga0207659_10005986 3300025926 Bacteria 7420
259 Ga0207659_10019170 3300025926 Bacteria 4497
260 Ga0207659_10028152 3300025926 Bacteria 3815
261 Ga0207687_10007820 3300025927 Bacteria 7012
262 Ga0207706_10016746 3300025933 Bacteria 6617
263 Ga0207706_10071703 3300025933 Bacteria 3047
264 Ga0207686_10013291 3300025934 Bacteria 4552
265 Ga0207686_10054783 3300025934 Unclassified 2499
266 Ga0207709_10013130 3300025935 Bacteria 4568
267 Ga0207670_10046176 3300025936 Bacteria 2892
268 Ga0207670_10047223 3300025936 Bacteria 2866
269 Ga0207670_10074557 3300025936 Bacteria 2356
270 Ga0207669_10000628 3300025937 Bacteria 15239
271 Ga0207669_10077040 3300025937 Bacteria 2119
272 Ga0207704_10007473 3300025938 Bacteria 5166
273 Ga0207704_10019705 3300025938 Bacteria 3550
274 Ga0207704_10023437 3300025938 Bacteria 3327
275 Ga0207691_10009367 3300025940 Bacteria 9401
276 Ga0207691_10009464 3300025940 Bacteria 9356
277 Ga0207691_10029542 3300025940 Bacteria 5128
278 Ga0207691_10037253 3300025940 Bacteria 4505
279 Ga0207691_10045009 3300025940 Bacteria 4059
280 Ga0207691_10075461 3300025940 Unclassified 3040
281 Ga0207691_10096097 3300025940 Bacteria 2649
282 Ga0207711_10016325 3300025941 Bacteria 6169
283 Ga0207711_10039279 3300025941 Bacteria 4026
284 Ga0207711_10077106 3300025941 Bacteria 2904
285 Ga0207689_10002182 3300025942 Bacteria 18371
286 Ga0207689_10016927 3300025942 Bacteria 6167
287 Ga0207689_10020726 3300025942 Bacteria 5527
288 Ga0207689_10030731 3300025942 Bacteria 4476
289 Ga0207679_10014779 3300025945 Bacteria 5141
290 Ga0207651_10004214 3300025960 Bacteria 7207
291 Ga0207651_10012655 3300025960 Bacteria 4786
292 Ga0207651_10014738 3300025960 Bacteria 4523
293 Ga0207651_10019307 3300025960 Bacteria 4080
294 Ga0207677_10049348 3300026023 Bacteria 2839
295 Ga0207703_10004861 3300026035 Bacteria 10936
296 Ga0207708_10010376 3300026075 Bacteria 6915
297 Ga0207708_10011393 3300026075 Bacteria 6623
298 Ga0207708_10012336 3300026075 Bacteria 6368
299 Ga0207708_10020530 3300026075 Bacteria 4982
300 Ga0207708_10031748 3300026075 Bacteria 4010
301 Ga0207641_10005002 3300026088 Bacteria 11363
302 Ga0207641_10087541 3300026088 Bacteria 2718
303 Ga0207648_10000436 3300026089 Bacteria 46118
304 Ga0207648_10003747 3300026089 Bacteria 15893
305 Ga0207648_10011035 3300026089 Bacteria 8528
306 Ga0207648_10030705 3300026089 Bacteria 4756
307 Ga0207648_10058601 3300026089 Bacteria 3358
308 Ga0207648_10103197 3300026089 Unclassified 2500
309 Ga0207676_10011572 3300026095 Bacteria 6309
310 Ga0207676_10044853 3300026095 Bacteria 3413
311 Ga0207676_10057354 3300026095 Bacteria 3066
312 Ga0207674_10161290 3300026116 Bacteria 2196
313 Ga0207675_100007767 3300026118 Bacteria 10119
314 Ga0207675_100013278 3300026118 Bacteria 7689
315 Ga0207675_100037534 3300026118 Bacteria 4519
316 Ga0207683_10029703 3300026121 Unclassified 4734
317 Ga0207683_10055447 3300026121 Bacteria 3475
318 Ga0207683_10066868 3300026121 Bacteria 3170
319 Ga0207683_10119851 3300026121 Bacteria 2361
320 Ga0207428_10017459 3300027907 Bacteria 6158
321 Ga0207428_10019420 3300027907 Bacteria 5796
322 Ga0207428_10054473 3300027907 Bacteria 3186
323 Ga0207428_10056899 3300027907 Bacteria 3106
324 Ga0268266_10088907 3300028379 Bacteria 2704
325 Ga0268265_10096416 3300028380 Bacteria 2377
326 Ga0268264_10029571 3300028381 Bacteria 4488
327 Ga0307408_100041323 3300031548 Bacteria 3269
328 Ga0265314_10047738 3300031711 Bacteria 3011
329 Ga0307405_10035427 3300031731 Bacteria 2980
330 Ga0307405_10085323 3300031731 Bacteria 2075
331 Ga0307413_10017137 3300031824 Bacteria 3767
332 Ga0307413_10020333 3300031824 Bacteria 3529
333 Ga0307406_10011896 3300031901 Bacteria 4946
334 Ga0307412_10069604 3300031911 Bacteria 2396
335 Ga0307409_100007752 3300031995 Bacteria 6455
336 Ga0307416_100004883 3300032002 Bacteria 8163
337 Ga0373927_0070483 3300035695 Bacteria 2263
338 Ga0373933_0053855 3300035724 Bacteria 2410
339 Ga0373947_0009312 3300035725 Bacteria 5642
340 Ga0373937_0190490 3300036401 Bacteria 1927
341 Ga0439433_0002367 3300041999 Bacteria 3991
342 Ga0439435_0008918 3300042436 Bacteria 2339
343 Ga0495608_0013627 3300046511 Bacteria 5640
344 Ga0495628_0115398 3300046516 Bacteria 2062
345 Ga0495587_0013860 3300046536 Bacteria 5064
346 Ga0495598_0006504 3300046537 Unclassified 2642
347 Ga0495634_0011324 3300046642 Bacteria 6496
348 Ga0495658_0019457 3300046683 Bacteria 3545
349 Ga0495658_0033478 3300046683 Unclassified 2815
350 Ga0495613_0000790 3300046689 Bacteria 24652
351 Ga0495581_0103996 3300047315 Bacteria 1650
352 Ga0495684_0000697 3300047471 Bacteria 26977
353 Ga0496100_0006086 3300048903 Bacteria 6558
354 Ga0496100_0027684 3300048903 Bacteria 3488
355 Ga0496101_0009045 3300048904 Bacteria 6534
356 Ga0496104_0004112 3300048907 Bacteria 12635
357 Ga0496104_0136494 3300048907 Bacteria 2357
358 Ga0496104_0172478 3300048907 Bacteria 2074
359 Ga0496107_0046015 3300048910 Bacteria 3140
360 Ga0496114_0000363 3300048917 Bacteria 33231
361 Ga0496114_0001356 3300048917 Bacteria 18567
362 Ga0496114_0003823 3300048917 Bacteria 11614
363 Ga0501033_0016007 3300049570 Bacteria 5681
364 Ga0501036_0012164 3300049572 Bacteria 7130
365 Ga0501036_0057653 3300049572 Bacteria 3290
366 Ga0501038_0104345 3300049574 Bacteria 2356
367 Ga0501038_0125701 3300049574 Bacteria 2111
368 Ga0501039_0007475 3300049575 Bacteria 8342
369 Ga0501039_0057179 3300049575 Bacteria 3021
370 Ga0501040_0001978 3300049576 Bacteria 13214
371 Ga0501040_0011408 3300049576 Bacteria 5818
372 Ga0501041_0016553 3300049577 Bacteria 4385
373 Ga0501043_0073108 3300049579 Bacteria 2693
374 Ga0501046_0012891 3300049580 Bacteria 7108
375 Ga0501046_0019801 3300049580 Bacteria 5575
376 Ga0501048_0014288 3300049582 Bacteria 5880
377 Ga0501068_0026371 3300049584 Bacteria 3423
378 Ga0501071_0044404 3300049587 Bacteria 3187
379 Ga0501071_0077922 3300049587 Bacteria 2421
380 Ga0501072_0043323 3300049588 Bacteria 3537
381 Ga0501074_0130666 3300049590 Bacteria 1796
382 Ga0501075_0003476 3300049591 Bacteria 10540
383 Ga0501076_0014467 3300049592 Bacteria 5945
384 Ga0501076_0127420 3300049592 Bacteria 2063
385 Ga0501077_0044824 3300049593 Bacteria 2809
386 Ga0501079_0027332 3300049741 Bacteria 4373
387 Ga0501080_0027490 3300049742 Bacteria 5290
388 Ga0501080_0032385 3300049742 Bacteria 4875
389 Ga0501081_0003625 3300049743 Bacteria 9883
390 Ga0501081_0054293 3300049743 Bacteria 2768
391 Ga0501045_0025595 3300049824 Bacteria 4243
392 Ga0501045_0067514 3300049824 Bacteria 2626
393 nmdc:mga05p37_11148_c1 3300050507 Bacteria 10681
394 nmdc:mga09592_52815_c1 3300050508 Bacteria 3430
395 nmdc:mga09592_56216_c1 3300050508 Bacteria 3325
396 nmdc:mga09592_92246_c1 3300050508 Bacteria 2589
397 nmdc:mga0qj67_106916_c1 3300050509 Bacteria 2257
398 nmdc:mga0qj67_1129_c1 3300050509 Bacteria 18518
399 nmdc:mga0qj67_37454_c1 3300050509 Bacteria 3799
400 nmdc:mga0qj67_77704_c1 3300050509 Bacteria 2656
401 nmdc:mga0qj67_81282_c1 3300050509 Unclassified 2598
402 nmdc:mga06r32_5831_c1 3300050510 Bacteria 11092
403 nmdc:mga08y16_114321_c1 3300050511 Unclassified 2810
404 nmdc:mga08y16_136727_c1 3300050511 Bacteria 2547
405 nmdc:mga08y16_18087_c1 3300050511 Bacteria 7423
406 nmdc:mga08y16_28441_c1 3300050511 Bacteria 5894
407 nmdc:mga08y16_347_c1 3300050511 Bacteria 41642
408 nmdc:mga08y16_42998_c1 3300050511 Unclassified 4732
409 nmdc:mga08y16_60551_c1 3300050511 Unclassified 3954
410 nmdc:mga08y16_6420_c1 3300050511 Bacteria 12326
411 nmdc:mga0n895_130487_c1 3300050512 Bacteria 2538
412 nmdc:mga0n895_167152_c1 3300050512 Bacteria 2231
413 nmdc:mga0n895_28331_c1 3300050512 Bacteria 5327
414 nmdc:mga0rr50_31038_c1 3300050513 Bacteria 3790
415 nmdc:mga0a205_19469_c1 3300050515 Bacteria 6399
416 nmdc:mga0a205_3517_c1 3300050515 Bacteria 14001
417 nmdc:mga0a205_453_c1 3300050515 Bacteria 31784
418 nmdc:mga0a205_4683_c1 3300050515 Bacteria 12274
419 Ga0500643_000434 3300053087 Bacteria 31543
420 Ga0500643_003518 3300053087 Bacteria 7493
421 Ga0501084_0015275 3300054114 Bacteria 6367
422 Ga0501082_0001526 3300060353 Bacteria 20365
423 Ga0111539_10017521
424 JGI24746J21847_1004889
425 JGI25406J46586_10000393
426 JGI25406J46586_10002342
427 Ga0065712_10000378
428 Ga0065712_10002792
429 Ga0065712_10007244
430 Ga0065712_10103415
431 Ga0065715_10108547
432 Ga0065715_10135307
433 Ga0070658_10022095
434 Ga0070676_10017603
435 Ga0070676_10018175
436 Ga0070690_100003639
437 Ga0070690_100022240
438 Ga0070670_100010669
439 Ga0068869_100009749
440 Ga0068869_100012485
441 Ga0068869_100021711
442 Ga0068869_100024956
443 Ga0068869_100049122
444 Ga0070666_10030156
445 Ga0070682_100023253
446 Ga0070682_100047649
447 Ga0068868_100015352
448 Ga0068868_100027264
449 Ga0068868_100033474
450 Ga0068868_100035239
451 Ga0070689_100031724
452 Ga0070689_100110382
453 Ga0070687_100009547
454 Ga0070668_100131818
455 Ga0070669_100002774
456 Ga0070669_100005111
457 Ga0070669_100012855
458 Ga0070669_100027658
459 Ga0070669_100055898
460 Ga0070675_100003977
461 Ga0070675_100007116
462 Ga0070675_100013835
463 Ga0070675_100018573
464 Ga0070675_100030724
465 Ga0070671_100083270
466 Ga0070674_100000561
467 Ga0070674_100001192
468 Ga0070674_100021841
469 Ga0070674_100030425
470 Ga0070673_100014093
471 Ga0070673_100023022
472 Ga0070673_100026976
473 Ga0070673_100044916
474 Ga0070673_100054403
475 Ga0070673_100055252
476 Ga0070688_100007832
477 Ga0070688_100037447
478 Ga0070667_100089028
479 Ga0070709_10008166
480 Ga0070701_10002227
481 Ga0070701_10023264
482 Ga0070700_100002614
483 Ga0070700_100014827
484 Ga0070694_100029158
485 Ga0070694_100033505
486 Ga0070694_100109788
487 Ga0070708_100166870
488 Ga0070678_100114609
489 Ga0070678_100149000
490 Ga0070662_100047596
491 Ga0070662_100111738
492 Ga0068867_100001665
493 Ga0068867_100004975
494 Ga0068867_100019390
495 Ga0068867_100020353
496 Ga0068867_100027957
497 Ga0068867_100085343
498 Ga0070685_10001943
499 Ga0070685_10016202
500 Ga0070685_10021117
501 Ga0070684_100099409
502 Ga0070672_100004887
503 Ga0070672_100008743
504 Ga0070672_100025925
505 Ga0070672_100053238
506 Ga0070686_100009347
507 Ga0070686_100014828
508 Ga0070686_100015962
509 Ga0070686_100079209
510 Ga0070695_100087116
511 Ga0070696_100070456
512 Ga0070665_100086023
513 Ga0070665_100089298
514 Ga0070704_100014273
515 Ga0070704_100141113
516 Ga0070664_100014829
517 Ga0070664_100030635
518 Ga0070664_100097382
519 Ga0068857_100003848
520 Ga0068857_100163802
521 Ga0070702_100023782
522 Ga0070702_100035701
523 Ga0068859_100004353
524 Ga0068859_100030208
525 Ga0068859_100079909
526 Ga0068859_100120652
527 Ga0068859_100136974
528 Ga0068859_100198051
529 Ga0068864_100028152
530 Ga0068864_100063538
531 Ga0068866_10003094
532 Ga0068861_100008246
533 Ga0068861_100027913
534 Ga0068861_100037332
535 Ga0068861_100117844
536 Ga0068861_100117914
537 Ga0068870_10001328
538 Ga0068870_10019041
539 Ga0068863_100000973
540 Ga0068863_100006940
541 Ga0068863_100025314
542 Ga0068863_100104509
543 Ga0068863_100122660
544 Ga0068858_100008883
545 Ga0068858_100030634
546 Ga0068858_100031601
547 Ga0068858_100036060
548 Ga0068858_100095389
549 Ga0068860_100076590
550 Ga0068860_100205082
551 Ga0068862_100024613
552 Ga0068862_100092734
553 Ga0081455_10099819
554 Ga0081539_10000047
555 Ga0081539_10001878
556 Ga0081539_10005549
557 Ga0081539_10008461
558 Ga0081539_10025952
559 Ga0097621_100011182
560 Ga0097621_100030097
561 Ga0097621_100033488
562 Ga0068871_100045758
563 Ga0075428_100002991
564 Ga0075428_100003502
565 Ga0075428_100004145
566 Ga0075428_100050210
567 Ga0075428_100118476
568 Ga0075430_100019357
569 Ga0075430_100039899
570 Ga0075430_100045881
571 Ga0075430_100089096
572 Ga0075430_100090639
573 Ga0075431_100000792
574 Ga0075431_100024848
575 Ga0075431_100027436
576 Ga0075433_10007983
577 Ga0075434_100000984
578 Ga0075434_100067139
579 Ga0075434_100131076
580 Ga0075429_100000997
581 Ga0075429_100058141
582 Ga0075429_100061234
583 Ga0068865_100005703
584 Ga0068865_100024432
585 Ga0068865_100025894
586 Ga0097620_100004352
587 Ga0097620_100030207
588 Ga0097620_100079909
589 Ga0097620_100120648
590 Ga0097620_100136965
591 Ga0097620_100198057
592 Ga0075435_100013886
593 Ga0105240_10094101
594 Ga0111539_10001820
595 Ga0111539_10002166
596 Ga0111539_10002182
597 Ga0111539_10005765
598 Ga0111539_10007916
599 Ga0111539_10009050
600 Ga0111539_10015316
601 Ga0111539_10051698
602 Ga0111539_10195762
603 Ga0105245_10019637
604 Ga0105245_10063389
605 Ga0105247_10002442
606 Ga0105247_10013636
607 Ga0105247_10019502
608 Ga0114129_10016062
609 Ga0114129_10076555
610 Ga0114129_10140136
611 Ga0105243_10015764
612 Ga0105243_10034803
613 Ga0105243_10099756
614 Ga0105242_10003718
615 Ga0105242_10062173
616 Ga0105242_10096718
617 Ga0105248_10002184
618 Ga0105248_10026721
619 Ga0105248_10105062
620 Ga0105248_10179707
621 Ga0105238_10004165
622 Ga0105238_10007860
623 Ga0105238_10011880
624 Ga0105238_10014663
625 Ga0105249_10007086
626 Ga0105246_10012754
627 Ga0105246_10100287
628 Ga0157374_10026112
629 Ga0163162_10007700
630 Ga0163162_10008759
631 Ga0163162_10010247
632 Ga0163162_10065268
633 Ga0157375_10001084
634 Ga0157375_10002923
635 Ga0157375_10014358
636 Ga0157375_10115854
637 Ga0163163_10000522
638 Ga0163163_10041659
639 Ga0163163_10045105
640 Ga0163163_10076048
641 Ga0163163_10086137
642 Ga0163163_10087554
643 Ga0157380_10001264
644 Ga0157380_10001966
645 Ga0157380_10002044
646 Ga0157380_10002890
647 Ga0157380_10008303
648 Ga0157380_10008590
649 Ga0157380_10012613
650 Ga0157377_10015373
651 Ga0157377_10020241
652 Ga0157379_10007582
653 Ga0157379_10015885
654 Ga0157379_10165694
655 Ga0157376_10014864
656 Ga0157376_10026209
657 Ga0157376_10073859
658 Ga0163161_10030393
659 Ga0207682_10001490
660 Ga0207682_10006069
661 Ga0207642_10005539
662 Ga0207642_10037076
663 Ga0207688_10000527
664 Ga0207685_10023867
665 Ga0207645_10004987
666 Ga0207645_10008961
667 Ga0207645_10035009
668 Ga0207645_10046664
669 Ga0207645_10054015
670 Ga0207643_10017822
671 Ga0207662_10056305
672 Ga0207681_10014355
673 Ga0207681_10017345
674 Ga0207681_10086496
675 Ga0207694_10006426
676 Ga0207694_10036508
677 Ga0207650_10039583
678 Ga0207659_10002473
679 Ga0207659_10003593
680 Ga0207659_10005986
681 Ga0207659_10019170
682 Ga0207659_10028152
683 Ga0207687_10007820
684 Ga0207706_10016746
685 Ga0207706_10071703
686 Ga0207686_10013291
687 Ga0207686_10054783
688 Ga0207709_10013130
689 Ga0207670_10046176
690 Ga0207670_10047223
691 Ga0207670_10074557
692 Ga0207669_10000628
693 Ga0207669_10077040
694 Ga0207704_10007473
695 Ga0207704_10019705
696 Ga0207704_10023437
697 Ga0207691_10009367
698 Ga0207691_10009464
699 Ga0207691_10029542
700 Ga0207691_10037253
701 Ga0207691_10045009
702 Ga0207691_10075461
703 Ga0207691_10096097
704 Ga0207711_10016325
705 Ga0207711_10039279
706 Ga0207711_10077106
707 Ga0207689_10002182
708 Ga0207689_10016927
709 Ga0207689_10020726
710 Ga0207689_10030731
711 Ga0207679_10014779
712 Ga0207651_10004214
713 Ga0207651_10012655
714 Ga0207651_10014738
715 Ga0207651_10019307
716 Ga0207677_10049348
717 Ga0207703_10004861
718 Ga0207708_10010376
719 Ga0207708_10011393
720 Ga0207708_10012336
721 Ga0207708_10020530
722 Ga0207708_10031748
723 Ga0207641_10005002
724 Ga0207641_10087541
725 Ga0207648_10000436
726 Ga0207648_10003747
727 Ga0207648_10011035
728 Ga0207648_10030705
729 Ga0207648_10058601
730 Ga0207648_10103197
731 Ga0207676_10011572
732 Ga0207676_10044853
733 Ga0207676_10057354
734 Ga0207674_10161290
735 Ga0207675_100007767
736 Ga0207675_100013278
737 Ga0207675_100037534
738 Ga0207683_10029703
739 Ga0207683_10055447
740 Ga0207683_10066868
741 Ga0207683_10119851
742 Ga0207428_10017459
743 Ga0207428_10019420
744 Ga0207428_10054473
745 Ga0207428_10056899
746 Ga0268266_10088907
747 Ga0268265_10096416
748 Ga0268264_10029571
749 Ga0307408_100041323
750 Ga0265314_10047738
751 Ga0307405_10035427
752 Ga0307405_10085323
753 Ga0307413_10017137
754 Ga0307413_10020333
755 Ga0307406_10011896
756 Ga0307412_10069604
757 Ga0307409_100007752
758 Ga0307416_100004883
759 Ga0373927_0070483
760 Ga0373933_0053855
761 Ga0373947_0009312
762 Ga0373937_0190490
763 Ga0439433_0002367
764 Ga0439435_0008918
765 Ga0495608_0013627
766 Ga0495628_0115398
767 Ga0495587_0013860
768 Ga0495598_0006504
769 Ga0495634_0011324
770 Ga0495658_0019457
771 Ga0495658_0033478
772 Ga0495613_0000790
773 Ga0495581_0103996
774 Ga0495684_0000697
775 Ga0496100_0006086
776 Ga0496100_0027684
777 Ga0496101_0009045
778 Ga0496104_0004112
779 Ga0496104_0136494
780 Ga0496104_0172478
781 Ga0496107_0046015
782 Ga0496114_0000363
783 Ga0496114_0001356
784 Ga0496114_0003823
785 Ga0501033_0016007
786 Ga0501036_0012164
787 Ga0501036_0057653
788 Ga0501038_0104345
789 Ga0501038_0125701
790 Ga0501039_0007475
791 Ga0501039_0057179
792 Ga0501040_0001978
793 Ga0501040_0011408
794 Ga0501041_0016553
795 Ga0501043_0073108
796 Ga0501046_0012891
797 Ga0501046_0019801
798 Ga0501048_0014288
799 Ga0501068_0026371
800 Ga0501071_0044404
801 Ga0501071_0077922
802 Ga0501072_0043323
803 Ga0501074_0130666
804 Ga0501075_0003476
805 Ga0501076_0014467
806 Ga0501076_0127420
807 Ga0501077_0044824
808 Ga0501079_0027332
809 Ga0501080_0027490
810 Ga0501080_0032385
811 Ga0501081_0003625
812 Ga0501081_0054293
813 Ga0501045_0025595
814 Ga0501045_0067514
815 nmdc:mga05p37_11148_c1
816 nmdc:mga09592_52815_c1
817 nmdc:mga09592_56216_c1
818 nmdc:mga09592_92246_c1
819 nmdc:mga0qj67_106916_c1
820 nmdc:mga0qj67_1129_c1
821 nmdc:mga0qj67_37454_c1
822 nmdc:mga0qj67_77704_c1
823 nmdc:mga0qj67_81282_c1
824 nmdc:mga06r32_5831_c1
825 nmdc:mga08y16_114321_c1
826 nmdc:mga08y16_136727_c1
827 nmdc:mga08y16_18087_c1
828 nmdc:mga08y16_28441_c1
829 nmdc:mga08y16_347_c1
830 nmdc:mga08y16_42998_c1
831 nmdc:mga08y16_60551_c1
832 nmdc:mga08y16_6420_c1
833 nmdc:mga0n895_130487_c1
834 nmdc:mga0n895_167152_c1
835 nmdc:mga0n895_28331_c1
836 nmdc:mga0rr50_31038_c1
837 nmdc:mga0a205_19469_c1
838 nmdc:mga0a205_3517_c1
839 nmdc:mga0a205_453_c1
840 nmdc:mga0a205_4683_c1
841 Ga0500643_000434
842 Ga0500643_003518
843 Ga0501084_0015275
844 Ga0501082_0001526

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13570

PQQ_3

PQQ-like domain

503

542

0.96

PF13360

PQQ_2

PQQ-like domain

491

581

0.84

PF13360

PQQ_2

PQQ-like domain

70

222

0.79

PF13360

PQQ_2

PQQ-like domain

230

457

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yms-assembly1.cif.gz_B structure and assembly of a b-propeller with nine blades and a new conserved repetitive sequence motif 0.8992 432 488
4cvb-assembly1.cif.gz_A crystal structure of quinone-dependent alcohol dehydrogenase from pseudogluconobacter saccharoketogenenes 0.8905 29 542
4cvb-assembly1.cif.gz_A crystal structure of quinone-dependent alcohol dehydrogenase from pseudogluconobacter saccharoketogenenes 0.8448 29 542
7wmk-assembly1.cif.gz_A pqq-dependent alcohol dehydrogenase complexed with pqq 0.8396 23 542
1flg-assembly1.cif.gz_B crystal structure of the quinoprotein ethanol dehydrogenase from pseudomonas aeruginosa 0.826 36 542
ID Description Score Start End Superfamily
af_Q5RG49_936_1023_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.9122 432 503 2.40.128.630
2ymsB00 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8992 432 488 2.40.10.480
af_Q60259_9_76_2.40.10.480 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.8845 432 487 2.40.10.480
af_A0A1D8PNG5_157_281_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8563 432 513 2.40.128.630
af_Q86HN6_279_402_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8198 384 512 2.40.128.630
ID Description Score Start End GO Terms
AF-A0A7X4FQ54-F1-model_v4 PQQ-binding-like beta-propeller repeat protein 0.9995 456 542
AF-A0A2E1W141-F1-model_v4 ATP-binding protein 0.9885 422 542 GO:0005524
AF-A0A6L7WJA2-F1-model_v4 PQQ-binding-like beta-propeller repeat protein 0.988 432 542
AF-A0A3C0TE46-F1-model_v4 Pyrrolo-quinoline quinone 0.9742 423 542
AF-A0A7W1PQK8-F1-model_v4 PQQ-binding-like beta-propeller repeat protein 0.961 434 515

Map