F439601

General Info

Members Datasets Scaffolds Average Seq Length
419 231 838 379

Family's Representative Sequence

Representative Sequence 3300048904|Ga0496101_0009036|Ga0496101_0009036_1682_2863
Length 393
Sequence LIVWVIAGLLGLATGLRIGWALVNKQSLVSSAMILALGSLGTVAALNWQPLTLLIDTALHWPNIAVALSQVALISCAAGSCVMITTVASDRKPVTIRRIAIAQYLVALAIAVGTMVGFFVSGQEPEMAPQEYLRRNLGSAGGWSAWLLPMLYVLLALTLVAWAGVRHSNRTRRGRALFVFSIGIVLIVLASAFFLLRAVGNTDLLGVGSAATLLGCAMLVVAGGSLLPSIEDWFGARRELRTVSPLLAELSARHPDVGIGVRPRGPLLFRVAEQMSLISDSLYLEATAAETVRRRVQAHGSAARQLADDHDDDPDEFVDIAELEGPPVPAAEQARGIAQWIYDGRGADRDAANREFPGLNWLRQPPTFSDREWILAIAEQYCDLERTHGATAR

Samples

Sample ID Description Type Environment
1 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
134 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
135 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
136 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
137 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
138 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
139 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
140 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
141 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
142 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
143 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
146 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
147 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
148 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
156 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
157 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
184 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
202 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
205 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
206 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
209 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
210 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
211 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
212 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
213 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
214 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
215 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
216 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
219 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
220 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
221 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
222 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
223 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
224 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
225 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
226 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
227 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
228 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
229 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
230 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
231 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.9
Metatranscriptomes 0
Isolates 3.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.56
Nodule 0.24
Rhizoplane 14.8
Rhizosphere 60.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496101_0009036 3300048904 Bacteria 6536
2 JGI24746J21847_1002200 3300001977 Bacteria 3113
3 JGI24744J21845_10002139 3300002077 Bacteria 4011
4 JGI24744J21845_10003841 3300002077 Bacteria 3105
5 JGI24744J21845_10005635 3300002077 Bacteria 2594
6 JGI24744J21845_10005722 3300002077 Bacteria 2575
7 JGI24751J29686_10003627 3300002459 Bacteria 3110
8 Ga0055540_1000038 3300003792 Bacteria 161988
9 Ga0055540_1003730 3300003792 Bacteria 7205
10 Ga0055540_1003872 3300003792 Bacteria 7027
11 Ga0070690_100001324 3300005330 Bacteria 12887
12 Ga0070666_10045388 3300005335 Bacteria 2945
13 Ga0070682_100003462 3300005337 Bacteria 8731
14 Ga0068868_100001506 3300005338 Bacteria 16026
15 Ga0070689_100009946 3300005340 Bacteria 6766
16 Ga0070691_10025818 3300005341 Bacteria 2737
17 Ga0070687_100052278 3300005343 Bacteria 2119
18 Ga0070668_100000647 3300005347 Bacteria 23505
19 Ga0070668_100000685 3300005347 Bacteria 23052
20 Ga0070668_100230941 3300005347 Bacteria 1529
21 Ga0070669_100001291 3300005353 Bacteria 18110
22 Ga0070671_100005694 3300005355 Bacteria 9924
23 Ga0070674_100059042 3300005356 Bacteria 2669
24 Ga0070674_100089721 3300005356 Bacteria 2215
25 Ga0070667_100000099 3300005367 Bacteria 108662
26 Ga0070667_100000883 3300005367 Bacteria 27691
27 Ga0070667_100016635 3300005367 Bacteria 6087
28 Ga0070710_10002875 3300005437 Bacteria 8202
29 Ga0070701_10005856 3300005438 Bacteria 5125
30 Ga0070711_100057885 3300005439 Bacteria 2685
31 Ga0070711_100058671 3300005439 Bacteria 2669
32 Ga0070700_100004265 3300005441 Bacteria 7461
33 Ga0070700_100064115 3300005441 Bacteria 2326
34 Ga0070694_100142118 3300005444 Bacteria 1744
35 Ga0070663_100015246 3300005455 Bacteria 4956
36 Ga0070663_100060510 3300005455 Bacteria 2724
37 Ga0070678_100000296 3300005456 Bacteria 23040
38 Ga0070678_100054754 3300005456 Bacteria 2909
39 Ga0070678_100107694 3300005456 Bacteria 2174
40 Ga0068867_100000490 3300005459 Bacteria 26410
41 Ga0070685_10051066 3300005466 Bacteria 2391
42 Ga0070685_10093107 3300005466 Bacteria 1827
43 Ga0068853_100009987 3300005539 Bacteria 7665
44 Ga0068853_100019313 3300005539 Bacteria 5650
45 Ga0068853_100220560 3300005539 Bacteria 1732
46 Ga0070672_100070853 3300005543 Bacteria 2771
47 Ga0070686_100036332 3300005544 Bacteria 3050
48 Ga0070686_100067788 3300005544 Bacteria 2326
49 Ga0070695_100013373 3300005545 Bacteria 4931
50 Ga0070696_100046059 3300005546 Bacteria 3023
51 Ga0070665_100028202 3300005548 Bacteria 5654
52 Ga0070665_100138274 3300005548 Bacteria 2439
53 Ga0070704_100039560 3300005549 Bacteria 3238
54 Ga0068854_100030298 3300005578 Bacteria 3752
55 Ga0068854_100172617 3300005578 Bacteria 1683
56 Ga0068856_100075634 3300005614 Bacteria 3336
57 Ga0070702_100004813 3300005615 Bacteria 6205
58 Ga0068852_100129897 3300005616 Bacteria 2319
59 Ga0068852_100202319 3300005616 Bacteria 1880
60 Ga0068859_100009024 3300005617 Bacteria 10072
61 Ga0068859_100017514 3300005617 Bacteria 7202
62 Ga0068866_10013085 3300005718 Bacteria 3630
63 Ga0068861_100006996 3300005719 Bacteria 7708
64 Ga0068861_100152661 3300005719 Bacteria 1896
65 Ga0068861_100178958 3300005719 Bacteria 1763
66 Ga0068863_100000821 3300005841 Bacteria 31118
67 Ga0068863_100005695 3300005841 Bacteria 12234
68 Ga0068863_100096877 3300005841 Bacteria 2801
69 Ga0068858_100001766 3300005842 Bacteria 22051
70 Ga0068858_100146512 3300005842 Bacteria 2217
71 Ga0068860_100000163 3300005843 Bacteria 108836
72 Ga0068860_100004769 3300005843 Bacteria 13817
73 Ga0068862_100000089 3300005844 Bacteria 109047
74 Ga0068862_100019304 3300005844 Bacteria 5688
75 Ga0081455_10098415 3300005937 Bacteria 2355
76 Ga0075365_10001439 3300006038 Bacteria 10783
77 Ga0075365_10053620 3300006038 Bacteria 2671
78 Ga0075365_10054049 3300006038 Bacteria 2662
79 Ga0075368_10029667 3300006042 Bacteria 2115
80 Ga0075363_100004300 3300006048 Bacteria 6199
81 Ga0075364_10000497 3300006051 Bacteria 19965
82 Ga0075364_10005945 3300006051 Bacteria 7135
83 Ga0075364_10028382 3300006051 Bacteria 3582
84 Ga0075364_10030414 3300006051 Bacteria 3465
85 Ga0075364_10050684 3300006051 Bacteria 2710
86 Ga0075364_10091664 3300006051 Bacteria 2016
87 Ga0075364_10095755 3300006051 Bacteria 1974
88 Ga0070712_100006573 3300006175 Bacteria 7219
89 Ga0075362_10035734 3300006177 Bacteria 2171
90 Ga0075367_10001108 3300006178 Bacteria 11157
91 Ga0075367_10142749 3300006178 Bacteria 1484
92 Ga0075369_10000627 3300006186 Bacteria 11206
93 Ga0075369_10002357 3300006186 Bacteria 6731
94 Ga0075370_10016963 3300006353 Bacteria 3927
95 Ga0075370_10048516 3300006353 Bacteria 2405
96 Ga0075370_10055379 3300006353 Bacteria 2253
97 Ga0068871_100057371 3300006358 Bacteria 3167
98 Ga0075428_100002524 3300006844 Bacteria 19896
99 Ga0075430_100033934 3300006846 Bacteria 4330
100 Ga0075431_100096143 3300006847 Bacteria 3058
101 Ga0068865_100058771 3300006881 Bacteria 2687
102 Ga0097620_100009021 3300006931 Bacteria 10072
103 Ga0097620_100017513 3300006931 Bacteria 7202
104 Ga0105250_10079927 3300009092 Bacteria 1325
105 Ga0105245_10011834 3300009098 Bacteria 7589
106 Ga0105245_10182991 3300009098 Bacteria 2003
107 Ga0105247_10000089 3300009101 Bacteria 98925
108 Ga0105247_10000256 3300009101 Bacteria 49229
109 Ga0105243_10101189 3300009148 Bacteria 2392
110 Ga0105243_10284546 3300009148 Bacteria 1491
111 Ga0105242_10047125 3300009176 Bacteria 3499
112 Ga0105248_10000183 3300009177 Bacteria 72792
113 Ga0105248_10053402 3300009177 Bacteria 4535
114 Ga0105248_10079029 3300009177 Bacteria 3697
115 Ga0105237_10000178 3300009545 Bacteria 89960
116 Ga0105237_10005032 3300009545 Bacteria 15049
117 Ga0105237_10329945 3300009545 Bacteria 1530
118 Ga0105238_10191455 3300009551 Bacteria 2021
119 Ga0105238_10428845 3300009551 Bacteria 1318
120 Ga0105249_10000117 3300009553 Bacteria 108322
121 Ga0105249_10020022 3300009553 Bacteria 5975
122 Ga0105249_10099189 3300009553 Bacteria 2737
123 Ga0099796_10007406 3300010159 Bacteria 2868
124 Ga0105239_10005914 3300010375 Bacteria 14250
125 Ga0105239_10009352 3300010375 Bacteria 11062
126 Ga0105239_10021599 3300010375 Bacteria 7098
127 Ga0105239_10064574 3300010375 Bacteria 4018
128 Ga0105239_10242598 3300010375 Bacteria 2022
129 Ga0105246_10161122 3300011119 Bacteria 1709
130 Ga0157374_10034828 3300013296 Bacteria 4603
131 Ga0157378_10097356 3300013297 Bacteria 2681
132 Ga0163162_10061292 3300013306 Bacteria 3799
133 Ga0163162_10075610 3300013306 Bacteria 3429
134 Ga0163162_10129126 3300013306 Bacteria 2636
135 Ga0157372_10147046 3300013307 Bacteria 2718
136 Ga0157375_10124859 3300013308 Bacteria 2687
137 Ga0157375_10144260 3300013308 Bacteria 2510
138 Ga0157380_10006155 3300014326 Bacteria 8416
139 Ga0157380_10156454 3300014326 Bacteria 1976
140 Ga0157379_10016363 3300014968 Bacteria 6524
141 Ga0157376_10331368 3300014969 Bacteria 1450
142 Ga0163161_10019863 3300017792 Bacteria 4713
143 Ga0213875_10028941 3300021388 Bacteria 2627
144 Ga0209051_1000014 3300025303 Bacteria 552732
145 Ga0209051_1000865 3300025303 Bacteria 30711
146 Ga0209051_1001402 3300025303 Bacteria 20758
147 Ga0209051_1002403 3300025303 Bacteria 13468
148 Ga0209051_1031624 3300025303 Bacteria 2032
149 Ga0207692_10004744 3300025898 Bacteria 5401
150 Ga0207642_10001523 3300025899 Bacteria 7129
151 Ga0207642_10055056 3300025899 Bacteria 1817
152 Ga0207710_10000117 3300025900 Bacteria 98934
153 Ga0207710_10011497 3300025900 Bacteria 3726
154 Ga0207688_10001028 3300025901 Bacteria 14271
155 Ga0207688_10008889 3300025901 Bacteria 5466
156 Ga0207688_10063448 3300025901 Bacteria 2084
157 Ga0207647_10062261 3300025904 Bacteria 2274
158 Ga0207647_10067975 3300025904 Bacteria 2158
159 Ga0207685_10015745 3300025905 Bacteria 2403
160 Ga0207643_10082957 3300025908 Bacteria 1859
161 Ga0207671_10013503 3300025914 Bacteria 6501
162 Ga0207671_10027780 3300025914 Bacteria 4230
163 Ga0207693_10001486 3300025915 Bacteria 20708
164 Ga0207663_10053898 3300025916 Bacteria 2515
165 Ga0207663_10063427 3300025916 Bacteria 2353
166 Ga0207681_10106038 3300025923 Bacteria 2036
167 Ga0207687_10000262 3300025927 Bacteria 35881
168 Ga0207687_10160463 3300025927 Bacteria 1725
169 Ga0207644_10004466 3300025931 Bacteria 9084
170 Ga0207706_10022704 3300025933 Bacteria 5631
171 Ga0207706_10119069 3300025933 Bacteria 2322
172 Ga0207686_10007671 3300025934 Bacteria 5817
173 Ga0207709_10005446 3300025935 Bacteria 7232
174 Ga0207669_10000512 3300025937 Bacteria 16936
175 Ga0207704_10015000 3300025938 Bacteria 3935
176 Ga0207704_10048262 3300025938 Bacteria 2551
177 Ga0207665_10000773 3300025939 Bacteria 21554
178 Ga0207665_10055214 3300025939 Bacteria 2679
179 Ga0207691_10055547 3300025940 Bacteria 3608
180 Ga0207711_10000096 3300025941 Bacteria 93552
181 Ga0207689_10048493 3300025942 Bacteria 3503
182 Ga0207712_10000083 3300025961 Bacteria 108319
183 Ga0207712_10014889 3300025961 Bacteria 5008
184 Ga0207712_10070679 3300025961 Bacteria 2508
185 Ga0207668_10000174 3300025972 Bacteria 43732
186 Ga0207668_10045308 3300025972 Bacteria 2999
187 Ga0207640_10001283 3300025981 Bacteria 13661
188 Ga0207658_10000085 3300025986 Bacteria 104042
189 Ga0207658_10001419 3300025986 Bacteria 18686
190 Ga0207658_10019947 3300025986 Bacteria 4639
191 Ga0207677_10100744 3300026023 Bacteria 2125
192 Ga0207703_10064757 3300026035 Bacteria 3001
193 Ga0207703_10113443 3300026035 Bacteria 2316
194 Ga0207678_10005755 3300026067 Bacteria 11054
195 Ga0207678_10012362 3300026067 Bacteria 7493
196 Ga0207678_10186066 3300026067 Bacteria 1774
197 Ga0207708_10037084 3300026075 Bacteria 3713
198 Ga0207708_10081964 3300026075 Bacteria 2480
199 Ga0207702_10070710 3300026078 Bacteria 3002
200 Ga0207641_10000762 3300026088 Bacteria 34691
201 Ga0207641_10014222 3300026088 Bacteria 6521
202 Ga0207648_10000677 3300026089 Bacteria 38214
203 Ga0207676_10053332 3300026095 Bacteria 3165
204 Ga0207675_100000092 3300026118 Bacteria 70351
205 Ga0207675_100223730 3300026118 Bacteria 1814
206 Ga0207683_10000319 3300026121 Bacteria 43887
207 Ga0207683_10059559 3300026121 Bacteria 3354
208 Ga0207683_10093344 3300026121 Bacteria 2682
209 Ga0268266_10006785 3300028379 Bacteria 10437
210 Ga0268266_10032690 3300028379 Bacteria 4420
211 Ga0268266_10097483 3300028379 Bacteria 2586
212 Ga0268265_10000099 3300028380 Bacteria 109591
213 Ga0268265_10025530 3300028380 Bacteria 4196
214 Ga0268264_10000225 3300028381 Bacteria 109852
215 Ga0265327_10000363 3300031251 Bacteria 86525
216 Ga0265327_10000718 3300031251 Bacteria 52146
217 Ga0307405_10024912 3300031731 Bacteria 3427
218 Ga0307410_10035760 3300031852 Bacteria 3229
219 Ga0307406_10043803 3300031901 Bacteria 2801
220 Ga0307406_10110831 3300031901 Bacteria 1889
221 Ga0307416_100073896 3300032002 Bacteria 2845
222 Ga0307411_10031943 3300032005 Bacteria 3247
223 Ga0307415_100113778 3300032126 Bacteria 2013
224 Ga0373931_0008757 3300035691 Bacteria 4816
225 Ga0316584_0113890 3300036712 Bacteria 2023
226 Ga0436364_1009445 3300037853 Bacteria 41017
227 Ga0436363_0816874 3300039450 Bacteria 2509
228 Ga0436362_0161674 3300039453 Bacteria 1361
229 Ga0439461_0001011 3300041410 Bacteria 4228
230 Ga0439461_0002056 3300041410 Bacteria 3185
231 Ga0439466_0001930 3300041411 Bacteria 8139
232 Ga0439466_0004549 3300041411 Bacteria 5328
233 Ga0439465_0000161 3300041413 Bacteria 16901
234 Ga0439465_0001028 3300041413 Bacteria 8880
235 Ga0439465_0002802 3300041413 Bacteria 5712
236 Ga0439465_0012474 3300041413 Bacteria 2656
237 Ga0451802_0702805 3300041460 Bacteria 2380
238 Ga0439431_0017921 3300041997 Bacteria 1670
239 Ga0439445_0003402 3300042004 Bacteria 3568
240 Ga0439445_0009221 3300042004 Bacteria 2322
241 Ga0439434_0007650 3300042435 Bacteria 3165
242 Ga0466972_0027569 3300044658 Bacteria 2809
243 Ga0466972_0034184 3300044658 Bacteria 2492
244 Ga0466965_0003534 3300044683 Bacteria 6870
245 Ga0466961_0076552 3300044693 Bacteria 2120
246 Ga0466968_0024317 3300044735 Bacteria 2473
247 Ga0466970_0009608 3300044765 Bacteria 4893
248 Ga0466957_0032108 3300044842 Bacteria 3142
249 Ga0466960_0000607 3300044901 Bacteria 12375
250 Ga0466960_0002665 3300044901 Bacteria 6736
251 Ga0466967_0020947 3300045976 Bacteria 5297
252 Ga0466967_0023926 3300045976 Bacteria 5014
253 Ga0466967_0300458 3300045976 Bacteria 1544
254 Ga0495638_0000303 3300046460 Bacteria 63516
255 Ga0495606_0087195 3300046507 Bacteria 1927
256 Ga0495648_0003638 3300046524 Bacteria 13476
257 Ga0495640_0028257 3300046533 Bacteria 4039
258 Ga0495640_0081504 3300046533 Bacteria 2151
259 Ga0495668_0034139 3300046616 Bacteria 2856
260 Ga0495611_0041075 3300046648 Bacteria 2063
261 Ga0495671_0114018 3300046692 Bacteria 1320
262 Ga0495672_0021975 3300047320 Bacteria 4155
263 Ga0495676_0089646 3300047321 Bacteria 2304
264 Ga0495673_0002285 3300047469 Bacteria 13733
265 Ga0495686_0010911 3300047472 Bacteria 6432
266 Ga0495593_0003906 3300047673 Bacteria 8906
267 Ga0496100_0000087 3300048903 Bacteria 52650
268 Ga0496100_0010004 3300048903 Bacteria 5355
269 Ga0496100_0043266 3300048903 Bacteria 2880
270 Ga0496100_0184990 3300048903 Bacteria 1509
271 Ga0496101_0000034 3300048904 Bacteria 178045
272 Ga0496101_0002154 3300048904 Bacteria 12022
273 Ga0496101_0004411 3300048904 Bacteria 8849
274 Ga0496101_0061237 3300048904 Bacteria 2733
275 Ga0496102_0000180 3300048905 Bacteria 85998
276 Ga0496102_0005125 3300048905 Bacteria 11109
277 Ga0496102_0007220 3300048905 Bacteria 9481
278 Ga0496102_0007745 3300048905 Bacteria 9176
279 Ga0496103_0000007 3300048906 Bacteria 354915
280 Ga0496103_0000334 3300048906 Bacteria 43011
281 Ga0496103_0005953 3300048906 Bacteria 7291
282 Ga0496103_0029636 3300048906 Bacteria 3326
283 Ga0496103_0047476 3300048906 Bacteria 2653
284 Ga0496104_0005544 3300048907 Bacteria 11052
285 Ga0496104_0028062 3300048907 Bacteria 5214
286 Ga0496105_0072444 3300048908 Bacteria 2847
287 Ga0496105_0109138 3300048908 Bacteria 2285
288 Ga0496105_0142461 3300048908 Bacteria 1972
289 Ga0496106_0001266 3300048909 Bacteria 18926
290 Ga0496106_0007094 3300048909 Bacteria 8281
291 Ga0496106_0009242 3300048909 Bacteria 7284
292 Ga0496106_0103083 3300048909 Bacteria 2214
293 Ga0496106_0213950 3300048909 Bacteria 1536
294 Ga0496107_0000108 3300048910 Bacteria 40403
295 Ga0496107_0022068 3300048910 Bacteria 4497
296 Ga0496107_0030169 3300048910 Bacteria 3864
297 Ga0496107_0073443 3300048910 Bacteria 2488
298 Ga0496107_0088728 3300048910 Bacteria 2257
299 Ga0496108_0026051 3300048911 Bacteria 4823
300 Ga0496108_0150696 3300048911 Bacteria 2006
301 Ga0496108_0197288 3300048911 Bacteria 1746
302 Ga0496109_0000127 3300048912 Bacteria 77905
303 Ga0496109_0027416 3300048912 Bacteria 5085
304 Ga0496109_0038466 3300048912 Bacteria 4325
305 Ga0496109_0068303 3300048912 Bacteria 3258
306 Ga0496110_0000632 3300048913 Bacteria 24071
307 Ga0496110_0106487 3300048913 Bacteria 2516
308 Ga0496111_0014263 3300048914 Bacteria 5424
309 Ga0496111_0091222 3300048914 Bacteria 2233
310 Ga0496111_0152360 3300048914 Bacteria 1715
311 Ga0496112_0013873 3300048915 Bacteria 7454
312 Ga0496112_0031389 3300048915 Bacteria 5153
313 Ga0496112_0047292 3300048915 Bacteria 4220
314 Ga0496112_0047548 3300048915 Bacteria 4209
315 Ga0496112_0141830 3300048915 Bacteria 2372
316 Ga0496113_0011960 3300048916 Bacteria 5817
317 Ga0496113_0041223 3300048916 Bacteria 3406
318 Ga0496113_0115943 3300048916 Bacteria 2090
319 Ga0496114_0000123 3300048917 Bacteria 56062
320 Ga0496114_0000196 3300048917 Bacteria 43970
321 Ga0496114_0001176 3300048917 Bacteria 19820
322 Ga0496114_0188987 3300048917 Bacteria 1801
323 Ga0496115_0001791 3300048918 Bacteria 15389
324 Ga0496115_0044033 3300048918 Bacteria 3559
325 Ga0496115_0045159 3300048918 Bacteria 3517
326 Ga0496115_0164094 3300048918 Bacteria 1837
327 Ga0496116_0000018 3300048919 Bacteria 545877
328 Ga0496116_0004626 3300048919 Bacteria 13036
329 Ga0496117_0000015 3300048920 Bacteria 583316
330 Ga0496117_0000508 3300048920 Bacteria 64302
331 Ga0496117_0022600 3300048920 Bacteria 5040
332 Ga0496118_0000012 3300048921 Bacteria 583316
333 Ga0496118_0000415 3300048921 Bacteria 71044
334 Ga0496118_0012406 3300048921 Bacteria 8184
335 Ga0496119_0000551 3300048922 Bacteria 51087
336 Ga0496119_0007860 3300048922 Bacteria 9498
337 Ga0496120_0000155 3300048923 Bacteria 114046
338 Ga0496120_0017569 3300048923 Bacteria 4630
339 Ga0496120_0021104 3300048923 Bacteria 4121
340 Ga0496120_0063030 3300048923 Bacteria 2064
341 Ga0496121_0000048 3300048924 Bacteria 330242
342 Ga0496121_0003445 3300048924 Bacteria 22596
343 Ga0496121_0004132 3300048924 Bacteria 19872
344 Ga0496121_0240498 3300048924 Bacteria 1262
345 Ga0496122_0002047 3300048925 Bacteria 29932
346 Ga0496123_0006011 3300048926 Bacteria 11939
347 Ga0496123_0015438 3300048926 Bacteria 6263
348 Ga0496124_0000044 3300048927 Bacteria 289064
349 Ga0496125_0000037 3300048928 Bacteria 330242
350 Ga0496125_0010868 3300048928 Bacteria 9160
351 Ga0496126_0000046 3300048929 Bacteria 330242
352 Ga0496126_0001113 3300048929 Bacteria 45012
353 Ga0496126_0008405 3300048929 Bacteria 11139
354 Ga0496126_0059280 3300048929 Bacteria 3447
355 Ga0496126_0193936 3300048929 Bacteria 1719
356 Ga0501032_0002384 3300049569 Bacteria 14666
357 Ga0501034_0013510 3300049571 Bacteria 8404
358 Ga0501036_0024273 3300049572 Bacteria 5111
359 Ga0501037_0001507 3300049573 Bacteria 17018
360 Ga0501038_0028953 3300049574 Bacteria 4914
361 Ga0501039_0000312 3300049575 Bacteria 34396
362 Ga0501043_0003966 3300049579 Bacteria 12125
363 Ga0501067_0104961 3300049583 Bacteria 1570
364 Ga0501070_0008107 3300049586 Bacteria 8891
365 Ga0501070_0060136 3300049586 Bacteria 3150
366 Ga0501073_0045719 3300049589 Bacteria 3083
367 Ga0501079_0261795 3300049741 Bacteria 1352
368 Ga0501080_0051235 3300049742 Bacteria 3841
369 Ga0501044_0012905 3300049823 Bacteria 9043
370 Ga0501044_0138342 3300049823 Bacteria 2424
371 nmdc:mga03n38_5142_c1 3300050490 Bacteria 4422
372 nmdc:mga03n38_5282_c1 3300050490 Bacteria 4381
373 nmdc:mga03n38_6481_c1 3300050490 Bacteria 4070
374 nmdc:mga00v17_1500_c1 3300050491 Bacteria 12189
375 nmdc:mga00v17_43095_c1 3300050491 Bacteria 2716
376 nmdc:mga00v17_48845_c1 3300050491 Bacteria 2565
377 nmdc:mga00v17_50365_c1 3300050491 Bacteria 2530
378 nmdc:mga00v17_790_c1 3300050491 Bacteria 17237
379 nmdc:mga00v17_81220_c1 3300050491 Bacteria 2024
380 nmdc:mga0yw44_16835_c1 3300050492 Bacteria 3961
381 nmdc:mga0yw44_17452_c1 3300050492 Bacteria 3497
382 nmdc:mga0yw44_27569_c1 3300050492 Bacteria 3255
383 nmdc:mga0yw44_40837_c1 3300050492 Bacteria 2468
384 nmdc:mga06z11_25793_c1 3300050494 Bacteria 2790
385 nmdc:mga07m45_27460_c1 3300050496 Bacteria 3136
386 nmdc:mga07m45_35315_c1 3300050496 Bacteria 2780
387 nmdc:mga07m45_6803_c1 3300050496 Bacteria 5808
388 nmdc:mga0qj67_19076_c1 3300050509 Bacteria 5236
389 nmdc:mga06r32_68898_c1 3300050510 Bacteria 3418
390 nmdc:mga0sz30_23611_c1 3300050516 Bacteria 2504
391 nmdc:mga0sz30_46005_c1 3300050516 Bacteria 1841
392 nmdc:mga0sz30_5558_c1 3300050516 Bacteria 4631
393 nmdc:mga0sz30_9953_c1 3300050516 Bacteria 3632
394 Ga0500610_0009717 3300053079 Bacteria 4282
395 Ga0500635_0002900 3300053080 Bacteria 4267
396 Ga0495655_0005980 3300053083 Bacteria 2184
397 Ga0500643_014648 3300053087 Bacteria 2715
398 Ga0500556_0011130 3300053104 Bacteria 2657
399 Ga0500562_001911 3300053108 Bacteria 5222
400 Ga0500652_003204 3300053131 Bacteria 4947
401 Ga0500652_003999 3300053131 Bacteria 4513
402 Ga0500568_0023166 3300053139 Bacteria 2644
403 Ga0500616_0015501 3300053153 Bacteria 4356
404 Ga0500616_0021339 3300053153 Bacteria 3633
405 Ga0500645_000004 3300053730 Bacteria 305014
406 Ga0500645_017853 3300053730 Bacteria 2220
407 2644488302 2643221687 Bacteria 6500351
408 2644640014 2643221715 Bacteria 6671032
409 2738663803 2738541264 Bacteria 5935393
410 2738703147 2738541274 Bacteria 6909446
411 2739142938 2738541356 Bacteria 5935017
412 2739329388 2738543028 Bacteria 6917070
413 2842136135 2842134933 Bacteria 5847019
414 2902795217 2902792274 Bacteria 7270173
415 2902800442 2902799365 Bacteria 5419524
416 2902811585 2902810491 Bacteria 6794147
417 2902841394 2902837492 Bacteria 6697721
418 2929218477 2929212328 Bacteria 7708288
419 2939583674 2939582691 Bacteria 7088898
420 Ga0496101_0009036
421 JGI24746J21847_1002200
422 JGI24744J21845_10002139
423 JGI24744J21845_10003841
424 JGI24744J21845_10005635
425 JGI24744J21845_10005722
426 JGI24751J29686_10003627
427 Ga0055540_1000038
428 Ga0055540_1003730
429 Ga0055540_1003872
430 Ga0070690_100001324
431 Ga0070666_10045388
432 Ga0070682_100003462
433 Ga0068868_100001506
434 Ga0070689_100009946
435 Ga0070691_10025818
436 Ga0070687_100052278
437 Ga0070668_100000647
438 Ga0070668_100000685
439 Ga0070668_100230941
440 Ga0070669_100001291
441 Ga0070671_100005694
442 Ga0070674_100059042
443 Ga0070674_100089721
444 Ga0070667_100000099
445 Ga0070667_100000883
446 Ga0070667_100016635
447 Ga0070710_10002875
448 Ga0070701_10005856
449 Ga0070711_100057885
450 Ga0070711_100058671
451 Ga0070700_100004265
452 Ga0070700_100064115
453 Ga0070694_100142118
454 Ga0070663_100015246
455 Ga0070663_100060510
456 Ga0070678_100000296
457 Ga0070678_100054754
458 Ga0070678_100107694
459 Ga0068867_100000490
460 Ga0070685_10051066
461 Ga0070685_10093107
462 Ga0068853_100009987
463 Ga0068853_100019313
464 Ga0068853_100220560
465 Ga0070672_100070853
466 Ga0070686_100036332
467 Ga0070686_100067788
468 Ga0070695_100013373
469 Ga0070696_100046059
470 Ga0070665_100028202
471 Ga0070665_100138274
472 Ga0070704_100039560
473 Ga0068854_100030298
474 Ga0068854_100172617
475 Ga0068856_100075634
476 Ga0070702_100004813
477 Ga0068852_100129897
478 Ga0068852_100202319
479 Ga0068859_100009024
480 Ga0068859_100017514
481 Ga0068866_10013085
482 Ga0068861_100006996
483 Ga0068861_100152661
484 Ga0068861_100178958
485 Ga0068863_100000821
486 Ga0068863_100005695
487 Ga0068863_100096877
488 Ga0068858_100001766
489 Ga0068858_100146512
490 Ga0068860_100000163
491 Ga0068860_100004769
492 Ga0068862_100000089
493 Ga0068862_100019304
494 Ga0081455_10098415
495 Ga0075365_10001439
496 Ga0075365_10053620
497 Ga0075365_10054049
498 Ga0075368_10029667
499 Ga0075363_100004300
500 Ga0075364_10000497
501 Ga0075364_10005945
502 Ga0075364_10028382
503 Ga0075364_10030414
504 Ga0075364_10050684
505 Ga0075364_10091664
506 Ga0075364_10095755
507 Ga0070712_100006573
508 Ga0075362_10035734
509 Ga0075367_10001108
510 Ga0075367_10142749
511 Ga0075369_10000627
512 Ga0075369_10002357
513 Ga0075370_10016963
514 Ga0075370_10048516
515 Ga0075370_10055379
516 Ga0068871_100057371
517 Ga0075428_100002524
518 Ga0075430_100033934
519 Ga0075431_100096143
520 Ga0068865_100058771
521 Ga0097620_100009021
522 Ga0097620_100017513
523 Ga0105250_10079927
524 Ga0105245_10011834
525 Ga0105245_10182991
526 Ga0105247_10000089
527 Ga0105247_10000256
528 Ga0105243_10101189
529 Ga0105243_10284546
530 Ga0105242_10047125
531 Ga0105248_10000183
532 Ga0105248_10053402
533 Ga0105248_10079029
534 Ga0105237_10000178
535 Ga0105237_10005032
536 Ga0105237_10329945
537 Ga0105238_10191455
538 Ga0105238_10428845
539 Ga0105249_10000117
540 Ga0105249_10020022
541 Ga0105249_10099189
542 Ga0099796_10007406
543 Ga0105239_10005914
544 Ga0105239_10009352
545 Ga0105239_10021599
546 Ga0105239_10064574
547 Ga0105239_10242598
548 Ga0105246_10161122
549 Ga0157374_10034828
550 Ga0157378_10097356
551 Ga0163162_10061292
552 Ga0163162_10075610
553 Ga0163162_10129126
554 Ga0157372_10147046
555 Ga0157375_10124859
556 Ga0157375_10144260
557 Ga0157380_10006155
558 Ga0157380_10156454
559 Ga0157379_10016363
560 Ga0157376_10331368
561 Ga0163161_10019863
562 Ga0213875_10028941
563 Ga0209051_1000014
564 Ga0209051_1000865
565 Ga0209051_1001402
566 Ga0209051_1002403
567 Ga0209051_1031624
568 Ga0207692_10004744
569 Ga0207642_10001523
570 Ga0207642_10055056
571 Ga0207710_10000117
572 Ga0207710_10011497
573 Ga0207688_10001028
574 Ga0207688_10008889
575 Ga0207688_10063448
576 Ga0207647_10062261
577 Ga0207647_10067975
578 Ga0207685_10015745
579 Ga0207643_10082957
580 Ga0207671_10013503
581 Ga0207671_10027780
582 Ga0207693_10001486
583 Ga0207663_10053898
584 Ga0207663_10063427
585 Ga0207681_10106038
586 Ga0207687_10000262
587 Ga0207687_10160463
588 Ga0207644_10004466
589 Ga0207706_10022704
590 Ga0207706_10119069
591 Ga0207686_10007671
592 Ga0207709_10005446
593 Ga0207669_10000512
594 Ga0207704_10015000
595 Ga0207704_10048262
596 Ga0207665_10000773
597 Ga0207665_10055214
598 Ga0207691_10055547
599 Ga0207711_10000096
600 Ga0207689_10048493
601 Ga0207712_10000083
602 Ga0207712_10014889
603 Ga0207712_10070679
604 Ga0207668_10000174
605 Ga0207668_10045308
606 Ga0207640_10001283
607 Ga0207658_10000085
608 Ga0207658_10001419
609 Ga0207658_10019947
610 Ga0207677_10100744
611 Ga0207703_10064757
612 Ga0207703_10113443
613 Ga0207678_10005755
614 Ga0207678_10012362
615 Ga0207678_10186066
616 Ga0207708_10037084
617 Ga0207708_10081964
618 Ga0207702_10070710
619 Ga0207641_10000762
620 Ga0207641_10014222
621 Ga0207648_10000677
622 Ga0207676_10053332
623 Ga0207675_100000092
624 Ga0207675_100223730
625 Ga0207683_10000319
626 Ga0207683_10059559
627 Ga0207683_10093344
628 Ga0268266_10006785
629 Ga0268266_10032690
630 Ga0268266_10097483
631 Ga0268265_10000099
632 Ga0268265_10025530
633 Ga0268264_10000225
634 Ga0265327_10000363
635 Ga0265327_10000718
636 Ga0307405_10024912
637 Ga0307410_10035760
638 Ga0307406_10043803
639 Ga0307406_10110831
640 Ga0307416_100073896
641 Ga0307411_10031943
642 Ga0307415_100113778
643 Ga0373931_0008757
644 Ga0316584_0113890
645 Ga0436364_1009445
646 Ga0436363_0816874
647 Ga0436362_0161674
648 Ga0439461_0001011
649 Ga0439461_0002056
650 Ga0439466_0001930
651 Ga0439466_0004549
652 Ga0439465_0000161
653 Ga0439465_0001028
654 Ga0439465_0002802
655 Ga0439465_0012474
656 Ga0451802_0702805
657 Ga0439431_0017921
658 Ga0439445_0003402
659 Ga0439445_0009221
660 Ga0439434_0007650
661 Ga0466972_0027569
662 Ga0466972_0034184
663 Ga0466965_0003534
664 Ga0466961_0076552
665 Ga0466968_0024317
666 Ga0466970_0009608
667 Ga0466957_0032108
668 Ga0466960_0000607
669 Ga0466960_0002665
670 Ga0466967_0020947
671 Ga0466967_0023926
672 Ga0466967_0300458
673 Ga0495638_0000303
674 Ga0495606_0087195
675 Ga0495648_0003638
676 Ga0495640_0028257
677 Ga0495640_0081504
678 Ga0495668_0034139
679 Ga0495611_0041075
680 Ga0495671_0114018
681 Ga0495672_0021975
682 Ga0495676_0089646
683 Ga0495673_0002285
684 Ga0495686_0010911
685 Ga0495593_0003906
686 Ga0496100_0000087
687 Ga0496100_0010004
688 Ga0496100_0043266
689 Ga0496100_0184990
690 Ga0496101_0000034
691 Ga0496101_0002154
692 Ga0496101_0004411
693 Ga0496101_0061237
694 Ga0496102_0000180
695 Ga0496102_0005125
696 Ga0496102_0007220
697 Ga0496102_0007745
698 Ga0496103_0000007
699 Ga0496103_0000334
700 Ga0496103_0005953
701 Ga0496103_0029636
702 Ga0496103_0047476
703 Ga0496104_0005544
704 Ga0496104_0028062
705 Ga0496105_0072444
706 Ga0496105_0109138
707 Ga0496105_0142461
708 Ga0496106_0001266
709 Ga0496106_0007094
710 Ga0496106_0009242
711 Ga0496106_0103083
712 Ga0496106_0213950
713 Ga0496107_0000108
714 Ga0496107_0022068
715 Ga0496107_0030169
716 Ga0496107_0073443
717 Ga0496107_0088728
718 Ga0496108_0026051
719 Ga0496108_0150696
720 Ga0496108_0197288
721 Ga0496109_0000127
722 Ga0496109_0027416
723 Ga0496109_0038466
724 Ga0496109_0068303
725 Ga0496110_0000632
726 Ga0496110_0106487
727 Ga0496111_0014263
728 Ga0496111_0091222
729 Ga0496111_0152360
730 Ga0496112_0013873
731 Ga0496112_0031389
732 Ga0496112_0047292
733 Ga0496112_0047548
734 Ga0496112_0141830
735 Ga0496113_0011960
736 Ga0496113_0041223
737 Ga0496113_0115943
738 Ga0496114_0000123
739 Ga0496114_0000196
740 Ga0496114_0001176
741 Ga0496114_0188987
742 Ga0496115_0001791
743 Ga0496115_0044033
744 Ga0496115_0045159
745 Ga0496115_0164094
746 Ga0496116_0000018
747 Ga0496116_0004626
748 Ga0496117_0000015
749 Ga0496117_0000508
750 Ga0496117_0022600
751 Ga0496118_0000012
752 Ga0496118_0000415
753 Ga0496118_0012406
754 Ga0496119_0000551
755 Ga0496119_0007860
756 Ga0496120_0000155
757 Ga0496120_0017569
758 Ga0496120_0021104
759 Ga0496120_0063030
760 Ga0496121_0000048
761 Ga0496121_0003445
762 Ga0496121_0004132
763 Ga0496121_0240498
764 Ga0496122_0002047
765 Ga0496123_0006011
766 Ga0496123_0015438
767 Ga0496124_0000044
768 Ga0496125_0000037
769 Ga0496125_0010868
770 Ga0496126_0000046
771 Ga0496126_0001113
772 Ga0496126_0008405
773 Ga0496126_0059280
774 Ga0496126_0193936
775 Ga0501032_0002384
776 Ga0501034_0013510
777 Ga0501036_0024273
778 Ga0501037_0001507
779 Ga0501038_0028953
780 Ga0501039_0000312
781 Ga0501043_0003966
782 Ga0501067_0104961
783 Ga0501070_0008107
784 Ga0501070_0060136
785 Ga0501073_0045719
786 Ga0501079_0261795
787 Ga0501080_0051235
788 Ga0501044_0012905
789 Ga0501044_0138342
790 nmdc:mga03n38_5142_c1
791 nmdc:mga03n38_5282_c1
792 nmdc:mga03n38_6481_c1
793 nmdc:mga00v17_1500_c1
794 nmdc:mga00v17_43095_c1
795 nmdc:mga00v17_48845_c1
796 nmdc:mga00v17_50365_c1
797 nmdc:mga00v17_790_c1
798 nmdc:mga00v17_81220_c1
799 nmdc:mga0yw44_16835_c1
800 nmdc:mga0yw44_17452_c1
801 nmdc:mga0yw44_27569_c1
802 nmdc:mga0yw44_40837_c1
803 nmdc:mga06z11_25793_c1
804 nmdc:mga07m45_27460_c1
805 nmdc:mga07m45_35315_c1
806 nmdc:mga07m45_6803_c1
807 nmdc:mga0qj67_19076_c1
808 nmdc:mga06r32_68898_c1
809 nmdc:mga0sz30_23611_c1
810 nmdc:mga0sz30_46005_c1
811 nmdc:mga0sz30_5558_c1
812 nmdc:mga0sz30_9953_c1
813 Ga0500610_0009717
814 Ga0500635_0002900
815 Ga0495655_0005980
816 Ga0500643_014648
817 Ga0500556_0011130
818 Ga0500562_001911
819 Ga0500652_003204
820 Ga0500652_003999
821 Ga0500568_0023166
822 Ga0500616_0015501
823 Ga0500616_0021339
824 Ga0500645_000004
825 Ga0500645_017853
826 2644488302
827 2644640014
828 2738663803
829 2738703147
830 2739142938
831 2739329388
832 2842136135
833 2902795217
834 2902800442
835 2902811585
836 2902841394
837 2929218477
838 2939583674

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4or2-assembly1.cif.gz_A human class c g protein-coupled metabotropic glutamate receptor 1 in complex with a negative allosteric modulator 0.6395 2 233
7epd-assembly1.cif.gz_B cryo-em structure of inactive mglu2-7 heterodimer 0.6238 2 234
8t7h-assembly1.cif.gz_B quis-bound intermediate mglu5 0.6146 2 231
6uoa-assembly1.cif.gz_B human metabotropic gaba(b) receptor in its intermediate state 1 0.6143 7 237
4or2-assembly1.cif.gz_B human class c g protein-coupled metabotropic glutamate receptor 1 in complex with a negative allosteric modulator 0.61 2 227
ID Description Score Start End Superfamily
af_A0A0R0KAD7_54_246_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6246 5 205 1.20.1070.10
af_D3YU55_2_306_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6073 2 241 1.20.1070.10
af_Q18768_3_215_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6053 2 186 1.20.1070.10
af_F1QGP7_64_301_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6023 10 231 1.20.1070.10
af_P83119_218_478_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5986 5 227 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0R655-F1-model_v4 Uncharacterized protein 0.8377 1 386 GO:0016020
AF-A0R655-F1-model_v4 Uncharacterized protein 0.8087 1 386 GO:0016020
AF-A0A850DRT0-F1-model_v4 DUF5671 domain-containing protein 0.8032 8 266 GO:0016020
AF-A0A646J378-F1-model_v4 Uncharacterized protein 0.7991 7 159 GO:0016020
AF-A0A1P8X9E3-F1-model_v4 DUF4129 domain-containing protein 0.7861 1 386 GO:0016020

Map