F439095

General Info

Members Datasets Scaffolds Average Seq Length
417 359 834 211

Family's Representative Sequence

Representative Sequence 3300031911|Ga0307412_10000002|Ga0307412_10000002545
Length 244
Sequence MARDNECESSGDEAAALREPLSQPSRRRFLQSAAAAATVGAAPHLRAQTQAPVAPAAGTAQTVPPRPVTLNVNGRNYALQLEPRVTLLDALREYAGLMGTKKGCDRGQCGACTVIANGRRINSCLTLAAMHEGETITTVEGLASNGALSPLQRAFIEHDAFQCGYCTPGQLCSATALLEEFRNGTASVVTADIRRRPIKLSDDEIRERMSGNICRCGAYANIVAAIRAAHDGSGQNASAADVDA

Samples

Sample ID Description Type Environment
1 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
34 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
35 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
36 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
37 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
38 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
52 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
54 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
56 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
57 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
58 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
59 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
62 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
63 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
64 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
65 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
66 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
67 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
68 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
69 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
70 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
71 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
72 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
73 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
74 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
75 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
76 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
77 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
78 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
79 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
80 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
81 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
82 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
83 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
84 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
85 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
86 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
87 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
88 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
89 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
90 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
91 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
92 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
93 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
94 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
95 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
96 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
97 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
98 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
99 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
100 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
101 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
102 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
103 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
104 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
105 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
106 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
107 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
108 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
109 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
121 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
122 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
123 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
129 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
130 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
133 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
134 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
139 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
140 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
141 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
142 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
143 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
144 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
145 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
146 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
147 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
148 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
149 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
150 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
151 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
152 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
153 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
154 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
155 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
156 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
157 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
158 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
159 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
160 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
161 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
162 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
163 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
164 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
165 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
166 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
167 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
168 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
169 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
170 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
171 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
172 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
173 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
174 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
175 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
176 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
177 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
178 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
179 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
180 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
181 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
182 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
183 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
184 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
185 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
186 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
187 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
188 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
189 2902330777 Methylobacterium sp. 2A Isolate Unclassified
190 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
191 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
192 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
193 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
194 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
195 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
196 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
197 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
198 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
199 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
200 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
201 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
202 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
203 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
204 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
205 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
206 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
207 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
208 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
209 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
210 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
211 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
212 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
213 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
214 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
215 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
216 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
217 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
218 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
219 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
220 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
221 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
222 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
223 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
224 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
225 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
226 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
227 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
228 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
229 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
230 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
231 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
232 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
233 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
234 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
235 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
236 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
237 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
238 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
239 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
240 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
241 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
242 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
243 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
244 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
245 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
246 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
247 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
248 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
249 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
250 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
251 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
252 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
253 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
254 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
255 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
256 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
257 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
258 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
259 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
260 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
261 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
262 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
263 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
264 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
265 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
266 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
267 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
268 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
269 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
270 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
271 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
272 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
273 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
274 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
275 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
276 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
277 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
278 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
279 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
280 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
281 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
282 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
283 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
284 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
285 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
286 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
287 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
288 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
289 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
290 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
291 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
292 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
293 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
294 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
295 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
296 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
297 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
298 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
299 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
300 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
301 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
302 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
303 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
304 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
305 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
306 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
307 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
308 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
309 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
310 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
311 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
312 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
313 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
314 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
315 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
316 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
317 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
318 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
319 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
320 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
321 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
322 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
323 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
324 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
325 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
326 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
327 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
328 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
329 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
330 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
331 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
332 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
333 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
334 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
335 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
336 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
337 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
338 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
339 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
340 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
341 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
342 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
343 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
344 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
345 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
346 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
347 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
348 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
349 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
350 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
351 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
352 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
353 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
354 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
355 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
356 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
357 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
358 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
359 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 48.68
Metatranscriptomes 0
Isolates 51.32

Biome Distribution

Category Percentage (%)
Aerial Root 0.48
Bulb 0
Endosphere 3.6
Nodule 47.96
Rhizoplane 2.88
Rhizosphere 41.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307412_10000002 3300031911 Bacteria 743446
2 JGI24737J22298_10006231 3300001990 Bacteria 4084
3 JGI24735J21928_10008432 3300002067 Bacteria 3331
4 JGI24735J21928_10019700 3300002067 Bacteria 2072
5 Ga0058692_1000047 3300003856 Bacteria 112440
6 Ga0070676_10192971 3300005328 Bacteria 1331
7 Ga0070682_100188787 3300005337 Bacteria 1445
8 Ga0068868_100666067 3300005338 Bacteria 928
9 Ga0070660_100000445 3300005339 Bacteria 27517
10 Ga0070673_100326667 3300005364 Bacteria 1356
11 Ga0070673_100518337 3300005364 Bacteria 1080
12 Ga0070678_100664222 3300005456 Bacteria 936
13 Ga0070662_100481980 3300005457 Bacteria 1033
14 Ga0070706_100112438 3300005467 Bacteria 2535
15 Ga0070707_100002138 3300005468 Bacteria 18923
16 Ga0070699_100344500 3300005518 Bacteria 1342
17 Ga0070697_100087811 3300005536 Bacteria 2568
18 Ga0070697_100384605 3300005536 Bacteria 1216
19 Ga0070672_100812263 3300005543 Bacteria 823
20 Ga0068855_100012525 3300005563 Bacteria 10237
21 Ga0068856_100005626 3300005614 Bacteria 12330
22 Ga0068852_100667463 3300005616 Bacteria 1048
23 Ga0068863_100568947 3300005841 Bacteria 1120
24 Ga0081455_10077771 3300005937 Bacteria 2728
25 Ga0075364_10153000 3300006051 Bacteria 1555
26 Ga0070715_10156660 3300006163 Bacteria 1121
27 Ga0097621_100627846 3300006237 Bacteria 984
28 Ga0075370_10220042 3300006353 Bacteria 1122
29 Ga0075430_100000767 3300006846 Bacteria 24741
30 Ga0105251_10021983 3300009011 Bacteria 3320
31 Ga0114129_10340826 3300009147 Bacteria 1988
32 Ga0157371_10002009 3300013102 Bacteria 20097
33 Ga0157371_10252886 3300013102 Bacteria 1269
34 Ga0157369_10022608 3300013105 Bacteria 7013
35 Ga0157369_10457644 3300013105 Bacteria 1321
36 Ga0163162_10005585 3300013306 Bacteria 12166
37 Ga0157372_10106775 3300013307 Bacteria 3203
38 Ga0157372_10488639 3300013307 Bacteria 1435
39 Ga0183362_10002 3300015683 Bacteria 1432711
40 Ga0163161_10012872 3300017792 Bacteria 5814
41 Ga0228711_1024790 3300022739 Bacteria 4166
42 Ga0228710_1008201 3300022740 Bacteria 15068
43 Ga0209758_1002274 3300025297 Bacteria 19896
44 Ga0207647_10055222 3300025904 Bacteria 2441
45 Ga0207647_10126520 3300025904 Bacteria 1504
46 Ga0207705_10157134 3300025909 Bacteria 1706
47 Ga0207684_10228413 3300025910 Bacteria 1606
48 Ga0207684_10679264 3300025910 Bacteria 876
49 Ga0207654_10284298 3300025911 Bacteria 1120
50 Ga0207662_10365953 3300025918 Bacteria 971
51 Ga0207657_10000630 3300025919 Bacteria 37349
52 Ga0207652_10290723 3300025921 Bacteria 1474
53 Ga0207646_10005935 3300025922 Bacteria 12739
54 Ga0207706_10489647 3300025933 Bacteria 1062
55 Ga0207667_10056266 3300025949 Bacteria 4132
56 Ga0207667_10422672 3300025949 Bacteria 1356
57 Ga0207677_10642352 3300026023 Bacteria 936
58 Ga0207702_10015620 3300026078 Bacteria 6284
59 Ga0207641_10678729 3300026088 Bacteria 1013
60 Ga0209281_1000087 3300027111 Bacteria 246142
61 Ga0209371_1000148 3300027312 Bacteria 112568
62 Ga0209282_1000008 3300027666 Bacteria 248526
63 Ga0268266_10008805 3300028379 Bacteria 8938
64 Ga0307517_10187113 3300028786 Bacteria 1323
65 Ga0307515_10257639 3300028794 Bacteria 1486
66 Ga0268256_1000122 3300030500 Bacteria 112568
67 Ga0307405_10060714 3300031731 Bacteria 2387
68 Ga0315914_1000011 3300031967 Bacteria 170175
69 Ga0307416_100923408 3300032002 Bacteria 974
70 Ga0307510_10000233 3300033180 Bacteria 49994
71 Ga0315913_1000008 3300033430 Bacteria 155397
72 Ga0315911_1000003 3300033442 Bacteria 502217
73 Ga0315915_1000009 3300033464 Bacteria 252178
74 Ga0315915_1034243 3300033464 Bacteria 2887
75 Ga0395905_0039081 3300037471 Bacteria 4452
76 Ga0439448_0002558 3300042005 Bacteria 4957
77 Ga0439450_045152 3300042008 Bacteria 1034
78 Ga0439455_0000258 3300042012 Bacteria 6442
79 Ga0439455_0000273 3300042012 Bacteria 6323
80 Ga0439458_0009858 3300042157 Bacteria 2127
81 Ga0439458_0041504 3300042157 Bacteria 1117
82 Ga0495629_0204449 3300046459 Bacteria 1365
83 Ga0495638_0122002 3300046460 Bacteria 1539
84 Ga0495650_0000007 3300046471 Bacteria 718072
85 Ga0495650_0000027 3300046471 Bacteria 475071
86 Ga0495650_0035414 3300046471 Bacteria 2198
87 Ga0495605_0019112 3300046474 Bacteria 3666
88 Ga0495605_0027347 3300046474 Bacteria 2956
89 Ga0495605_0066184 3300046474 Bacteria 1717
90 Ga0495639_0000597 3300046475 Bacteria 16861
91 Ga0495584_0012364 3300046491 Bacteria 4357
92 Ga0495585_0055202 3300046492 Bacteria 2195
93 Ga0495596_0000174 3300046500 Bacteria 44820
94 Ga0495596_0001576 3300046500 Bacteria 13010
95 Ga0495596_0004987 3300046500 Bacteria 6358
96 Ga0495607_0003663 3300046501 Bacteria 11655
97 Ga0495607_0007102 3300046501 Bacteria 7787
98 Ga0495607_0092393 3300046501 Bacteria 1637
99 Ga0495583_0000160 3300046506 Bacteria 113560
100 Ga0495583_0033926 3300046506 Bacteria 2450
101 Ga0495606_0006055 3300046507 Bacteria 11309
102 Ga0495606_0030330 3300046507 Bacteria 3779
103 Ga0495606_0165540 3300046507 Bacteria 1287
104 Ga0495606_0255603 3300046507 Bacteria 970
105 Ga0495610_0100149 3300046512 Bacteria 1299
106 Ga0495616_0000281 3300046513 Bacteria 41179
107 Ga0495616_0002094 3300046513 Bacteria 13405
108 Ga0495616_0009104 3300046513 Bacteria 5824
109 Ga0495631_0006098 3300046518 Bacteria 6254
110 Ga0495632_0001202 3300046519 Bacteria 21984
111 Ga0495632_0001302 3300046519 Bacteria 21119
112 Ga0495632_0019664 3300046519 Bacteria 3673
113 Ga0495632_0198516 3300046519 Bacteria 914
114 Ga0495643_0001036 3300046522 Bacteria 28185
115 Ga0495643_0008343 3300046522 Bacteria 6572
116 Ga0495643_0188615 3300046522 Bacteria 997
117 Ga0495643_0304874 3300046522 Bacteria 724
118 Ga0495644_0001818 3300046523 Bacteria 8597
119 Ga0495644_0012887 3300046523 Bacteria 3213
120 Ga0495648_0000105 3300046524 Bacteria 105677
121 Ga0495648_0016048 3300046524 Bacteria 5408
122 Ga0495648_0103729 3300046524 Bacteria 1563
123 Ga0495642_0020033 3300046528 Bacteria 2624
124 Ga0495609_0000319 3300046538 Bacteria 43061
125 Ga0495609_0000451 3300046538 Bacteria 33601
126 Ga0495609_0042734 3300046538 Bacteria 2036
127 Ga0495633_0007600 3300046558 Bacteria 6212
128 Ga0495633_0014851 3300046558 Bacteria 4054
129 Ga0495656_0013175 3300046615 Bacteria 3069
130 Ga0495668_0005590 3300046616 Bacteria 8451
131 Ga0495668_0009154 3300046616 Bacteria 6102
132 Ga0495611_0002335 3300046648 Bacteria 8765
133 Ga0495625_0002796 3300046660 Bacteria 18400
134 Ga0495625_0105452 3300046660 Bacteria 1930
135 Ga0495625_0179734 3300046660 Bacteria 1408
136 Ga0495625_0206262 3300046660 Bacteria 1294
137 Ga0495661_0000418 3300046665 Bacteria 44828
138 Ga0495661_0000843 3300046665 Bacteria 28565
139 Ga0495661_0002430 3300046665 Bacteria 14342
140 Ga0495661_0062563 3300046665 Bacteria 2204
141 Ga0495588_0048961 3300046674 Bacteria 2172
142 Ga0495671_0117001 3300046692 Bacteria 1301
143 Ga0495649_0079704 3300046694 Bacteria 1751
144 Ga0495589_0000282 3300046794 Bacteria 41422
145 Ga0495589_0004044 3300046794 Bacteria 7860
146 Ga0495660_0011937 3300046810 Bacteria 5038
147 Ga0495683_0020602 3300047323 Bacteria 3400
148 Ga0495687_000622 3300047443 Bacteria 40986
149 Ga0495677_0000111 3300047445 Bacteria 40961
150 Ga0495677_0001353 3300047445 Bacteria 9787
151 Ga0495679_002819 3300047446 Bacteria 8622
152 Ga0495673_0000143 3300047469 Bacteria 128190
153 Ga0495681_0006401 3300047470 Bacteria 7749
154 Ga0495686_0000047 3300047472 Bacteria 280086
155 Ga0495686_0000464 3300047472 Bacteria 60897
156 Ga0495686_0004991 3300047472 Bacteria 10668
157 Ga0495626_0000591 3300048091 Bacteria 35534
158 Ga0495626_0007380 3300048091 Bacteria 6124
159 Ga0495626_0060016 3300048091 Bacteria 1734
160 Ga0495626_0060664 3300048091 Bacteria 1722
161 Ga0496100_0005625 3300048903 Bacteria 6771
162 Ga0496101_0000352 3300048904 Bacteria 31023
163 Ga0496102_1050202 3300048905 Bacteria 735
164 Ga0496104_0000777 3300048907 Bacteria 27303
165 Ga0496106_0078787 3300048909 Bacteria 2529
166 Ga0496108_0021295 3300048911 Bacteria 5329
167 Ga0496109_0436252 3300048912 Bacteria 1237
168 Ga0496110_0001189 3300048913 Bacteria 18534
169 Ga0496111_0021983 3300048914 Bacteria 4461
170 Ga0496112_1416806 3300048915 Bacteria 609
171 Ga0496114_0018247 3300048917 Bacteria 5671
172 Ga0496114_0091106 3300048917 Bacteria 2589
173 Ga0496126_0142224 3300048929 Bacteria 2064
174 Ga0495678_002057 3300049459 Bacteria 14380
175 Ga0495682_0000677 3300049460 Bacteria 22419
176 Ga0501033_0023921 3300049570 Bacteria 4608
177 Ga0501033_0027098 3300049570 Bacteria 4311
178 Ga0501034_0008109 3300049571 Bacteria 11139
179 Ga0501038_0089900 3300049574 Bacteria 2575
180 Ga0501038_0229515 3300049574 Bacteria 1478
181 Ga0501046_0159240 3300049580 Bacteria 1699
182 Ga0501047_0078355 3300049581 Bacteria 3178
183 Ga0501069_0043434 3300049585 Bacteria 2488
184 Ga0501073_0084515 3300049589 Bacteria 2208
185 Ga0501074_0010282 3300049590 Bacteria 6792
186 Ga0501044_0000764 3300049823 Bacteria 38944
187 Ga0501044_0023224 3300049823 Bacteria 6599
188 Ga0501044_0076226 3300049823 Bacteria 3404
189 nmdc:mga03683_81291_c1 3300050489 Bacteria 1399
190 nmdc:mga00v17_178514_c1 3300050491 Bacteria 1370
191 nmdc:mga07m45_238899_c1 3300050496 Bacteria 1057
192 nmdc:mga05p37_21517_c1 3300050507 Bacteria 7812
193 nmdc:mga0qj67_87841_c1 3300050509 Bacteria 2496
194 nmdc:mga06r32_68579_c1 3300050510 Bacteria 3427
195 Ga0500644_0000004 3300053088 Bacteria 173652
196 Ga0500641_0166790 3300053096 Bacteria 949
197 Ga0500650_0000054 3300053098 Bacteria 37455
198 Ga0500562_004954 3300053108 Bacteria 3357
199 Ga0500562_013660 3300053108 Bacteria 2076
200 Ga0500592_000048 3300053116 Bacteria 35599
201 Ga0500564_000927 3300053138 Bacteria 9478
202 Ga0500627_0002487 3300053158 Bacteria 5476
203 Ga0500634_0145223 3300053161 Bacteria 1117
204 2509141370 2508501127 Bacteria 7037543
205 2510283542 2510065053 Bacteria 5005518
206 2510292630 2510065055 Bacteria 5037935
207 2510311722 2510065058 Bacteria 5005894
208 2511498014 2511231052 Bacteria 6974333
209 2512529167 2512047086 Bacteria 6850303
210 2513583778 2513237086 Bacteria 7265287
211 2513604889 2513237089 Bacteria 6553624
212 2513607952 2513237090 Bacteria 7096802
213 2513617301 2513237091 Bacteria 6900273
214 2513882462 2513237140 Bacteria 7076289
215 2513904104 2513237143 Bacteria 6664116
216 2514006600 2513237160 Bacteria 6650282
217 2514591856 2513237351 Bacteria 6968952
218 2515612569 2515154107 Bacteria 6795637
219 2516896341 2516653046 Bacteria 6989037
220 2517565785 2517487022 Bacteria 7227575
221 2524449772 2524023207 Bacteria 6813453
222 2551676180 2551306084 Bacteria 8942552
223 2551685647 2551306085 Bacteria 7347181
224 2551695196 2551306086 Bacteria 6843938
225 2551700593 2551306087 Bacteria 7351905
226 2551709970 2551306089 Bacteria 7162724
227 2551723368 2551306090 Bacteria 7953713
228 2551732398 2551306092 Bacteria 6992595
229 2551741881 2551306093 Bacteria 7064773
230 2585151926 2582581280 Bacteria 5994497
231 2585194589 2582581293 Bacteria 5907401
232 2596377173 2595698237 Bacteria 6712432
233 2738745265 2738541281 Bacteria 5112672
234 2739354495 2738543032 Bacteria 5115625
235 2774128686 2773857672 Bacteria 4993178
236 2802721400 2802428858 Bacteria 6636079
237 2802732586 2802428860 Bacteria 6525526
238 2802739707 2802428861 Bacteria 6534206
239 2802747128 2802428862 Bacteria 6633353
240 2802748816 2802428863 Bacteria 6410669
241 2840764879 2840764183 Bacteria 6358399
242 2855828833 2855825444 Bacteria 6785811
243 2855843957 2855839649 Bacteria 7135830
244 2858806800 2858800743 Bacteria 6603254
245 2861695220 2861691609 Bacteria 5628931
246 2889308303 2889306138 Bacteria 6358934
247 2902335783 2902330777 Bacteria 6395352
248 2902405725 2902405164 Bacteria 6784948
249 2915981942 2915980308 Bacteria 6624279
250 2915993472 2915986958 Bacteria 6739310
251 2915994612 2915993759 Bacteria 7016183
252 2916010247 2916007675 Bacteria 6898660
253 2916016163 2916014648 Bacteria 6946486
254 2916022834 2916021584 Bacteria 6854472
255 2916031623 2916028427 Bacteria 6748433
256 2916036167 2916035215 Bacteria 6755766
257 2916044230 2916041962 Bacteria 6820487
258 2916050875 2916048683 Bacteria 6543552
259 2916061307 2916055098 Bacteria 6758838
260 2916064407 2916061851 Bacteria 6737736
261 2916073537 2916068649 Bacteria 6943657
262 2916081730 2916076590 Bacteria 6596108
263 2917837296 2917832318 Bacteria 5346010
264 2919126703 2919125081 Bacteria 5385106
265 2921203409 2921201388 Bacteria 6926299
266 2921210540 2921208531 Bacteria 6745326
267 2921238660 2921237296 Bacteria 6876710
268 2921245502 2921244191 Bacteria 6568419
269 2921251921 2921250672 Bacteria 6677771
270 2921262312 2921257292 Bacteria 6808382
271 2921265610 2921263974 Bacteria 6864552
272 2921282502 2921282425 Bacteria 6826397
273 2921289368 2921289301 Bacteria 7316391
274 2921298927 2921296804 Bacteria 7176999
275 2924145852 2924144063 Bacteria 6883928
276 2924152618 2924150972 Bacteria 7169444
277 2924159593 2924158325 Bacteria 7188855
278 2924170130 2924165586 Bacteria 7260590
279 2924178078 2924172951 Bacteria 6749356
280 2924182118 2924179722 Bacteria 6843264
281 2924190642 2924186466 Bacteria 6876637
282 2924199472 2924193448 Bacteria 6955718
283 2924205165 2924200457 Bacteria 6757188
284 2924208337 2924207177 Bacteria 6917007
285 2924215777 2924214083 Bacteria 7080103
286 2924225359 2924221636 Bacteria 7113495
287 2924229206 2924228884 Bacteria 6633132
288 2928125072 2928125067 Bacteria 5937560
289 2937007150 2937002841 Bacteria 6934057
290 2937015876 2937009748 Bacteria 6746052
291 2937022679 2937016420 Bacteria 6782579
292 2937024175 2937023124 Bacteria 6815156
293 2937031517 2937029754 Bacteria 6424026
294 2937037377 2937036028 Bacteria 6846469
295 2937048536 2937042894 Bacteria 6741576
296 2937053001 2937049772 Bacteria 6757901
297 2937066650 2937063883 Bacteria 7199456
298 2937072101 2937071275 Bacteria 6984483
299 2937083563 2937078374 Bacteria 6610289
300 2937098663 2937091812 Bacteria 6979387
301 2937105322 2937098957 Bacteria 7249374
302 2937107877 2937106411 Bacteria 6947143
303 2937114369 2937113482 Bacteria 6505872
304 2937122755 2937119839 Bacteria 6597547
305 2937128485 2937126314 Bacteria 6771275
306 2954768032 2954767861 Bacteria 5535784
307 2957379299 2957375807 Bacteria 6425588
308 2957384211 2957382221 Bacteria 6737050
309 2957390400 2957388812 Bacteria 6778072
310 2957401128 2957395598 Bacteria 6822399
311 2957408008 2957402308 Bacteria 6741770
312 2957409744 2957408893 Bacteria 6558585
313 2957420613 2957415311 Bacteria 6991633
314 2957425781 2957422303 Bacteria 7172205
315 2957436016 2957430029 Bacteria 7022557
316 2957438453 2957437181 Bacteria 6568994
317 2957448831 2957443900 Bacteria 6869977
318 2957452021 2957450854 Bacteria 6765715
319 2957462934 2957457609 Bacteria 6967680
320 2957467411 2957464669 Bacteria 6568877
321 2957477745 2957471148 Bacteria 6797643
322 2957484552 2957478035 Bacteria 6756658
323 2957488106 2957484790 Bacteria 6703082
324 2957497516 2957491536 Bacteria 6695180
325 2957501534 2957498199 Bacteria 7126688
326 2957509743 2957505466 Bacteria 7253085
327 2960589971 2960584000 Bacteria 6864594
328 2960594507 2960591022 Bacteria 6622873
329 2960598614 2960597568 Bacteria 6550735
330 2960608652 2960603979 Bacteria 6898737
331 2960615469 2960610863 Bacteria 6691244
332 2960622949 2960617483 Bacteria 6727748
333 2960630422 2960624210 Bacteria 6875384
334 2960632387 2960631154 Bacteria 6732508
335 2960641923 2960637947 Bacteria 7296468
336 2960649604 2960645483 Bacteria 7211087
337 2960657954 2960652885 Bacteria 7083688
338 2960664631 2960660292 Bacteria 7041660
339 2960667795 2960667422 Bacteria 6763020
340 2960678215 2960674078 Bacteria 6609048
341 2960682007 2960680706 Bacteria 6624464
342 2960693614 2960687367 Bacteria 6535474
343 2960700459 2960693952 Bacteria 6749742
344 2964615925 2964615318 Bacteria 6809089
345 2964627502 2964621998 Bacteria 6834995
346 2964632391 2964628898 Bacteria 7083044
347 2964636728 2964636051 Bacteria 7091832
348 2964648453 2964643177 Bacteria 6820887
349 2964656045 2964649959 Bacteria 6675118
350 2964658488 2964656573 Bacteria 7100150
351 2964670642 2964663802 Bacteria 7019362
352 2964673696 2964670856 Bacteria 6851364
353 2964684883 2964678106 Bacteria 6792020
354 2964688410 2964685014 Bacteria 6839111
355 2964697968 2964691889 Bacteria 6802758
356 2964703962 2964698721 Bacteria 6765331
357 2964709479 2964705432 Bacteria 7114648
358 2964714274 2964712639 Bacteria 6695970
359 2964724541 2964719344 Bacteria 7286602
360 2967666873 2967664464 Bacteria 6948836
361 2967674074 2967671571 Bacteria 7021409
362 2967684318 2967678726 Bacteria 7264382
363 2967692727 2967686174 Bacteria 6678622
364 2967693731 2967693043 Bacteria 6804451
365 2967705163 2967699805 Bacteria 6854538
366 2967710969 2967706974 Bacteria 7186053
367 2967715532 2967714385 Bacteria 7000047
368 2967725132 2967721400 Bacteria 7073753
369 2967736076 2967735183 Bacteria 6827012
370 2967747084 2967742019 Bacteria 6794534
371 2967751157 2967748971 Bacteria 6733771
372 2967762112 2967755722 Bacteria 6814706
373 2967768269 2967762386 Bacteria 6923502
374 2967775433 2967769361 Bacteria 6587838
375 2967782106 2967775926 Bacteria 6738189
376 2970022942 2970019648 Bacteria 7072033
377 2970031273 2970026789 Bacteria 6785236
378 2970037929 2970033650 Bacteria 7118744
379 2970042050 2970040964 Bacteria 6731123
380 2970053215 2970047711 Bacteria 7088379
381 2970055459 2970054988 Bacteria 6611507
382 2970065068 2970061556 Bacteria 7099761
383 2970071661 2970068827 Bacteria 7123112
384 2970080657 2970076120 Bacteria 6697332
385 2970088695 2970082768 Bacteria 6183754
386 2970092292 2970088815 Bacteria 6933825
387 2970100491 2970095765 Bacteria 6936963
388 2970103569 2970102677 Bacteria 6812532
389 2970114685 2970109326 Bacteria 6863976
390 2970116566 2970116247 Bacteria 6501857
391 2970127130 2970122695 Bacteria 6625855
392 2970130530 2970129317 Bacteria 6806560
393 2970138515 2970136068 Bacteria 7207982
394 2970147470 2970143518 Bacteria 6446480
395 2970155143 2970149975 Bacteria 6779706
396 2970157356 2970156795 Bacteria 7168044
397 2970165775 2970164137 Bacteria 6861252
398 2970177592 2970170962 Bacteria 6876229
399 2970180370 2970177841 Bacteria 6768001
400 2970186034 2970184632 Bacteria 7054431
401 2970192140 2970191845 Bacteria 7032787
402 2977518121 2977516862 Bacteria 6940108
403 2977528296 2977523885 Bacteria 6960446
404 2977535465 2977530762 Bacteria 6951399
405 2977538928 2977537788 Bacteria 6929320
406 2977551574 2977544691 Bacteria 6875412
407 2977552506 2977551784 Bacteria 7125765
408 2977561939 2977558990 Bacteria 6863948
409 2977570735 2977565890 Bacteria 6901543
410 2977579341 2977572785 Bacteria 6763888
411 2977580883 2977579622 Bacteria 6772100
412 2984501504 2984499530 Bacteria 5020881
413 2984505098 2984504281 Bacteria 5262371
414 648737567 648276728 Bacteria 6968865
415 8003996529 8003992118 Bacteria 7266902
416 8004004269 8003999396 Bacteria 7063185
417 8016733046 8016728285 Bacteria 5263933
418 Ga0307412_10000002
419 JGI24737J22298_10006231
420 JGI24735J21928_10008432
421 JGI24735J21928_10019700
422 Ga0058692_1000047
423 Ga0070676_10192971
424 Ga0070682_100188787
425 Ga0068868_100666067
426 Ga0070660_100000445
427 Ga0070673_100326667
428 Ga0070673_100518337
429 Ga0070678_100664222
430 Ga0070662_100481980
431 Ga0070706_100112438
432 Ga0070707_100002138
433 Ga0070699_100344500
434 Ga0070697_100087811
435 Ga0070697_100384605
436 Ga0070672_100812263
437 Ga0068855_100012525
438 Ga0068856_100005626
439 Ga0068852_100667463
440 Ga0068863_100568947
441 Ga0081455_10077771
442 Ga0075364_10153000
443 Ga0070715_10156660
444 Ga0097621_100627846
445 Ga0075370_10220042
446 Ga0075430_100000767
447 Ga0105251_10021983
448 Ga0114129_10340826
449 Ga0157371_10002009
450 Ga0157371_10252886
451 Ga0157369_10022608
452 Ga0157369_10457644
453 Ga0163162_10005585
454 Ga0157372_10106775
455 Ga0157372_10488639
456 Ga0183362_10002
457 Ga0163161_10012872
458 Ga0228711_1024790
459 Ga0228710_1008201
460 Ga0209758_1002274
461 Ga0207647_10055222
462 Ga0207647_10126520
463 Ga0207705_10157134
464 Ga0207684_10228413
465 Ga0207684_10679264
466 Ga0207654_10284298
467 Ga0207662_10365953
468 Ga0207657_10000630
469 Ga0207652_10290723
470 Ga0207646_10005935
471 Ga0207706_10489647
472 Ga0207667_10056266
473 Ga0207667_10422672
474 Ga0207677_10642352
475 Ga0207702_10015620
476 Ga0207641_10678729
477 Ga0209281_1000087
478 Ga0209371_1000148
479 Ga0209282_1000008
480 Ga0268266_10008805
481 Ga0307517_10187113
482 Ga0307515_10257639
483 Ga0268256_1000122
484 Ga0307405_10060714
485 Ga0315914_1000011
486 Ga0307416_100923408
487 Ga0307510_10000233
488 Ga0315913_1000008
489 Ga0315911_1000003
490 Ga0315915_1000009
491 Ga0315915_1034243
492 Ga0395905_0039081
493 Ga0439448_0002558
494 Ga0439450_045152
495 Ga0439455_0000258
496 Ga0439455_0000273
497 Ga0439458_0009858
498 Ga0439458_0041504
499 Ga0495629_0204449
500 Ga0495638_0122002
501 Ga0495650_0000007
502 Ga0495650_0000027
503 Ga0495650_0035414
504 Ga0495605_0019112
505 Ga0495605_0027347
506 Ga0495605_0066184
507 Ga0495639_0000597
508 Ga0495584_0012364
509 Ga0495585_0055202
510 Ga0495596_0000174
511 Ga0495596_0001576
512 Ga0495596_0004987
513 Ga0495607_0003663
514 Ga0495607_0007102
515 Ga0495607_0092393
516 Ga0495583_0000160
517 Ga0495583_0033926
518 Ga0495606_0006055
519 Ga0495606_0030330
520 Ga0495606_0165540
521 Ga0495606_0255603
522 Ga0495610_0100149
523 Ga0495616_0000281
524 Ga0495616_0002094
525 Ga0495616_0009104
526 Ga0495631_0006098
527 Ga0495632_0001202
528 Ga0495632_0001302
529 Ga0495632_0019664
530 Ga0495632_0198516
531 Ga0495643_0001036
532 Ga0495643_0008343
533 Ga0495643_0188615
534 Ga0495643_0304874
535 Ga0495644_0001818
536 Ga0495644_0012887
537 Ga0495648_0000105
538 Ga0495648_0016048
539 Ga0495648_0103729
540 Ga0495642_0020033
541 Ga0495609_0000319
542 Ga0495609_0000451
543 Ga0495609_0042734
544 Ga0495633_0007600
545 Ga0495633_0014851
546 Ga0495656_0013175
547 Ga0495668_0005590
548 Ga0495668_0009154
549 Ga0495611_0002335
550 Ga0495625_0002796
551 Ga0495625_0105452
552 Ga0495625_0179734
553 Ga0495625_0206262
554 Ga0495661_0000418
555 Ga0495661_0000843
556 Ga0495661_0002430
557 Ga0495661_0062563
558 Ga0495588_0048961
559 Ga0495671_0117001
560 Ga0495649_0079704
561 Ga0495589_0000282
562 Ga0495589_0004044
563 Ga0495660_0011937
564 Ga0495683_0020602
565 Ga0495687_000622
566 Ga0495677_0000111
567 Ga0495677_0001353
568 Ga0495679_002819
569 Ga0495673_0000143
570 Ga0495681_0006401
571 Ga0495686_0000047
572 Ga0495686_0000464
573 Ga0495686_0004991
574 Ga0495626_0000591
575 Ga0495626_0007380
576 Ga0495626_0060016
577 Ga0495626_0060664
578 Ga0496100_0005625
579 Ga0496101_0000352
580 Ga0496102_1050202
581 Ga0496104_0000777
582 Ga0496106_0078787
583 Ga0496108_0021295
584 Ga0496109_0436252
585 Ga0496110_0001189
586 Ga0496111_0021983
587 Ga0496112_1416806
588 Ga0496114_0018247
589 Ga0496114_0091106
590 Ga0496126_0142224
591 Ga0495678_002057
592 Ga0495682_0000677
593 Ga0501033_0023921
594 Ga0501033_0027098
595 Ga0501034_0008109
596 Ga0501038_0089900
597 Ga0501038_0229515
598 Ga0501046_0159240
599 Ga0501047_0078355
600 Ga0501069_0043434
601 Ga0501073_0084515
602 Ga0501074_0010282
603 Ga0501044_0000764
604 Ga0501044_0023224
605 Ga0501044_0076226
606 nmdc:mga03683_81291_c1
607 nmdc:mga00v17_178514_c1
608 nmdc:mga07m45_238899_c1
609 nmdc:mga05p37_21517_c1
610 nmdc:mga0qj67_87841_c1
611 nmdc:mga06r32_68579_c1
612 Ga0500644_0000004
613 Ga0500641_0166790
614 Ga0500650_0000054
615 Ga0500562_004954
616 Ga0500562_013660
617 Ga0500592_000048
618 Ga0500564_000927
619 Ga0500627_0002487
620 Ga0500634_0145223
621 2509141370
622 2510283542
623 2510292630
624 2510311722
625 2511498014
626 2512529167
627 2513583778
628 2513604889
629 2513607952
630 2513617301
631 2513882462
632 2513904104
633 2514006600
634 2514591856
635 2515612569
636 2516896341
637 2517565785
638 2524449772
639 2551676180
640 2551685647
641 2551695196
642 2551700593
643 2551709970
644 2551723368
645 2551732398
646 2551741881
647 2585151926
648 2585194589
649 2596377173
650 2738745265
651 2739354495
652 2774128686
653 2802721400
654 2802732586
655 2802739707
656 2802747128
657 2802748816
658 2840764879
659 2855828833
660 2855843957
661 2858806800
662 2861695220
663 2889308303
664 2902335783
665 2902405725
666 2915981942
667 2915993472
668 2915994612
669 2916010247
670 2916016163
671 2916022834
672 2916031623
673 2916036167
674 2916044230
675 2916050875
676 2916061307
677 2916064407
678 2916073537
679 2916081730
680 2917837296
681 2919126703
682 2921203409
683 2921210540
684 2921238660
685 2921245502
686 2921251921
687 2921262312
688 2921265610
689 2921282502
690 2921289368
691 2921298927
692 2924145852
693 2924152618
694 2924159593
695 2924170130
696 2924178078
697 2924182118
698 2924190642
699 2924199472
700 2924205165
701 2924208337
702 2924215777
703 2924225359
704 2924229206
705 2928125072
706 2937007150
707 2937015876
708 2937022679
709 2937024175
710 2937031517
711 2937037377
712 2937048536
713 2937053001
714 2937066650
715 2937072101
716 2937083563
717 2937098663
718 2937105322
719 2937107877
720 2937114369
721 2937122755
722 2937128485
723 2954768032
724 2957379299
725 2957384211
726 2957390400
727 2957401128
728 2957408008
729 2957409744
730 2957420613
731 2957425781
732 2957436016
733 2957438453
734 2957448831
735 2957452021
736 2957462934
737 2957467411
738 2957477745
739 2957484552
740 2957488106
741 2957497516
742 2957501534
743 2957509743
744 2960589971
745 2960594507
746 2960598614
747 2960608652
748 2960615469
749 2960622949
750 2960630422
751 2960632387
752 2960641923
753 2960649604
754 2960657954
755 2960664631
756 2960667795
757 2960678215
758 2960682007
759 2960693614
760 2960700459
761 2964615925
762 2964627502
763 2964632391
764 2964636728
765 2964648453
766 2964656045
767 2964658488
768 2964670642
769 2964673696
770 2964684883
771 2964688410
772 2964697968
773 2964703962
774 2964709479
775 2964714274
776 2964724541
777 2967666873
778 2967674074
779 2967684318
780 2967692727
781 2967693731
782 2967705163
783 2967710969
784 2967715532
785 2967725132
786 2967736076
787 2967747084
788 2967751157
789 2967762112
790 2967768269
791 2967775433
792 2967782106
793 2970022942
794 2970031273
795 2970037929
796 2970042050
797 2970053215
798 2970055459
799 2970065068
800 2970071661
801 2970080657
802 2970088695
803 2970092292
804 2970100491
805 2970103569
806 2970114685
807 2970116566
808 2970127130
809 2970130530
810 2970138515
811 2970147470
812 2970155143
813 2970157356
814 2970165775
815 2970177592
816 2970180370
817 2970186034
818 2970192140
819 2977518121
820 2977528296
821 2977535465
822 2977538928
823 2977551574
824 2977552506
825 2977561939
826 2977570735
827 2977579341
828 2977580883
829 2984501504
830 2984505098
831 648737567
832 8003996529
833 8004004269
834 8016733046

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

138

227

0.94

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

70

143

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5g5h-assembly1.cif.gz_A escherichia coli periplasmic aldehyde oxidase r440h mutant 0.9595 26 189
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9508 26 190
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9465 27 190
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.944 27 190
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9437 25 190
ID Description Score Start End Superfamily
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9898 26 101 3.10.20.30
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9801 26 101 3.10.20.30
af_Q46801_1_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9796 26 99 3.10.20.30
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9782 27 101 3.10.20.30
3hrdH01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9657 26 101 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A0J6S4E4-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.9921 26 144 GO:0016903
GO:0046872
GO:0051537
AF-A0A1H7QB46-F1-model_v4 Xanthine dehydrogenase YagT iron-sulfur-binding subunit 0.9787 23 190 GO:0016903
GO:0046872
GO:0051537
AF-A0A848LMS9-F1-model_v4 (2Fe-2S)-binding protein 0.976 25 190 GO:0016903
GO:0046872
GO:0051537
AF-A0A858WYS0-F1-model_v4 (2Fe-2S)-binding protein 0.9759 25 190 GO:0016903
GO:0046872
GO:0051537
AF-A0A0Q6Z557-F1-model_v4 (2Fe-2S)-binding protein 0.9741 26 191 GO:0016903
GO:0046872
GO:0051537

Map