F439086

General Info

Members Datasets Scaffolds Average Seq Length
417 197 834 236

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_10241681|Ga0207648_102416812
Length 283
Sequence MRSAGHAAVSSAPDAPAPRAVGPPPTIIELNQVTKQFAGKRDVVALDAVSLTIPRGEMVSIIGPSGSGKSTLLNLVGGLDRPTSGQVSIDGEPLAGLGDDQLTRVRRDKIGFIFQFFNLLPTLSSLENVGLPLHLRGWPRKKVEERARELLSLVKLEPRTHHLPDELSGGERQRVAIARALSVYPPILLADEPTGNLDTRTGEEILALIRDLHTRLHSTVVIGDCTLVLGEVVHAAVDEDVVVDGRADLRRLRPLSRLGGNEWGTVGEIHDLARVAYRDLPPS

Samples

Sample ID Description Type Environment
1 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
148 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
149 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
150 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
151 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
152 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
153 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
154 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
155 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
156 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
159 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
160 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
161 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
164 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.64
Rhizosphere 97.36
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207648_10241681 3300026089 Bacteria 1607
2 Ga0065715_10416661 3300005293 Bacteria 863
3 Ga0070683_100083884 3300005329 Bacteria 2985
4 Ga0070690_100145126 3300005330 Bacteria 1614
5 Ga0070670_100023296 3300005331 Bacteria 5330
6 Ga0068869_100058299 3300005334 Bacteria 2823
7 Ga0070666_10090631 3300005335 Bacteria 2100
8 Ga0070666_10091780 3300005335 Bacteria 2087
9 Ga0070680_100017244 3300005336 Bacteria 5690
10 Ga0068868_100004969 3300005338 Bacteria 9338
11 Ga0068868_100059667 3300005338 Bacteria 3018
12 Ga0068868_100071293 3300005338 Bacteria 2771
13 Ga0068868_100076821 3300005338 Bacteria 2670
14 Ga0070660_100149508 3300005339 Bacteria 1877
15 Ga0070660_100168288 3300005339 Bacteria 1769
16 Ga0070689_100615219 3300005340 Bacteria 942
17 Ga0070691_10000422 3300005341 Bacteria 15522
18 Ga0070691_10002427 3300005341 Bacteria 8265
19 Ga0070661_100072712 3300005344 Bacteria 2531
20 Ga0070661_100096632 3300005344 Bacteria 2192
21 Ga0070669_100010277 3300005353 Bacteria 6649
22 Ga0070669_100284223 3300005353 Bacteria 1326
23 Ga0070669_100319753 3300005353 Bacteria 1253
24 Ga0070675_100089718 3300005354 Bacteria 2574
25 Ga0070674_100059522 3300005356 Bacteria 2659
26 Ga0070674_100520427 3300005356 Bacteria 994
27 Ga0070673_100165093 3300005364 Bacteria 1886
28 Ga0070673_100255626 3300005364 Bacteria 1528
29 Ga0070673_100589813 3300005364 Bacteria 1013
30 Ga0070688_100033931 3300005365 Bacteria 3087
31 Ga0070659_100325164 3300005366 Bacteria 1286
32 Ga0070667_100082643 3300005367 Bacteria 2750
33 Ga0070667_100118386 3300005367 Bacteria 2302
34 Ga0070667_100468215 3300005367 Bacteria 1153
35 Ga0070714_100001779 3300005435 Bacteria 15703
36 Ga0070713_100003610 3300005436 Bacteria 10230
37 Ga0070713_100394210 3300005436 Bacteria 1292
38 Ga0070701_10036686 3300005438 Bacteria 2471
39 Ga0070701_10234291 3300005438 Bacteria 1101
40 Ga0070711_100047516 3300005439 Bacteria 2931
41 Ga0070705_100009848 3300005440 Bacteria 4768
42 Ga0070700_100000968 3300005441 Bacteria 14164
43 Ga0070694_100007673 3300005444 Bacteria 6585
44 Ga0070678_100640885 3300005456 Bacteria 952
45 Ga0070662_100384297 3300005457 Bacteria 1156
46 Ga0070662_100417757 3300005457 Bacteria 1109
47 Ga0070681_10001569 3300005458 Bacteria 20292
48 Ga0070681_10005564 3300005458 Bacteria 12170
49 Ga0070681_10026429 3300005458 Bacteria 5833
50 Ga0070681_10047693 3300005458 Bacteria 4283
51 Ga0070681_10090152 3300005458 Bacteria 3016
52 Ga0068867_100036319 3300005459 Bacteria 3577
53 Ga0068867_100081987 3300005459 Bacteria 2433
54 Ga0070685_10086441 3300005466 Bacteria 1891
55 Ga0070685_10308231 3300005466 Bacteria 1069
56 Ga0070707_100102105 3300005468 Bacteria 2779
57 Ga0070679_100039974 3300005530 Bacteria 4664
58 Ga0070684_100000438 3300005535 Bacteria 28577
59 Ga0068853_100035910 3300005539 Bacteria 4212
60 Ga0070672_100263578 3300005543 Bacteria 1454
61 Ga0070686_100025208 3300005544 Bacteria 3576
62 Ga0070686_100287759 3300005544 Bacteria 1214
63 Ga0070695_100001952 3300005545 Bacteria 11704
64 Ga0070695_100065900 3300005545 Bacteria 2360
65 Ga0070696_100003239 3300005546 Bacteria 10841
66 Ga0070696_100067432 3300005546 Bacteria 2511
67 Ga0070696_100144763 3300005546 Bacteria 1740
68 Ga0070665_100010348 3300005548 Bacteria 9437
69 Ga0070665_100010405 3300005548 Bacteria 9414
70 Ga0070665_100021327 3300005548 Bacteria 6516
71 Ga0070704_100034141 3300005549 Bacteria 3446
72 Ga0070704_100037097 3300005549 Bacteria 3326
73 Ga0068855_100126771 3300005563 Bacteria 2918
74 Ga0068855_100177754 3300005563 Bacteria 2407
75 Ga0068855_100242279 3300005563 Bacteria 2014
76 Ga0068857_100006148 3300005577 Bacteria 10260
77 Ga0068857_100109729 3300005577 Bacteria 2479
78 Ga0068854_100320417 3300005578 Bacteria 1260
79 Ga0068854_100680713 3300005578 Bacteria 886
80 Ga0068856_100001077 3300005614 Bacteria 28871
81 Ga0068856_100067368 3300005614 Bacteria 3538
82 Ga0068856_100075240 3300005614 Bacteria 3345
83 Ga0068856_100124855 3300005614 Bacteria 2577
84 Ga0070702_100004013 3300005615 Bacteria 6680
85 Ga0070702_100513980 3300005615 Bacteria 882
86 Ga0068852_100030591 3300005616 Bacteria 4435
87 Ga0068852_100031871 3300005616 Bacteria 4357
88 Ga0068852_100261702 3300005616 Bacteria 1661
89 Ga0068859_100140331 3300005617 Bacteria 2490
90 Ga0068866_10031172 3300005718 Bacteria 2566
91 Ga0068861_100036460 3300005719 Bacteria 3650
92 Ga0068861_100313443 3300005719 Bacteria 1364
93 Ga0068870_10122304 3300005840 Bacteria 1501
94 Ga0068863_100012751 3300005841 Bacteria 8106
95 Ga0068863_100111139 3300005841 Bacteria 2610
96 Ga0068858_100004349 3300005842 Bacteria 13898
97 Ga0068858_100007498 3300005842 Bacteria 10547
98 Ga0068858_100034125 3300005842 Bacteria 4720
99 Ga0068858_100054838 3300005842 Bacteria 3686
100 Ga0068858_100088941 3300005842 Bacteria 2874
101 Ga0068860_100006969 3300005843 Bacteria 11325
102 Ga0068860_100322746 3300005843 Bacteria 1516
103 Ga0068860_100872491 3300005843 Bacteria 915
104 Ga0068862_100011894 3300005844 Bacteria 7186
105 Ga0070717_10868178 3300006028 Bacteria 821
106 Ga0070712_100371678 3300006175 Bacteria 1175
107 Ga0070712_100669005 3300006175 Bacteria 883
108 Ga0097621_100003312 3300006237 Bacteria 11082
109 Ga0097621_100011227 3300006237 Bacteria 6594
110 Ga0097621_100013094 3300006237 Bacteria 6169
111 Ga0097621_100214225 3300006237 Bacteria 1676
112 Ga0097621_100572979 3300006237 Bacteria 1029
113 Ga0068871_100007041 3300006358 Bacteria 8010
114 Ga0068871_100015114 3300006358 Bacteria 5771
115 Ga0068871_100017256 3300006358 Bacteria 5458
116 Ga0068871_100129510 3300006358 Bacteria 2138
117 Ga0075431_100041125 3300006847 Bacteria 4766
118 Ga0075434_100005904 3300006871 Bacteria 11194
119 Ga0075434_100041660 3300006871 Bacteria 4549
120 Ga0075434_100145955 3300006871 Bacteria 2386
121 Ga0075434_100469996 3300006871 Bacteria 1279
122 Ga0075429_100087940 3300006880 Bacteria 2708
123 Ga0075429_100201828 3300006880 Bacteria 1742
124 Ga0068865_100013246 3300006881 Bacteria 5208
125 Ga0068865_100091060 3300006881 Bacteria 2212
126 Ga0068865_100161297 3300006881 Bacteria 1711
127 Ga0075436_100000295 3300006914 Bacteria 31676
128 Ga0075436_100021116 3300006914 Bacteria 4467
129 Ga0075436_100106915 3300006914 Bacteria 1951
130 Ga0097620_100046106 3300006931 Bacteria 4378
131 Ga0097620_100070479 3300006931 Bacteria 3531
132 Ga0097620_100140341 3300006931 Bacteria 2490
133 Ga0097620_101176494 3300006931 Bacteria 844
134 Ga0075435_100000147 3300007076 Bacteria 39845
135 Ga0075435_100002653 3300007076 Bacteria 11929
136 Ga0075435_100014660 3300007076 Bacteria 5871
137 Ga0075435_100075285 3300007076 Bacteria 2764
138 Ga0075435_100268275 3300007076 Bacteria 1455
139 Ga0105240_10011792 3300009093 Bacteria 12141
140 Ga0105240_10057261 3300009093 Bacteria 4871
141 Ga0105240_10132943 3300009093 Bacteria 2982
142 Ga0105240_10221824 3300009093 Bacteria 2202
143 Ga0105240_10344174 3300009093 Bacteria 1693
144 Ga0105240_10345826 3300009093 Bacteria 1688
145 Ga0111539_10002429 3300009094 Bacteria 24773
146 Ga0111539_10009461 3300009094 Bacteria 12298
147 Ga0105245_10005530 3300009098 Bacteria 11098
148 Ga0105245_10017418 3300009098 Bacteria 6268
149 Ga0105245_10029447 3300009098 Bacteria 4851
150 Ga0105245_10052475 3300009098 Bacteria 3657
151 Ga0105247_10031266 3300009101 Bacteria 3230
152 Ga0105247_10065073 3300009101 Bacteria 2267
153 Ga0105247_10348584 3300009101 Bacteria 1041
154 Ga0114129_10015882 3300009147 Bacteria 10708
155 Ga0114129_10063086 3300009147 Bacteria 5176
156 Ga0114129_10220081 3300009147 Bacteria 2562
157 Ga0114129_10396628 3300009147 Bacteria 1819
158 Ga0105243_10036985 3300009148 Bacteria 3791
159 Ga0105243_10127842 3300009148 Bacteria 2152
160 Ga0105241_10003184 3300009174 Bacteria 12215
161 Ga0105241_10035596 3300009174 Bacteria 3744
162 Ga0105241_10123349 3300009174 Bacteria 2089
163 Ga0105241_10677703 3300009174 Bacteria 939
164 Ga0105242_10037468 3300009176 Bacteria 3895
165 Ga0105242_10170322 3300009176 Bacteria 1913
166 Ga0105242_10694113 3300009176 Bacteria 995
167 Ga0105248_10023159 3300009177 Bacteria 6897
168 Ga0105248_10054945 3300009177 Bacteria 4466
169 Ga0105248_10057244 3300009177 Bacteria 4375
170 Ga0105248_10080721 3300009177 Bacteria 3656
171 Ga0105248_10241320 3300009177 Bacteria 2034
172 Ga0105248_10735786 3300009177 Bacteria 1113
173 Ga0105237_10041827 3300009545 Bacteria 4621
174 Ga0105237_10143291 3300009545 Bacteria 2384
175 Ga0105238_10021153 3300009551 Bacteria 6631
176 Ga0105238_10068642 3300009551 Bacteria 3545
177 Ga0105238_10078328 3300009551 Bacteria 3295
178 Ga0105238_10341164 3300009551 Bacteria 1486
179 Ga0105239_10001226 3300010375 Bacteria 34944
180 Ga0105239_10025750 3300010375 Bacteria 6479
181 Ga0157370_10051694 3300013104 Bacteria 3925
182 Ga0157370_10315879 3300013104 Bacteria 1441
183 Ga0157369_10054021 3300013105 Bacteria 4338
184 Ga0157369_10278731 3300013105 Bacteria 1741
185 Ga0157369_10425299 3300013105 Bacteria 1377
186 Ga0157369_10753535 3300013105 Bacteria 1002
187 Ga0157374_10035730 3300013296 Bacteria 4547
188 Ga0157374_10429728 3300013296 Bacteria 1320
189 Ga0157374_10479661 3300013296 Bacteria 1247
190 Ga0157374_10838198 3300013296 Bacteria 936
191 Ga0163162_10009499 3300013306 Bacteria 9459
192 Ga0163162_10096386 3300013306 Bacteria 3046
193 Ga0163162_10454358 3300013306 Bacteria 1413
194 Ga0157372_10168070 3300013307 Bacteria 2537
195 Ga0157375_10079422 3300013308 Bacteria 3317
196 Ga0157375_10247728 3300013308 Bacteria 1942
197 Ga0157375_10325906 3300013308 Bacteria 1701
198 Ga0157375_10713631 3300013308 Bacteria 1156
199 Ga0163163_10008581 3300014325 Bacteria 9085
200 Ga0163163_10008779 3300014325 Bacteria 8996
201 Ga0163163_10045215 3300014325 Bacteria 4321
202 Ga0163163_10192039 3300014325 Bacteria 2090
203 Ga0157379_10476179 3300014968 Bacteria 1155
204 Ga0157376_10007267 3300014969 Bacteria 7889
205 Ga0157376_10032950 3300014969 Bacteria 4166
206 Ga0157376_10126881 3300014969 Bacteria 2271
207 Ga0207642_10028573 3300025899 Bacteria 2299
208 Ga0207710_10028881 3300025900 Bacteria 2409
209 Ga0207680_10260917 3300025903 Bacteria 1199
210 Ga0207685_10034110 3300025905 Bacteria 1846
211 Ga0207699_10133979 3300025906 Bacteria 1620
212 Ga0207645_10004101 3300025907 Bacteria 10841
213 Ga0207645_10112553 3300025907 Bacteria 1763
214 Ga0207654_10009981 3300025911 Bacteria 4829
215 Ga0207654_10054327 3300025911 Bacteria 2314
216 Ga0207654_10411534 3300025911 Bacteria 942
217 Ga0207707_10003367 3300025912 Bacteria 14187
218 Ga0207707_10003371 3300025912 Bacteria 14182
219 Ga0207707_10445546 3300025912 Bacteria 1108
220 Ga0207695_10001639 3300025913 Bacteria 36154
221 Ga0207695_10010571 3300025913 Bacteria 11283
222 Ga0207695_10038343 3300025913 Bacteria 5160
223 Ga0207695_10089357 3300025913 Bacteria 3098
224 Ga0207695_10236823 3300025913 Bacteria 1728
225 Ga0207695_10324799 3300025913 Bacteria 1428
226 Ga0207695_10563384 3300025913 Bacteria 1021
227 Ga0207671_10066455 3300025914 Bacteria 2684
228 Ga0207671_10116162 3300025914 Bacteria 2041
229 Ga0207693_10333191 3300025915 Bacteria 1188
230 Ga0207660_10051703 3300025917 Bacteria 2922
231 Ga0207660_10132409 3300025917 Bacteria 1899
232 Ga0207660_10282112 3300025917 Bacteria 1318
233 Ga0207657_10022480 3300025919 Bacteria 5897
234 Ga0207657_10027038 3300025919 Bacteria 5260
235 Ga0207657_10046274 3300025919 Bacteria 3812
236 Ga0207649_10056175 3300025920 Bacteria 2457
237 Ga0207652_10041915 3300025921 Bacteria 3893
238 Ga0207652_10054116 3300025921 Bacteria 3449
239 Ga0207652_10058759 3300025921 Bacteria 3313
240 Ga0207646_10029458 3300025922 Bacteria 4989
241 Ga0207681_10015007 3300025923 Bacteria 4828
242 Ga0207681_10467983 3300025923 Bacteria 1028
243 Ga0207694_10001085 3300025924 Bacteria 23569
244 Ga0207694_10010267 3300025924 Bacteria 7060
245 Ga0207650_10101612 3300025925 Bacteria 2214
246 Ga0207659_10640297 3300025926 Bacteria 908
247 Ga0207687_10005509 3300025927 Bacteria 8375
248 Ga0207687_10042162 3300025927 Bacteria 3137
249 Ga0207687_10055543 3300025927 Bacteria 2775
250 Ga0207687_10090225 3300025927 Bacteria 2233
251 Ga0207700_10001595 3300025928 Bacteria 12864
252 Ga0207700_10503409 3300025928 Bacteria 1072
253 Ga0207664_10041319 3300025929 Bacteria 3591
254 Ga0207644_10043246 3300025931 Bacteria 3196
255 Ga0207690_10160405 3300025932 Bacteria 1676
256 Ga0207690_10383343 3300025932 Bacteria 1118
257 Ga0207706_10114173 3300025933 Bacteria 2376
258 Ga0207686_10008068 3300025934 Bacteria 5681
259 Ga0207686_10018918 3300025934 Bacteria 3907
260 Ga0207686_10039604 3300025934 Bacteria 2860
261 Ga0207686_10155632 3300025934 Bacteria 1596
262 Ga0207709_10018897 3300025935 Bacteria 3866
263 Ga0207670_10101117 3300025936 Bacteria 2059
264 Ga0207669_10266480 3300025937 Bacteria 1284
265 Ga0207704_10105651 3300025938 Bacteria 1889
266 Ga0207704_10117773 3300025938 Bacteria 1810
267 Ga0207704_10237398 3300025938 Bacteria 1360
268 Ga0207704_10498735 3300025938 Bacteria 981
269 Ga0207665_10140427 3300025939 Bacteria 1722
270 Ga0207691_10099847 3300025940 Bacteria 2591
271 Ga0207691_10280601 3300025940 Bacteria 1433
272 Ga0207711_10030976 3300025941 Bacteria 4512
273 Ga0207711_10045233 3300025941 Bacteria 3762
274 Ga0207711_10056899 3300025941 Bacteria 3361
275 Ga0207711_10117399 3300025941 Bacteria 2373
276 Ga0207711_10434762 3300025941 Bacteria 1221
277 Ga0207689_10056308 3300025942 Bacteria 3235
278 Ga0207661_10065592 3300025944 Bacteria 2948
279 Ga0207661_10080038 3300025944 Bacteria 2694
280 Ga0207667_10000483 3300025949 Bacteria 52728
281 Ga0207667_10224291 3300025949 Bacteria 1925
282 Ga0207667_10278398 3300025949 Bacteria 1710
283 Ga0207667_10297298 3300025949 Bacteria 1649
284 Ga0207667_10351979 3300025949 Bacteria 1502
285 Ga0207667_10845684 3300025949 Bacteria 909
286 Ga0207651_10001596 3300025960 Bacteria 10386
287 Ga0207651_10531461 3300025960 Bacteria 1020
288 Ga0207651_10603206 3300025960 Bacteria 960
289 Ga0207651_10765524 3300025960 Bacteria 854
290 Ga0207712_10120712 3300025961 Bacteria 1983
291 Ga0207640_10015361 3300025981 Bacteria 4431
292 Ga0207658_10003889 3300025986 Bacteria 10510
293 Ga0207658_10041122 3300025986 Bacteria 3346
294 Ga0207658_10093379 3300025986 Bacteria 2339
295 Ga0207677_10021072 3300026023 Bacteria 3975
296 Ga0207677_10023835 3300026023 Bacteria 3788
297 Ga0207677_10058292 3300026023 Bacteria 2658
298 Ga0207703_10021169 3300026035 Bacteria 5090
299 Ga0207703_10021312 3300026035 Bacteria 5074
300 Ga0207703_10024618 3300026035 Bacteria 4735
301 Ga0207703_10073881 3300026035 Bacteria 2821
302 Ga0207639_10006242 3300026041 Bacteria 8098
303 Ga0207639_10100765 3300026041 Bacteria 2334
304 Ga0207708_10002926 3300026075 Bacteria 12581
305 Ga0207708_10014763 3300026075 Bacteria 5846
306 Ga0207702_10003479 3300026078 Bacteria 14352
307 Ga0207702_10034059 3300026078 Bacteria 4256
308 Ga0207702_10125450 3300026078 Bacteria 2304
309 Ga0207702_10138067 3300026078 Bacteria 2202
310 Ga0207702_10785745 3300026078 Bacteria 941
311 Ga0207641_10017364 3300026088 Bacteria 5891
312 Ga0207641_10037773 3300026088 Bacteria 4035
313 Ga0207648_10015050 3300026089 Bacteria 7124
314 Ga0207648_10039618 3300026089 Bacteria 4143
315 Ga0207676_10011334 3300026095 Bacteria 6374
316 Ga0207676_10212259 3300026095 Bacteria 1718
317 Ga0207676_10408417 3300026095 Bacteria 1271
318 Ga0207674_10000097 3300026116 Bacteria 98549
319 Ga0207674_10012753 3300026116 Bacteria 9387
320 Ga0207674_10276322 3300026116 Bacteria 1628
321 Ga0207675_100024246 3300026118 Bacteria 5642
322 Ga0207675_100184627 3300026118 Bacteria 1998
323 Ga0207675_100512980 3300026118 Bacteria 1194
324 Ga0207683_10005213 3300026121 Bacteria 11161
325 Ga0207683_10217440 3300026121 Bacteria 1740
326 Ga0207698_10037605 3300026142 Bacteria 3567
327 Ga0207698_10041994 3300026142 Bacteria 3413
328 Ga0207698_10181436 3300026142 Bacteria 1865
329 Ga0207428_10014844 3300027907 Bacteria 6746
330 Ga0268266_10002664 3300028379 Bacteria 18789
331 Ga0268266_10007559 3300028379 Bacteria 9787
332 Ga0268266_10013799 3300028379 Bacteria 6955
333 Ga0268266_10056569 3300028379 Bacteria 3374
334 Ga0268266_10537893 3300028379 Bacteria 1118
335 Ga0268265_10023742 3300028380 Bacteria 4327
336 Ga0268264_10009504 3300028381 Bacteria 8053
337 Ga0268264_10606080 3300028381 Bacteria 1080
338 Ga0268264_10952626 3300028381 Bacteria 863
339 Ga0265313_10211248 3300031595 Bacteria 804
340 Ga0265314_10025491 3300031711 Bacteria 4457
341 Ga0316578_10108867 3300031728 Bacteria 1664
342 Ga0373948_0002269 3300034817 Bacteria 2813
343 Ga0373950_0050027 3300034818 Bacteria 819
344 Ga0373958_0007133 3300034819 Bacteria 1768
345 Ga0373959_0009272 3300034820 Bacteria 1694
346 Ga0373926_0121600 3300035083 Bacteria 985
347 Ga0373928_0016619 3300035084 Bacteria 1507
348 Ga0373929_0005038 3300035085 Bacteria 2371
349 Ga0373949_0003582 3300035090 Bacteria 3670
350 Ga0373951_0015969 3300035091 Bacteria 1692
351 Ga0373923_0036512 3300035111 Bacteria 2006
352 Ga0373932_0004536 3300035112 Bacteria 3278
353 Ga0373939_0108407 3300035114 Bacteria 963
354 Ga0373954_0000785 3300035118 Bacteria 12266
355 Ga0373960_0008640 3300035121 Bacteria 2446
356 Ga0373955_0063356 3300035172 Bacteria 2047
357 Ga0373955_0139493 3300035172 Bacteria 1421
358 Ga0373942_0020741 3300035207 Bacteria 1652
359 Ga0373961_0007408 3300035241 Bacteria 2653
360 Ga0373931_0022729 3300035691 Bacteria 3158
361 Ga0373935_0428711 3300035692 Bacteria 953
362 Ga0373937_0023028 3300036401 Bacteria 5603
363 Ga0373937_0023369 3300036401 Bacteria 5566
364 Ga0373937_0085786 3300036401 Bacteria 2914
365 Ga0373925_0040196 3300037068 Bacteria 3462
366 Ga0395905_0499374 3300037471 Bacteria 1117
367 Ga0466967_0361343 3300045976 Bacteria 1407
368 Ga0495629_0017266 3300046459 Bacteria 5176
369 Ga0495580_0172114 3300046472 Bacteria 1497
370 Ga0495666_0195959 3300046526 Bacteria 930
371 Ga0495667_0082680 3300046559 Bacteria 2086
372 Ga0495599_0003711 3300046678 Bacteria 8949
373 Ga0495647_0096647 3300046681 Bacteria 1218
374 Ga0495658_0063690 3300046683 Bacteria 2122
375 Ga0495674_0072167 3300047319 Bacteria 2978
376 Ga0495614_0158089 3300048089 Bacteria 1013
377 Ga0496100_0168862 3300048903 Bacteria 1574
378 Ga0496102_0437429 3300048905 Bacteria 1228
379 Ga0496104_0049439 3300048907 Bacteria 3966
380 Ga0496104_0111339 3300048907 Bacteria 2625
381 Ga0496106_0293321 3300048909 Bacteria 1304
382 Ga0496109_0890538 3300048912 Bacteria 828
383 Ga0496112_0043478 3300048915 Bacteria 4399
384 Ga0496112_0122472 3300048915 Bacteria 2571
385 Ga0496112_0583382 3300048915 Bacteria 1050
386 Ga0496114_0306151 3300048917 Bacteria 1403
387 Ga0496114_0683435 3300048917 Bacteria 901
388 Ga0501072_0668453 3300049588 Bacteria 817
389 nmdc:mga05p37_137661_c1 3300050507 Bacteria 2993
390 nmdc:mga05p37_161735_c1 3300050507 Bacteria 2734
391 nmdc:mga05p37_21501_c1 3300050507 Bacteria 7815
392 nmdc:mga05p37_223470_c1 3300050507 Bacteria 2272
393 nmdc:mga05p37_239758_c1 3300050507 Bacteria 2181
394 nmdc:mga09592_370216_c1 3300050508 Bacteria 1239
395 nmdc:mga09592_62780_c1 3300050508 Bacteria 3143
396 nmdc:mga06r32_2607_c1 3300050510 Bacteria 16100
397 nmdc:mga06r32_4417_c1 3300050510 Bacteria 12580
398 nmdc:mga08y16_1923_c1 3300050511 Bacteria 21184
399 nmdc:mga0n895_29839_c1 3300050512 Bacteria 5205
400 nmdc:mga0n895_358703_c1 3300050512 Bacteria 1476
401 nmdc:mga0n895_544830_c1 3300050512 Bacteria 1166
402 nmdc:mga0n895_559445_c1 3300050512 Bacteria 1149
403 nmdc:mga0n895_97_c1 3300050512 Bacteria 14298
404 nmdc:mga0rr50_1787_c1 3300050513 Bacteria 11874
405 nmdc:mga0rr50_180081_c1 3300050513 Bacteria 1727
406 nmdc:mga0rr50_20_c1 3300050513 Bacteria 140799
407 nmdc:mga0rr50_23553_c1 3300050513 Bacteria 4248
408 nmdc:mga0rr50_413550_c1 3300050513 Bacteria 1140
409 nmdc:mga0rr50_468447_c1 3300050513 Bacteria 1069
410 nmdc:mga0rr50_94643_c1 3300050513 Bacteria 2333
411 nmdc:mga08x19_178_c1 3300050514 Bacteria 51286
412 nmdc:mga0a205_17424_c1 3300050515 Bacteria 6734
413 nmdc:mga0a205_241470_c1 3300050515 Bacteria 1687
414 nmdc:mga0a205_479221_c1 3300050515 Bacteria 1103
415 nmdc:mga0a205_716430_c1 3300050515 Bacteria 850
416 Ga0495619_0100265 3300053085 Bacteria 1970
417 Ga0501084_0410172 3300054114 Bacteria 1145
418 Ga0207648_10241681
419 Ga0065715_10416661
420 Ga0070683_100083884
421 Ga0070690_100145126
422 Ga0070670_100023296
423 Ga0068869_100058299
424 Ga0070666_10090631
425 Ga0070666_10091780
426 Ga0070680_100017244
427 Ga0068868_100004969
428 Ga0068868_100059667
429 Ga0068868_100071293
430 Ga0068868_100076821
431 Ga0070660_100149508
432 Ga0070660_100168288
433 Ga0070689_100615219
434 Ga0070691_10000422
435 Ga0070691_10002427
436 Ga0070661_100072712
437 Ga0070661_100096632
438 Ga0070669_100010277
439 Ga0070669_100284223
440 Ga0070669_100319753
441 Ga0070675_100089718
442 Ga0070674_100059522
443 Ga0070674_100520427
444 Ga0070673_100165093
445 Ga0070673_100255626
446 Ga0070673_100589813
447 Ga0070688_100033931
448 Ga0070659_100325164
449 Ga0070667_100082643
450 Ga0070667_100118386
451 Ga0070667_100468215
452 Ga0070714_100001779
453 Ga0070713_100003610
454 Ga0070713_100394210
455 Ga0070701_10036686
456 Ga0070701_10234291
457 Ga0070711_100047516
458 Ga0070705_100009848
459 Ga0070700_100000968
460 Ga0070694_100007673
461 Ga0070678_100640885
462 Ga0070662_100384297
463 Ga0070662_100417757
464 Ga0070681_10001569
465 Ga0070681_10005564
466 Ga0070681_10026429
467 Ga0070681_10047693
468 Ga0070681_10090152
469 Ga0068867_100036319
470 Ga0068867_100081987
471 Ga0070685_10086441
472 Ga0070685_10308231
473 Ga0070707_100102105
474 Ga0070679_100039974
475 Ga0070684_100000438
476 Ga0068853_100035910
477 Ga0070672_100263578
478 Ga0070686_100025208
479 Ga0070686_100287759
480 Ga0070695_100001952
481 Ga0070695_100065900
482 Ga0070696_100003239
483 Ga0070696_100067432
484 Ga0070696_100144763
485 Ga0070665_100010348
486 Ga0070665_100010405
487 Ga0070665_100021327
488 Ga0070704_100034141
489 Ga0070704_100037097
490 Ga0068855_100126771
491 Ga0068855_100177754
492 Ga0068855_100242279
493 Ga0068857_100006148
494 Ga0068857_100109729
495 Ga0068854_100320417
496 Ga0068854_100680713
497 Ga0068856_100001077
498 Ga0068856_100067368
499 Ga0068856_100075240
500 Ga0068856_100124855
501 Ga0070702_100004013
502 Ga0070702_100513980
503 Ga0068852_100030591
504 Ga0068852_100031871
505 Ga0068852_100261702
506 Ga0068859_100140331
507 Ga0068866_10031172
508 Ga0068861_100036460
509 Ga0068861_100313443
510 Ga0068870_10122304
511 Ga0068863_100012751
512 Ga0068863_100111139
513 Ga0068858_100004349
514 Ga0068858_100007498
515 Ga0068858_100034125
516 Ga0068858_100054838
517 Ga0068858_100088941
518 Ga0068860_100006969
519 Ga0068860_100322746
520 Ga0068860_100872491
521 Ga0068862_100011894
522 Ga0070717_10868178
523 Ga0070712_100371678
524 Ga0070712_100669005
525 Ga0097621_100003312
526 Ga0097621_100011227
527 Ga0097621_100013094
528 Ga0097621_100214225
529 Ga0097621_100572979
530 Ga0068871_100007041
531 Ga0068871_100015114
532 Ga0068871_100017256
533 Ga0068871_100129510
534 Ga0075431_100041125
535 Ga0075434_100005904
536 Ga0075434_100041660
537 Ga0075434_100145955
538 Ga0075434_100469996
539 Ga0075429_100087940
540 Ga0075429_100201828
541 Ga0068865_100013246
542 Ga0068865_100091060
543 Ga0068865_100161297
544 Ga0075436_100000295
545 Ga0075436_100021116
546 Ga0075436_100106915
547 Ga0097620_100046106
548 Ga0097620_100070479
549 Ga0097620_100140341
550 Ga0097620_101176494
551 Ga0075435_100000147
552 Ga0075435_100002653
553 Ga0075435_100014660
554 Ga0075435_100075285
555 Ga0075435_100268275
556 Ga0105240_10011792
557 Ga0105240_10057261
558 Ga0105240_10132943
559 Ga0105240_10221824
560 Ga0105240_10344174
561 Ga0105240_10345826
562 Ga0111539_10002429
563 Ga0111539_10009461
564 Ga0105245_10005530
565 Ga0105245_10017418
566 Ga0105245_10029447
567 Ga0105245_10052475
568 Ga0105247_10031266
569 Ga0105247_10065073
570 Ga0105247_10348584
571 Ga0114129_10015882
572 Ga0114129_10063086
573 Ga0114129_10220081
574 Ga0114129_10396628
575 Ga0105243_10036985
576 Ga0105243_10127842
577 Ga0105241_10003184
578 Ga0105241_10035596
579 Ga0105241_10123349
580 Ga0105241_10677703
581 Ga0105242_10037468
582 Ga0105242_10170322
583 Ga0105242_10694113
584 Ga0105248_10023159
585 Ga0105248_10054945
586 Ga0105248_10057244
587 Ga0105248_10080721
588 Ga0105248_10241320
589 Ga0105248_10735786
590 Ga0105237_10041827
591 Ga0105237_10143291
592 Ga0105238_10021153
593 Ga0105238_10068642
594 Ga0105238_10078328
595 Ga0105238_10341164
596 Ga0105239_10001226
597 Ga0105239_10025750
598 Ga0157370_10051694
599 Ga0157370_10315879
600 Ga0157369_10054021
601 Ga0157369_10278731
602 Ga0157369_10425299
603 Ga0157369_10753535
604 Ga0157374_10035730
605 Ga0157374_10429728
606 Ga0157374_10479661
607 Ga0157374_10838198
608 Ga0163162_10009499
609 Ga0163162_10096386
610 Ga0163162_10454358
611 Ga0157372_10168070
612 Ga0157375_10079422
613 Ga0157375_10247728
614 Ga0157375_10325906
615 Ga0157375_10713631
616 Ga0163163_10008581
617 Ga0163163_10008779
618 Ga0163163_10045215
619 Ga0163163_10192039
620 Ga0157379_10476179
621 Ga0157376_10007267
622 Ga0157376_10032950
623 Ga0157376_10126881
624 Ga0207642_10028573
625 Ga0207710_10028881
626 Ga0207680_10260917
627 Ga0207685_10034110
628 Ga0207699_10133979
629 Ga0207645_10004101
630 Ga0207645_10112553
631 Ga0207654_10009981
632 Ga0207654_10054327
633 Ga0207654_10411534
634 Ga0207707_10003367
635 Ga0207707_10003371
636 Ga0207707_10445546
637 Ga0207695_10001639
638 Ga0207695_10010571
639 Ga0207695_10038343
640 Ga0207695_10089357
641 Ga0207695_10236823
642 Ga0207695_10324799
643 Ga0207695_10563384
644 Ga0207671_10066455
645 Ga0207671_10116162
646 Ga0207693_10333191
647 Ga0207660_10051703
648 Ga0207660_10132409
649 Ga0207660_10282112
650 Ga0207657_10022480
651 Ga0207657_10027038
652 Ga0207657_10046274
653 Ga0207649_10056175
654 Ga0207652_10041915
655 Ga0207652_10054116
656 Ga0207652_10058759
657 Ga0207646_10029458
658 Ga0207681_10015007
659 Ga0207681_10467983
660 Ga0207694_10001085
661 Ga0207694_10010267
662 Ga0207650_10101612
663 Ga0207659_10640297
664 Ga0207687_10005509
665 Ga0207687_10042162
666 Ga0207687_10055543
667 Ga0207687_10090225
668 Ga0207700_10001595
669 Ga0207700_10503409
670 Ga0207664_10041319
671 Ga0207644_10043246
672 Ga0207690_10160405
673 Ga0207690_10383343
674 Ga0207706_10114173
675 Ga0207686_10008068
676 Ga0207686_10018918
677 Ga0207686_10039604
678 Ga0207686_10155632
679 Ga0207709_10018897
680 Ga0207670_10101117
681 Ga0207669_10266480
682 Ga0207704_10105651
683 Ga0207704_10117773
684 Ga0207704_10237398
685 Ga0207704_10498735
686 Ga0207665_10140427
687 Ga0207691_10099847
688 Ga0207691_10280601
689 Ga0207711_10030976
690 Ga0207711_10045233
691 Ga0207711_10056899
692 Ga0207711_10117399
693 Ga0207711_10434762
694 Ga0207689_10056308
695 Ga0207661_10065592
696 Ga0207661_10080038
697 Ga0207667_10000483
698 Ga0207667_10224291
699 Ga0207667_10278398
700 Ga0207667_10297298
701 Ga0207667_10351979
702 Ga0207667_10845684
703 Ga0207651_10001596
704 Ga0207651_10531461
705 Ga0207651_10603206
706 Ga0207651_10765524
707 Ga0207712_10120712
708 Ga0207640_10015361
709 Ga0207658_10003889
710 Ga0207658_10041122
711 Ga0207658_10093379
712 Ga0207677_10021072
713 Ga0207677_10023835
714 Ga0207677_10058292
715 Ga0207703_10021169
716 Ga0207703_10021312
717 Ga0207703_10024618
718 Ga0207703_10073881
719 Ga0207639_10006242
720 Ga0207639_10100765
721 Ga0207708_10002926
722 Ga0207708_10014763
723 Ga0207702_10003479
724 Ga0207702_10034059
725 Ga0207702_10125450
726 Ga0207702_10138067
727 Ga0207702_10785745
728 Ga0207641_10017364
729 Ga0207641_10037773
730 Ga0207648_10015050
731 Ga0207648_10039618
732 Ga0207676_10011334
733 Ga0207676_10212259
734 Ga0207676_10408417
735 Ga0207674_10000097
736 Ga0207674_10012753
737 Ga0207674_10276322
738 Ga0207675_100024246
739 Ga0207675_100184627
740 Ga0207675_100512980
741 Ga0207683_10005213
742 Ga0207683_10217440
743 Ga0207698_10037605
744 Ga0207698_10041994
745 Ga0207698_10181436
746 Ga0207428_10014844
747 Ga0268266_10002664
748 Ga0268266_10007559
749 Ga0268266_10013799
750 Ga0268266_10056569
751 Ga0268266_10537893
752 Ga0268265_10023742
753 Ga0268264_10009504
754 Ga0268264_10606080
755 Ga0268264_10952626
756 Ga0265313_10211248
757 Ga0265314_10025491
758 Ga0316578_10108867
759 Ga0373948_0002269
760 Ga0373950_0050027
761 Ga0373958_0007133
762 Ga0373959_0009272
763 Ga0373926_0121600
764 Ga0373928_0016619
765 Ga0373929_0005038
766 Ga0373949_0003582
767 Ga0373951_0015969
768 Ga0373923_0036512
769 Ga0373932_0004536
770 Ga0373939_0108407
771 Ga0373954_0000785
772 Ga0373960_0008640
773 Ga0373955_0063356
774 Ga0373955_0139493
775 Ga0373942_0020741
776 Ga0373961_0007408
777 Ga0373931_0022729
778 Ga0373935_0428711
779 Ga0373937_0023028
780 Ga0373937_0023369
781 Ga0373937_0085786
782 Ga0373925_0040196
783 Ga0395905_0499374
784 Ga0466967_0361343
785 Ga0495629_0017266
786 Ga0495580_0172114
787 Ga0495666_0195959
788 Ga0495667_0082680
789 Ga0495599_0003711
790 Ga0495647_0096647
791 Ga0495658_0063690
792 Ga0495674_0072167
793 Ga0495614_0158089
794 Ga0496100_0168862
795 Ga0496102_0437429
796 Ga0496104_0049439
797 Ga0496104_0111339
798 Ga0496106_0293321
799 Ga0496109_0890538
800 Ga0496112_0043478
801 Ga0496112_0122472
802 Ga0496112_0583382
803 Ga0496114_0306151
804 Ga0496114_0683435
805 Ga0501072_0668453
806 nmdc:mga05p37_137661_c1
807 nmdc:mga05p37_161735_c1
808 nmdc:mga05p37_21501_c1
809 nmdc:mga05p37_223470_c1
810 nmdc:mga05p37_239758_c1
811 nmdc:mga09592_370216_c1
812 nmdc:mga09592_62780_c1
813 nmdc:mga06r32_2607_c1
814 nmdc:mga06r32_4417_c1
815 nmdc:mga08y16_1923_c1
816 nmdc:mga0n895_29839_c1
817 nmdc:mga0n895_358703_c1
818 nmdc:mga0n895_544830_c1
819 nmdc:mga0n895_559445_c1
820 nmdc:mga0n895_97_c1
821 nmdc:mga0rr50_1787_c1
822 nmdc:mga0rr50_180081_c1
823 nmdc:mga0rr50_20_c1
824 nmdc:mga0rr50_23553_c1
825 nmdc:mga0rr50_413550_c1
826 nmdc:mga0rr50_468447_c1
827 nmdc:mga0rr50_94643_c1
828 nmdc:mga08x19_178_c1
829 nmdc:mga0a205_17424_c1
830 nmdc:mga0a205_241470_c1
831 nmdc:mga0a205_479221_c1
832 nmdc:mga0a205_716430_c1
833 Ga0495619_0100265
834 Ga0501084_0410172

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

46

195

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9761 2 227
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.973 5 226
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9682 4 226
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9675 2 227
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9629 2 224
ID Description Score Start End Superfamily
af_A4I4M8_123_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9816 30 228 3.40.50.300
af_Q8T664_36_360_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9798 2 226 3.40.50.300
af_Q4DP20_46_317_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9791 2 228 3.40.50.300
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9763 2 221 3.40.50.300
af_P14175_33_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9757 20 227 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A843EBV0-F1-model_v4 ABC transporter ATP-binding protein 0.9868 28 227 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A7V9TM51-F1-model_v4 ABC transporter ATP-binding protein 0.9859 22 226 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A9KJN2-F1-model_v4 ABC transporter related 0.9837 2 226 GO:0005524
GO:0016887
AF-A0A078KQB6-F1-model_v4 Bacitracin export ATP-binding protein BceA 0.9826 2 223 GO:0005524
GO:0016887
AF-A0A2V5X8W1-F1-model_v4 ABC transporter 0.9826 3 223 GO:0005524
GO:0005886
GO:0016887
GO:0022857

Map