F438963

General Info

Members Datasets Scaffolds Average Seq Length
417 199 834 66

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10469345|Ga0065715_104693452
Length 73
Sequence MLEGLFQPMHLLVIFFIALLVFGPKKLPELGKGIGEGIRALKDSMKEGAAEPPTTAATDVKSTAPADLSNRPS

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
85 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
87 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
90 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
91 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
92 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
128 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
139 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
140 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
141 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
142 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
143 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
158 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
159 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
160 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
168 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
178 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.4
Metatranscriptomes 3.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.47
Rhizosphere 90.41
Stem 0
Stem Tuber 0
Unclassified 59.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10469345 3300005293 Unclassified 808
2 MBSR1b_contig_10223005 2162886012 Unclassified 976
3 Ga0065712_10173137 3300005290 Unclassified 1232
4 Ga0065712_10718931 3300005290 Bacteria 540
5 Ga0065715_10199952 3300005293 Bacteria 1350
6 Ga0065715_10672151 3300005293 Bacteria 667
7 Ga0070658_10695323 3300005327 Unclassified 882
8 Ga0070683_101096011 3300005329 Unclassified 765
9 Ga0070690_100296079 3300005330 Unclassified 1159
10 Ga0070670_100240755 3300005331 Bacteria 1575
11 Ga0068869_100799548 3300005334 Unclassified 810
12 Ga0070666_10958473 3300005335 Unclassified 634
13 Ga0070682_100460309 3300005337 Unclassified 976
14 Ga0068868_100193717 3300005338 Unclassified 1691
15 Ga0070660_100057574 3300005339 Bacteria 3011
16 Ga0070687_100470496 3300005343 Unclassified 840
17 Ga0070661_100099739 3300005344 Bacteria 2158
18 Ga0070668_100932627 3300005347 Unclassified 777
19 Ga0070669_100877907 3300005353 Unclassified 765
20 Ga0070671_100172836 3300005355 Unclassified 1827
21 Ga0070709_10239418 3300005434 Unclassified 1302
22 Ga0070709_10271991 3300005434 Unclassified 1228
23 Ga0070709_10373844 3300005434 Unclassified 1058
24 Ga0070709_10626852 3300005434 Unclassified 830
25 Ga0070709_11361653 3300005434 Unclassified 574
26 Ga0070709_11523503 3300005434 Unclassified 543
27 Ga0070714_100460041 3300005435 Bacteria 1209
28 Ga0070714_100592510 3300005435 Bacteria 1064
29 Ga0070714_100688994 3300005435 Bacteria 985
30 Ga0070714_101037553 3300005435 Bacteria 798
31 Ga0070714_101301931 3300005435 Unclassified 709
32 Ga0070714_101642230 3300005435 Unclassified 628
33 Ga0070714_102300424 3300005435 Bacteria 524
34 Ga0070713_100011439 3300005436 Bacteria 6464
35 Ga0070713_100043510 3300005436 Bacteria 3672
36 Ga0070713_100044533 3300005436 Unclassified 3633
37 Ga0070713_100061842 3300005436 Unclassified 3134
38 Ga0070713_100122047 3300005436 Bacteria 2287
39 Ga0070713_100135943 3300005436 Bacteria 2172
40 Ga0070713_100341920 3300005436 Bacteria 1386
41 Ga0070713_100681650 3300005436 Unclassified 980
42 Ga0070713_101540725 3300005436 Bacteria 645
43 Ga0070713_101869206 3300005436 Unclassified 583
44 Ga0070710_10002678 3300005437 Bacteria 8464
45 Ga0070710_10161002 3300005437 Bacteria 1392
46 Ga0070710_10238549 3300005437 Unclassified 1164
47 Ga0070710_10266162 3300005437 Bacteria 1107
48 Ga0070710_10327969 3300005437 Unclassified 1007
49 Ga0070711_100050305 3300005439 Bacteria 2857
50 Ga0070711_100193801 3300005439 Unclassified 1563
51 Ga0070705_100130219 3300005440 Bacteria 1640
52 Ga0070705_100800028 3300005440 Unclassified 750
53 Ga0070705_101257241 3300005440 Unclassified 612
54 Ga0070705_101689949 3300005440 Unclassified 535
55 Ga0070708_100000927 3300005445 Bacteria 22190
56 Ga0070708_100012424 3300005445 Bacteria 6952
57 Ga0070708_100073565 3300005445 Unclassified 3081
58 Ga0070708_100188469 3300005445 Bacteria 1929
59 Ga0070708_100307638 3300005445 Bacteria 1492
60 Ga0070708_100394761 3300005445 Unclassified 1304
61 Ga0070708_100464833 3300005445 Unclassified 1193
62 Ga0070708_100513684 3300005445 Bacteria 1130
63 Ga0070708_101322642 3300005445 Unclassified 673
64 Ga0070663_100241866 3300005455 Bacteria 1425
65 Ga0070662_100904911 3300005457 Unclassified 753
66 Ga0070681_10125560 3300005458 Bacteria 2499
67 Ga0070706_100000477 3300005467 Bacteria 47320
68 Ga0070706_100102861 3300005467 Bacteria 2656
69 Ga0070706_100183040 3300005467 Unclassified 1957
70 Ga0070706_100231017 3300005467 Bacteria 1727
71 Ga0070707_100046380 3300005468 Bacteria 4159
72 Ga0070707_100140001 3300005468 Bacteria 2355
73 Ga0070707_100462276 3300005468 Bacteria 1230
74 Ga0070707_100562351 3300005468 Unclassified 1103
75 Ga0070707_100713296 3300005468 Unclassified 966
76 Ga0070707_101131159 3300005468 Bacteria 749
77 Ga0070698_100097680 3300005471 Unclassified 2913
78 Ga0070698_100330986 3300005471 Bacteria 1454
79 Ga0070699_100061085 3300005518 Unclassified 3266
80 Ga0070699_100076417 3300005518 Bacteria 2915
81 Ga0070699_100136591 3300005518 Unclassified 2163
82 Ga0070699_100606044 3300005518 Bacteria 999
83 Ga0070699_101704839 3300005518 Unclassified 577
84 Ga0070699_101776443 3300005518 Unclassified 564
85 Ga0070699_101836005 3300005518 Unclassified 555
86 Ga0070679_100963461 3300005530 Unclassified 797
87 Ga0070684_100597337 3300005535 Unclassified 1026
88 Ga0070697_100000844 3300005536 Bacteria 23029
89 Ga0070697_100006919 3300005536 Bacteria 8817
90 Ga0070697_100066603 3300005536 Unclassified 2945
91 Ga0070697_100239803 3300005536 Unclassified 1548
92 Ga0070697_100265814 3300005536 Unclassified 1469
93 Ga0070697_100318259 3300005536 Unclassified 1339
94 Ga0070697_100371252 3300005536 Unclassified 1238
95 Ga0070697_100418531 3300005536 Unclassified 1164
96 Ga0070697_100430354 3300005536 Bacteria 1147
97 Ga0070697_100720665 3300005536 Unclassified 881
98 Ga0068853_100073901 3300005539 Bacteria 2973
99 Ga0070695_100570552 3300005545 Unclassified 884
100 Ga0070695_101288769 3300005545 Unclassified 603
101 Ga0070696_100769883 3300005546 Unclassified 790
102 Ga0070693_100248840 3300005547 Bacteria 1177
103 Ga0068855_100200839 3300005563 Bacteria 2244
104 Ga0070664_100015127 3300005564 Bacteria 6301
105 Ga0068857_100886752 3300005577 Unclassified 855
106 Ga0068856_100268344 3300005614 Unclassified 1722
107 Ga0068856_100488667 3300005614 Bacteria 1252
108 Ga0068852_100632039 3300005616 Bacteria 1077
109 Ga0068864_100421695 3300005618 Unclassified 1272
110 Ga0068851_10321809 3300005834 Unclassified 894
111 Ga0068863_100777738 3300005841 Unclassified 954
112 Ga0068863_100786742 3300005841 Bacteria 948
113 Ga0068863_102027837 3300005841 Unclassified 585
114 Ga0068858_100194861 3300005842 Bacteria 1915
115 Ga0068858_100916760 3300005842 Unclassified 857
116 Ga0081540_1134576 3300005983 Unclassified 1003
117 Ga0070717_10022499 3300006028 Unclassified 4982
118 Ga0070717_10031994 3300006028 Bacteria 4236
119 Ga0070717_10276229 3300006028 Bacteria 1489
120 Ga0070717_10337676 3300006028 Unclassified 1345
121 Ga0070717_10463705 3300006028 Bacteria 1143
122 Ga0070717_10580487 3300006028 Bacteria 1016
123 Ga0070717_11161451 3300006028 Unclassified 703
124 Ga0070717_11441384 3300006028 Unclassified 625
125 Ga0070715_10006547 3300006163 Bacteria 3968
126 Ga0070715_10155747 3300006163 Unclassified 1124
127 Ga0070715_10199087 3300006163 Unclassified 1016
128 Ga0070715_10275168 3300006163 Bacteria 890
129 Ga0070715_10634162 3300006163 Unclassified 631
130 Ga0070715_10814899 3300006163 Unclassified 568
131 Ga0070716_100003428 3300006173 Bacteria 7456
132 Ga0070716_100010838 3300006173 Unclassified 4583
133 Ga0070716_100108423 3300006173 Unclassified 1716
134 Ga0070716_100239189 3300006173 Unclassified 1230
135 Ga0070716_100338707 3300006173 Bacteria 1060
136 Ga0070716_100372718 3300006173 Unclassified 1018
137 Ga0070716_100510372 3300006173 Unclassified 889
138 Ga0070716_100722674 3300006173 Unclassified 763
139 Ga0070712_100021313 3300006175 Bacteria 4255
140 Ga0070712_100025456 3300006175 Bacteria 3933
141 Ga0070712_100265637 3300006175 Bacteria 1377
142 Ga0070712_100359875 3300006175 Bacteria 1193
143 Ga0070712_100885716 3300006175 Unclassified 769
144 Ga0070712_101424026 3300006175 Unclassified 605
145 Ga0070712_101450792 3300006175 Unclassified 599
146 Ga0070712_101579104 3300006175 Unclassified 574
147 Ga0097621_100236665 3300006237 Unclassified 1595
148 Ga0097621_100318809 3300006237 Unclassified 1376
149 Ga0097621_100515064 3300006237 Unclassified 1085
150 Ga0097621_101846630 3300006237 Unclassified 576
151 Ga0068871_100501362 3300006358 Bacteria 1094
152 Ga0075433_10044142 3300006852 Bacteria 3873
153 Ga0075434_100002865 3300006871 Bacteria 15297
154 Ga0075436_100010701 3300006914 Bacteria 6292
155 Ga0075436_100363820 3300006914 Unclassified 1044
156 Ga0075435_100060074 3300007076 Bacteria 3081
157 Ga0075435_100832067 3300007076 Unclassified 804
158 Ga0075435_100999337 3300007076 Unclassified 730
159 Ga0099795_10235823 3300007788 Unclassified 784
160 Ga0099795_10366416 3300007788 Unclassified 648
161 Ga0105251_10573782 3300009011 Unclassified 533
162 Ga0105240_11714240 3300009093 Unclassified 656
163 Ga0105240_12503489 3300009093 Unclassified 534
164 Ga0105247_10113899 3300009101 Unclassified 1744
165 Ga0105243_12435494 3300009148 Unclassified 562
166 Ga0105241_10022394 3300009174 Bacteria 4680
167 Ga0105241_10094989 3300009174 Bacteria 2359
168 Ga0105248_10221193 3300009177 Bacteria 2131
169 Ga0105248_10776885 3300009177 Bacteria 1081
170 Ga0105248_11180732 3300009177 Unclassified 865
171 Ga0105237_10138237 3300009545 Unclassified 2431
172 Ga0105238_10034673 3300009551 Bacteria 5134
173 Ga0099796_10430970 3300010159 Unclassified 583
174 Ga0105239_10020221 3300010375 Bacteria 7344
175 Ga0105239_10684491 3300010375 Unclassified 1172
176 Ga0157373_10066693 3300013100 Bacteria 2545
177 Ga0157370_10166663 3300013104 Unclassified 2049
178 Ga0157369_11071096 3300013105 Unclassified 824
179 Ga0157374_10017602 3300013296 Bacteria 6293
180 Ga0157378_10207122 3300013297 Bacteria 1858
181 Ga0157378_11000414 3300013297 Unclassified 870
182 Ga0163162_10675036 3300013306 Bacteria 1156
183 Ga0163162_11708070 3300013306 Unclassified 719
184 Ga0157372_10303708 3300013307 Unclassified 1857
185 Ga0163163_10156043 3300014325 Bacteria 2327
186 Ga0163163_10426941 3300014325 Bacteria 1384
187 Ga0182008_10020622 3300014497 Bacteria 3391
188 Ga0157377_11591451 3300014745 Unclassified 523
189 Ga0157379_10157343 3300014968 Unclassified 2050
190 Ga0157376_10003549 3300014969 Bacteria 10752
191 Ga0157376_10400433 3300014969 Bacteria 1327
192 Ga0157376_10696505 3300014969 Unclassified 1020
193 Ga0182006_1116976 3300015261 Unclassified 930
194 Ga0182007_10013295 3300015262 Unclassified 3143
195 Ga0182005_1072964 3300015265 Unclassified 943
196 Ga0184601_107114 3300019183 Unclassified 503
197 Ga0213873_10001756 3300021358 Unclassified 3644
198 Ga0213874_10189431 3300021377 Bacteria 735
199 Ga0213876_10440567 3300021384 Unclassified 693
200 Ga0224569_110012 3300022732 Unclassified 670
201 Ga0224571_109639 3300022734 Unclassified 664
202 Ga0224572_1002171 3300024225 Bacteria 3108
203 Ga0224572_1076983 3300024225 Bacteria 616
204 Ga0228598_1003146 3300024227 Unclassified 3573
205 Ga0207692_10066638 3300025898 Unclassified 1883
206 Ga0207692_10389784 3300025898 Unclassified 866
207 Ga0207692_10564301 3300025898 Unclassified 729
208 Ga0207692_10712342 3300025898 Unclassified 652
209 Ga0207710_10087190 3300025900 Unclassified 1455
210 Ga0207685_10160446 3300025905 Unclassified 1026
211 Ga0207685_10191506 3300025905 Unclassified 955
212 Ga0207685_10641193 3300025905 Unclassified 574
213 Ga0207699_10021344 3300025906 Bacteria 3488
214 Ga0207699_10040904 3300025906 Bacteria 2674
215 Ga0207699_10072625 3300025906 Unclassified 2108
216 Ga0207699_10262879 3300025906 Unclassified 1193
217 Ga0207699_10475901 3300025906 Unclassified 899
218 Ga0207699_11275424 3300025906 Unclassified 544
219 Ga0207699_11330849 3300025906 Unclassified 532
220 Ga0207705_11054043 3300025909 Unclassified 627
221 Ga0207684_10005893 3300025910 Bacteria 11224
222 Ga0207684_10095337 3300025910 Unclassified 2539
223 Ga0207684_10135977 3300025910 Bacteria 2110
224 Ga0207684_10185327 3300025910 Bacteria 1795
225 Ga0207654_10295088 3300025911 Bacteria 1101
226 Ga0207654_10365088 3300025911 Bacteria 997
227 Ga0207707_11000363 3300025912 Unclassified 686
228 Ga0207695_10318092 3300025913 Unclassified 1446
229 Ga0207671_11524543 3300025914 Unclassified 516
230 Ga0207693_10011133 3300025915 Bacteria 7286
231 Ga0207693_10029683 3300025915 Bacteria 4317
232 Ga0207693_10242496 3300025915 Unclassified 1415
233 Ga0207693_10312033 3300025915 Bacteria 1231
234 Ga0207693_10629457 3300025915 Unclassified 834
235 Ga0207693_11184221 3300025915 Unclassified 577
236 Ga0207693_11443895 3300025915 Unclassified 509
237 Ga0207663_10045679 3300025916 Bacteria 2695
238 Ga0207663_10419376 3300025916 Bacteria 1027
239 Ga0207663_10490917 3300025916 Bacteria 953
240 Ga0207663_10676305 3300025916 Unclassified 816
241 Ga0207662_10468707 3300025918 Unclassified 863
242 Ga0207657_10008400 3300025919 Bacteria 10483
243 Ga0207649_10068774 3300025920 Unclassified 2253
244 Ga0207646_10279863 3300025922 Unclassified 1508
245 Ga0207646_10568031 3300025922 Unclassified 1019
246 Ga0207646_10679907 3300025922 Unclassified 921
247 Ga0207646_10958637 3300025922 Unclassified 757
248 Ga0207681_10450793 3300025923 Unclassified 1047
249 Ga0207694_10169526 3300025924 Unclassified 1767
250 Ga0207700_10066199 3300025928 Unclassified 2761
251 Ga0207700_10106964 3300025928 Bacteria 2244
252 Ga0207700_10155696 3300025928 Unclassified 1893
253 Ga0207700_10222789 3300025928 Unclassified 1600
254 Ga0207700_10235167 3300025928 Bacteria 1559
255 Ga0207700_10250189 3300025928 Unclassified 1514
256 Ga0207700_10430150 3300025928 Unclassified 1161
257 Ga0207700_11086596 3300025928 Unclassified 715
258 Ga0207700_11414043 3300025928 Bacteria 618
259 Ga0207664_10429451 3300025929 Bacteria 1177
260 Ga0207664_10629911 3300025929 Bacteria 964
261 Ga0207664_10881765 3300025929 Unclassified 804
262 Ga0207664_11414905 3300025929 Unclassified 616
263 Ga0207644_10401204 3300025931 Unclassified 1121
264 Ga0207690_11220011 3300025932 Unclassified 628
265 Ga0207706_10064448 3300025933 Bacteria 3226
266 Ga0207665_10005217 3300025939 Bacteria 8679
267 Ga0207665_10006735 3300025939 Bacteria 7616
268 Ga0207665_10169906 3300025939 Unclassified 1574
269 Ga0207665_10189386 3300025939 Bacteria 1494
270 Ga0207665_10300740 3300025939 Bacteria 1199
271 Ga0207665_10743922 3300025939 Unclassified 773
272 Ga0207665_10745950 3300025939 Unclassified 772
273 Ga0207665_11126976 3300025939 Unclassified 626
274 Ga0207665_11378440 3300025939 Unclassified 562
275 Ga0207711_10490525 3300025941 Bacteria 1145
276 Ga0207711_10626158 3300025941 Bacteria 1004
277 Ga0207711_10804280 3300025941 Unclassified 876
278 Ga0207679_10156004 3300025945 Bacteria 1864
279 Ga0207640_10049807 3300025981 Unclassified 2714
280 Ga0207703_10851971 3300026035 Unclassified 871
281 Ga0207639_10339292 3300026041 Unclassified 1339
282 Ga0207702_11503269 3300026078 Unclassified 667
283 Ga0207641_10848367 3300026088 Bacteria 905
284 Ga0207641_11039437 3300026088 Unclassified 817
285 Ga0207641_11832931 3300026088 Unclassified 608
286 Ga0207676_10523904 3300026095 Unclassified 1129
287 Ga0207674_10417576 3300026116 Unclassified 1296
288 Ga0207698_10858047 3300026142 Unclassified 913
289 Ga0265356_1000075 3300028017 Bacteria 16301
290 Ga0265355_1021603 3300028036 Unclassified 558
291 Ga0265338_10055888 3300028800 Unclassified 3507
292 Ga0265338_10068188 3300028800 Bacteria 3067
293 Ga0265338_10417740 3300028800 Unclassified 954
294 Ga0265762_1001256 3300030760 Unclassified 4608
295 Ga0265762_1002802 3300030760 Unclassified 3117
296 Ga0265766_1002896 3300030863 Unclassified 977
297 Ga0265770_1015204 3300030878 Unclassified 1168
298 Ga0265770_1121271 3300030878 Unclassified 550
299 Ga0265765_1022745 3300030879 Bacteria 766
300 Ga0265771_1023276 3300031010 Bacteria 552
301 Ga0265760_10000493 3300031090 Bacteria 11083
302 Ga0265760_10001000 3300031090 Bacteria 8197
303 Ga0265760_10001057 3300031090 Bacteria 7988
304 Ga0265760_10041890 3300031090 Bacteria 1366
305 Ga0265760_10365387 3300031090 Unclassified 518
306 Ga0265325_10034709 3300031241 Unclassified 2682
307 Ga0265314_10334897 3300031711 Unclassified 838
308 Ga0265342_10026595 3300031712 Bacteria 3623
309 Ga0316215_1010294 3300033544 Unclassified 924
310 Ga0316214_1008143 3300033545 Unclassified 1408
311 Ga0316212_1006421 3300033547 Bacteria 1703
312 Ga0373926_0010190 3300035083 Bacteria 3146
313 Ga0373923_0357555 3300035111 Unclassified 698
314 Ga0373936_0003816 3300035113 Bacteria 5677
315 Ga0373936_0368262 3300035113 Bacteria 656
316 Ga0373943_0130270 3300035170 Unclassified 1345
317 Ga0373943_0440778 3300035170 Unclassified 756
318 Ga0373955_0061177 3300035172 Unclassified 2079
319 Ga0373931_0046257 3300035691 Bacteria 2300
320 Ga0373931_0515878 3300035691 Unclassified 773
321 Ga0373931_0537437 3300035691 Unclassified 758
322 Ga0373935_0218088 3300035692 Unclassified 1324
323 Ga0373935_1260270 3300035692 Unclassified 552
324 Ga0373935_1381757 3300035692 Bacteria 526
325 Ga0373927_0046104 3300035695 Bacteria 2821
326 Ga0373933_0398276 3300035724 Unclassified 898
327 Ga0373933_0477210 3300035724 Bacteria 816
328 Ga0373947_0009317 3300035725 Bacteria 5640
329 Ga0373947_0266642 3300035725 Unclassified 1136
330 Ga0373947_0932192 3300035725 Unclassified 593
331 Ga0373937_0246149 3300036401 Unclassified 1685
332 Ga0373937_1293049 3300036401 Bacteria 677
333 Ga0373925_0037285 3300037068 Bacteria 3588
334 Ga0373925_0438265 3300037068 Unclassified 1069
335 Ga0395905_0329617 3300037471 Bacteria 1417
336 Ga0436364_0040206 3300037853 Bacteria 680
337 Ga0436365_0021545 3300039437 Unclassified 761
338 Ga0436365_0152901 3300039437 Unclassified 668
339 Ga0436360_0612571 3300039438 Unclassified 587
340 Ga0436360_1237914 3300039438 Bacteria 1078
341 Ga0436363_0567579 3300039450 Bacteria 740
342 Ga0436363_0874904 3300039450 Unclassified 708
343 Ga0436363_0904344 3300039450 Bacteria 1138
344 Ga0436363_1294213 3300039450 Unclassified 506
345 Ga0436363_1585664 3300039450 Bacteria 5436
346 Ga0436362_0156081 3300039453 Bacteria 10143
347 Ga0466964_0052313 3300044706 Bacteria 1679
348 Ga0466964_0549439 3300044706 Unclassified 627
349 Ga0466970_0399357 3300044765 Unclassified 784
350 Ga0495592_0413148 3300046454 Unclassified 852
351 Ga0495580_0000854 3300046472 Bacteria 26345
352 Ga0495580_0004286 3300046472 Bacteria 11997
353 Ga0495580_0005262 3300046472 Bacteria 10749
354 Ga0495580_0014949 3300046472 Bacteria 5877
355 Ga0495580_0314389 3300046472 Unclassified 1065
356 Ga0495580_0573303 3300046472 Bacteria 748
357 Ga0495580_0782057 3300046472 Unclassified 620
358 Ga0495580_0893374 3300046472 Bacteria 571
359 Ga0495582_0001260 3300046473 Bacteria 14236
360 Ga0495582_0089913 3300046473 Bacteria 1712
361 Ga0495639_0027835 3300046475 Bacteria 2502
362 Ga0495630_0284670 3300046517 Unclassified 1263
363 Ga0495630_0338375 3300046517 Bacteria 1151
364 Ga0495630_0391282 3300046517 Unclassified 1065
365 Ga0495642_0427110 3300046528 Unclassified 585
366 Ga0495665_0003173 3300046531 Bacteria 8898
367 Ga0495667_0788660 3300046559 Bacteria 586
368 Ga0495634_0338315 3300046642 Unclassified 903
369 Ga0495635_0705667 3300046663 Unclassified 654
370 Ga0495658_0708973 3300046683 Unclassified 644
371 Ga0495669_0244210 3300046684 Bacteria 862
372 Ga0495624_0170523 3300046690 Unclassified 1328
373 Ga0495624_0374864 3300046690 Unclassified 855
374 Ga0495581_0103650 3300047315 Bacteria 1653
375 Ga0495674_0042929 3300047319 Unclassified 4029
376 Ga0495674_1020794 3300047319 Unclassified 633
377 Ga0495602_0543611 3300048088 Bacteria 806
378 Ga0495614_0462666 3300048089 Unclassified 601
379 Ga0496100_0678105 3300048903 Unclassified 804
380 Ga0496100_0774723 3300048903 Unclassified 751
381 Ga0496101_0056836 3300048904 Bacteria 2829
382 Ga0496101_0111034 3300048904 Bacteria 2064
383 Ga0496102_0003159 3300048905 Bacteria 13972
384 Ga0496102_0842975 3300048905 Bacteria 839
385 Ga0496102_0864320 3300048905 Unclassified 826
386 Ga0496103_0012393 3300048906 Bacteria 5057
387 Ga0496104_0091024 3300048907 Unclassified 2915
388 Ga0496104_0228006 3300048907 Unclassified 1775
389 Ga0496104_0331095 3300048907 Unclassified 1436
390 Ga0496104_1100168 3300048907 Bacteria 698
391 Ga0496105_0352647 3300048908 Bacteria 1175
392 Ga0496105_0511135 3300048908 Unclassified 942
393 Ga0496105_1030693 3300048908 Unclassified 614
394 Ga0496106_0029947 3300048909 Bacteria 4058
395 Ga0496106_1476808 3300048909 Unclassified 523
396 Ga0496107_0242653 3300048910 Unclassified 1341
397 Ga0496108_0181093 3300048911 Unclassified 1825
398 Ga0496109_0291773 3300048912 Unclassified 1538
399 Ga0496109_1045311 3300048912 Unclassified 754
400 Ga0496110_0187469 3300048913 Unclassified 1878
401 Ga0496111_0033510 3300048914 Unclassified 3664
402 Ga0496112_0014580 3300048915 Bacteria 7302
403 Ga0496112_0613213 3300048915 Unclassified 1019
404 Ga0496113_0149368 3300048916 Bacteria 1843
405 Ga0496115_1063726 3300048918 Unclassified 615
406 nmdc:mga0n895_1052693_c1 3300050512 Unclassified 793
407 nmdc:mga0n895_780961_c1 3300050512 Bacteria 947
408 nmdc:mga0rr50_1130671_c1 3300050513 Unclassified 666
409 nmdc:mga0rr50_1150047_c1 3300050513 Unclassified 660
410 nmdc:mga0rr50_1209908_c1 3300050513 Unclassified 642
411 nmdc:mga0rr50_8678_c1 3300050513 Bacteria 6338
412 nmdc:mga08x19_409028_c1 3300050514 Unclassified 952
413 nmdc:mga08x19_518896_c1 3300050514 Unclassified 842
414 nmdc:mga08x19_5544_c1 3300050514 Bacteria 7462
415 nmdc:mga0a205_56832_c1 3300050515 Bacteria 3778
416 Ga0587066_214969 3300059490 Unclassified 513
417 Ga0587071_210507 3300060344 Unclassified 513
418 Ga0065715_10469345
419 MBSR1b_contig_10223005
420 Ga0065712_10173137
421 Ga0065712_10718931
422 Ga0065715_10199952
423 Ga0065715_10672151
424 Ga0070658_10695323
425 Ga0070683_101096011
426 Ga0070690_100296079
427 Ga0070670_100240755
428 Ga0068869_100799548
429 Ga0070666_10958473
430 Ga0070682_100460309
431 Ga0068868_100193717
432 Ga0070660_100057574
433 Ga0070687_100470496
434 Ga0070661_100099739
435 Ga0070668_100932627
436 Ga0070669_100877907
437 Ga0070671_100172836
438 Ga0070709_10239418
439 Ga0070709_10271991
440 Ga0070709_10373844
441 Ga0070709_10626852
442 Ga0070709_11361653
443 Ga0070709_11523503
444 Ga0070714_100460041
445 Ga0070714_100592510
446 Ga0070714_100688994
447 Ga0070714_101037553
448 Ga0070714_101301931
449 Ga0070714_101642230
450 Ga0070714_102300424
451 Ga0070713_100011439
452 Ga0070713_100043510
453 Ga0070713_100044533
454 Ga0070713_100061842
455 Ga0070713_100122047
456 Ga0070713_100135943
457 Ga0070713_100341920
458 Ga0070713_100681650
459 Ga0070713_101540725
460 Ga0070713_101869206
461 Ga0070710_10002678
462 Ga0070710_10161002
463 Ga0070710_10238549
464 Ga0070710_10266162
465 Ga0070710_10327969
466 Ga0070711_100050305
467 Ga0070711_100193801
468 Ga0070705_100130219
469 Ga0070705_100800028
470 Ga0070705_101257241
471 Ga0070705_101689949
472 Ga0070708_100000927
473 Ga0070708_100012424
474 Ga0070708_100073565
475 Ga0070708_100188469
476 Ga0070708_100307638
477 Ga0070708_100394761
478 Ga0070708_100464833
479 Ga0070708_100513684
480 Ga0070708_101322642
481 Ga0070663_100241866
482 Ga0070662_100904911
483 Ga0070681_10125560
484 Ga0070706_100000477
485 Ga0070706_100102861
486 Ga0070706_100183040
487 Ga0070706_100231017
488 Ga0070707_100046380
489 Ga0070707_100140001
490 Ga0070707_100462276
491 Ga0070707_100562351
492 Ga0070707_100713296
493 Ga0070707_101131159
494 Ga0070698_100097680
495 Ga0070698_100330986
496 Ga0070699_100061085
497 Ga0070699_100076417
498 Ga0070699_100136591
499 Ga0070699_100606044
500 Ga0070699_101704839
501 Ga0070699_101776443
502 Ga0070699_101836005
503 Ga0070679_100963461
504 Ga0070684_100597337
505 Ga0070697_100000844
506 Ga0070697_100006919
507 Ga0070697_100066603
508 Ga0070697_100239803
509 Ga0070697_100265814
510 Ga0070697_100318259
511 Ga0070697_100371252
512 Ga0070697_100418531
513 Ga0070697_100430354
514 Ga0070697_100720665
515 Ga0068853_100073901
516 Ga0070695_100570552
517 Ga0070695_101288769
518 Ga0070696_100769883
519 Ga0070693_100248840
520 Ga0068855_100200839
521 Ga0070664_100015127
522 Ga0068857_100886752
523 Ga0068856_100268344
524 Ga0068856_100488667
525 Ga0068852_100632039
526 Ga0068864_100421695
527 Ga0068851_10321809
528 Ga0068863_100777738
529 Ga0068863_100786742
530 Ga0068863_102027837
531 Ga0068858_100194861
532 Ga0068858_100916760
533 Ga0081540_1134576
534 Ga0070717_10022499
535 Ga0070717_10031994
536 Ga0070717_10276229
537 Ga0070717_10337676
538 Ga0070717_10463705
539 Ga0070717_10580487
540 Ga0070717_11161451
541 Ga0070717_11441384
542 Ga0070715_10006547
543 Ga0070715_10155747
544 Ga0070715_10199087
545 Ga0070715_10275168
546 Ga0070715_10634162
547 Ga0070715_10814899
548 Ga0070716_100003428
549 Ga0070716_100010838
550 Ga0070716_100108423
551 Ga0070716_100239189
552 Ga0070716_100338707
553 Ga0070716_100372718
554 Ga0070716_100510372
555 Ga0070716_100722674
556 Ga0070712_100021313
557 Ga0070712_100025456
558 Ga0070712_100265637
559 Ga0070712_100359875
560 Ga0070712_100885716
561 Ga0070712_101424026
562 Ga0070712_101450792
563 Ga0070712_101579104
564 Ga0097621_100236665
565 Ga0097621_100318809
566 Ga0097621_100515064
567 Ga0097621_101846630
568 Ga0068871_100501362
569 Ga0075433_10044142
570 Ga0075434_100002865
571 Ga0075436_100010701
572 Ga0075436_100363820
573 Ga0075435_100060074
574 Ga0075435_100832067
575 Ga0075435_100999337
576 Ga0099795_10235823
577 Ga0099795_10366416
578 Ga0105251_10573782
579 Ga0105240_11714240
580 Ga0105240_12503489
581 Ga0105247_10113899
582 Ga0105243_12435494
583 Ga0105241_10022394
584 Ga0105241_10094989
585 Ga0105248_10221193
586 Ga0105248_10776885
587 Ga0105248_11180732
588 Ga0105237_10138237
589 Ga0105238_10034673
590 Ga0099796_10430970
591 Ga0105239_10020221
592 Ga0105239_10684491
593 Ga0157373_10066693
594 Ga0157370_10166663
595 Ga0157369_11071096
596 Ga0157374_10017602
597 Ga0157378_10207122
598 Ga0157378_11000414
599 Ga0163162_10675036
600 Ga0163162_11708070
601 Ga0157372_10303708
602 Ga0163163_10156043
603 Ga0163163_10426941
604 Ga0182008_10020622
605 Ga0157377_11591451
606 Ga0157379_10157343
607 Ga0157376_10003549
608 Ga0157376_10400433
609 Ga0157376_10696505
610 Ga0182006_1116976
611 Ga0182007_10013295
612 Ga0182005_1072964
613 Ga0184601_107114
614 Ga0213873_10001756
615 Ga0213874_10189431
616 Ga0213876_10440567
617 Ga0224569_110012
618 Ga0224571_109639
619 Ga0224572_1002171
620 Ga0224572_1076983
621 Ga0228598_1003146
622 Ga0207692_10066638
623 Ga0207692_10389784
624 Ga0207692_10564301
625 Ga0207692_10712342
626 Ga0207710_10087190
627 Ga0207685_10160446
628 Ga0207685_10191506
629 Ga0207685_10641193
630 Ga0207699_10021344
631 Ga0207699_10040904
632 Ga0207699_10072625
633 Ga0207699_10262879
634 Ga0207699_10475901
635 Ga0207699_11275424
636 Ga0207699_11330849
637 Ga0207705_11054043
638 Ga0207684_10005893
639 Ga0207684_10095337
640 Ga0207684_10135977
641 Ga0207684_10185327
642 Ga0207654_10295088
643 Ga0207654_10365088
644 Ga0207707_11000363
645 Ga0207695_10318092
646 Ga0207671_11524543
647 Ga0207693_10011133
648 Ga0207693_10029683
649 Ga0207693_10242496
650 Ga0207693_10312033
651 Ga0207693_10629457
652 Ga0207693_11184221
653 Ga0207693_11443895
654 Ga0207663_10045679
655 Ga0207663_10419376
656 Ga0207663_10490917
657 Ga0207663_10676305
658 Ga0207662_10468707
659 Ga0207657_10008400
660 Ga0207649_10068774
661 Ga0207646_10279863
662 Ga0207646_10568031
663 Ga0207646_10679907
664 Ga0207646_10958637
665 Ga0207681_10450793
666 Ga0207694_10169526
667 Ga0207700_10066199
668 Ga0207700_10106964
669 Ga0207700_10155696
670 Ga0207700_10222789
671 Ga0207700_10235167
672 Ga0207700_10250189
673 Ga0207700_10430150
674 Ga0207700_11086596
675 Ga0207700_11414043
676 Ga0207664_10429451
677 Ga0207664_10629911
678 Ga0207664_10881765
679 Ga0207664_11414905
680 Ga0207644_10401204
681 Ga0207690_11220011
682 Ga0207706_10064448
683 Ga0207665_10005217
684 Ga0207665_10006735
685 Ga0207665_10169906
686 Ga0207665_10189386
687 Ga0207665_10300740
688 Ga0207665_10743922
689 Ga0207665_10745950
690 Ga0207665_11126976
691 Ga0207665_11378440
692 Ga0207711_10490525
693 Ga0207711_10626158
694 Ga0207711_10804280
695 Ga0207679_10156004
696 Ga0207640_10049807
697 Ga0207703_10851971
698 Ga0207639_10339292
699 Ga0207702_11503269
700 Ga0207641_10848367
701 Ga0207641_11039437
702 Ga0207641_11832931
703 Ga0207676_10523904
704 Ga0207674_10417576
705 Ga0207698_10858047
706 Ga0265356_1000075
707 Ga0265355_1021603
708 Ga0265338_10055888
709 Ga0265338_10068188
710 Ga0265338_10417740
711 Ga0265762_1001256
712 Ga0265762_1002802
713 Ga0265766_1002896
714 Ga0265770_1015204
715 Ga0265770_1121271
716 Ga0265765_1022745
717 Ga0265771_1023276
718 Ga0265760_10000493
719 Ga0265760_10001000
720 Ga0265760_10001057
721 Ga0265760_10041890
722 Ga0265760_10365387
723 Ga0265325_10034709
724 Ga0265314_10334897
725 Ga0265342_10026595
726 Ga0316215_1010294
727 Ga0316214_1008143
728 Ga0316212_1006421
729 Ga0373926_0010190
730 Ga0373923_0357555
731 Ga0373936_0003816
732 Ga0373936_0368262
733 Ga0373943_0130270
734 Ga0373943_0440778
735 Ga0373955_0061177
736 Ga0373931_0046257
737 Ga0373931_0515878
738 Ga0373931_0537437
739 Ga0373935_0218088
740 Ga0373935_1260270
741 Ga0373935_1381757
742 Ga0373927_0046104
743 Ga0373933_0398276
744 Ga0373933_0477210
745 Ga0373947_0009317
746 Ga0373947_0266642
747 Ga0373947_0932192
748 Ga0373937_0246149
749 Ga0373937_1293049
750 Ga0373925_0037285
751 Ga0373925_0438265
752 Ga0395905_0329617
753 Ga0436364_0040206
754 Ga0436365_0021545
755 Ga0436365_0152901
756 Ga0436360_0612571
757 Ga0436360_1237914
758 Ga0436363_0567579
759 Ga0436363_0874904
760 Ga0436363_0904344
761 Ga0436363_1294213
762 Ga0436363_1585664
763 Ga0436362_0156081
764 Ga0466964_0052313
765 Ga0466964_0549439
766 Ga0466970_0399357
767 Ga0495592_0413148
768 Ga0495580_0000854
769 Ga0495580_0004286
770 Ga0495580_0005262
771 Ga0495580_0014949
772 Ga0495580_0314389
773 Ga0495580_0573303
774 Ga0495580_0782057
775 Ga0495580_0893374
776 Ga0495582_0001260
777 Ga0495582_0089913
778 Ga0495639_0027835
779 Ga0495630_0284670
780 Ga0495630_0338375
781 Ga0495630_0391282
782 Ga0495642_0427110
783 Ga0495665_0003173
784 Ga0495667_0788660
785 Ga0495634_0338315
786 Ga0495635_0705667
787 Ga0495658_0708973
788 Ga0495669_0244210
789 Ga0495624_0170523
790 Ga0495624_0374864
791 Ga0495581_0103650
792 Ga0495674_0042929
793 Ga0495674_1020794
794 Ga0495602_0543611
795 Ga0495614_0462666
796 Ga0496100_0678105
797 Ga0496100_0774723
798 Ga0496101_0056836
799 Ga0496101_0111034
800 Ga0496102_0003159
801 Ga0496102_0842975
802 Ga0496102_0864320
803 Ga0496103_0012393
804 Ga0496104_0091024
805 Ga0496104_0228006
806 Ga0496104_0331095
807 Ga0496104_1100168
808 Ga0496105_0352647
809 Ga0496105_0511135
810 Ga0496105_1030693
811 Ga0496106_0029947
812 Ga0496106_1476808
813 Ga0496107_0242653
814 Ga0496108_0181093
815 Ga0496109_0291773
816 Ga0496109_1045311
817 Ga0496110_0187469
818 Ga0496111_0033510
819 Ga0496112_0014580
820 Ga0496112_0613213
821 Ga0496113_0149368
822 Ga0496115_1063726
823 nmdc:mga0n895_1052693_c1
824 nmdc:mga0n895_780961_c1
825 nmdc:mga0rr50_1130671_c1
826 nmdc:mga0rr50_1150047_c1
827 nmdc:mga0rr50_1209908_c1
828 nmdc:mga0rr50_8678_c1
829 nmdc:mga08x19_409028_c1
830 nmdc:mga08x19_518896_c1
831 nmdc:mga08x19_5544_c1
832 nmdc:mga0a205_56832_c1
833 Ga0587066_214969
834 Ga0587071_210507

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02416

TatA_B_E

mttA/Hcf106 family

7

64

0.91

Map