F438723

General Info

Members Datasets Scaffolds Average Seq Length
416 244 832 133

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100645551|Ga0068868_1006455512
Length 135
Sequence MAAVSVRYIVDDVDAALAFYCRHLGFTEQMHPAPAFAMVARGDLRLLLSAPGKGPGGGGQALPDGTMPTPGGWNRFAIEVTDLAGTVDRLRQAGVHLRSDPITGVGGRQVVIDDPSGNPVELFEPTRPEARLTDR

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
121 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
122 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
136 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
137 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
138 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
139 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
140 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
141 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
142 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
143 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
144 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
145 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
148 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
149 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
150 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
158 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
164 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
165 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
180 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
241 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
242 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
243 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
244 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 11.78
Rhizosphere 86.54
Stem 0
Stem Tuber 0
Unclassified 8.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100645551 3300005338 Bacteria 942
2 Ga0006765J45826_111603 3300003161 Bacteria 739
3 Ga0070658_10296516 3300005327 Bacteria 1378
4 Ga0070683_100007350 3300005329 Bacteria 9307
5 Ga0070683_100639356 3300005329 Bacteria 1019
6 Ga0070682_100033229 3300005337 Bacteria 3133
7 Ga0070682_100065275 3300005337 Bacteria 2313
8 Ga0068868_100118354 3300005338 Bacteria 2159
9 Ga0070691_10013842 3300005341 Bacteria 3702
10 Ga0070691_10646590 3300005341 Bacteria 629
11 Ga0070661_100180650 3300005344 Bacteria 1605
12 Ga0070669_100049118 3300005353 Bacteria 3080
13 Ga0070709_10066052 3300005434 Bacteria 2319
14 Ga0070714_100003091 3300005435 Bacteria 12353
15 Ga0070714_100025386 3300005435 Bacteria 4890
16 Ga0070714_100147338 3300005435 Bacteria 2118
17 Ga0070714_100300825 3300005435 Bacteria 1495
18 Ga0070713_100000930 3300005436 Bacteria 18692
19 Ga0070713_101021510 3300005436 Bacteria 798
20 Ga0070710_10002732 3300005437 Bacteria 8398
21 Ga0070710_10004695 3300005437 Bacteria 6463
22 Ga0070711_100029474 3300005439 Bacteria 3622
23 Ga0070705_101608767 3300005440 Bacteria 547
24 Ga0070700_100535967 3300005441 Bacteria 907
25 Ga0070681_11490588 3300005458 Bacteria 601
26 Ga0068867_100115368 3300005459 Bacteria 2069
27 Ga0068867_100345549 3300005459 Bacteria 1240
28 Ga0070685_10169629 3300005466 Bacteria 1398
29 Ga0070679_100594610 3300005530 Bacteria 1050
30 Ga0070684_100000361 3300005535 Bacteria 31277
31 Ga0070684_100025813 3300005535 Bacteria 4942
32 Ga0070684_100134069 3300005535 Bacteria 2236
33 Ga0070672_100037268 3300005543 Bacteria 3709
34 Ga0070672_101176533 3300005543 Bacteria 683
35 Ga0070686_100248620 3300005544 Bacteria 1298
36 Ga0070693_100346097 3300005547 Bacteria 1016
37 Ga0070665_100491148 3300005548 Bacteria 1239
38 Ga0070665_101021428 3300005548 Bacteria 839
39 Ga0070665_101822670 3300005548 Bacteria 615
40 Ga0070664_100035958 3300005564 Bacteria 4160
41 Ga0070664_100822936 3300005564 Bacteria 869
42 Ga0068857_100002084 3300005577 Bacteria 16240
43 Ga0068857_101038269 3300005577 Bacteria 790
44 Ga0068854_100233190 3300005578 Bacteria 1462
45 Ga0068856_100012537 3300005614 Bacteria 8205
46 Ga0068856_100052479 3300005614 Bacteria 4021
47 Ga0068864_100004311 3300005618 Bacteria 11699
48 Ga0068861_100040096 3300005719 Bacteria 3500
49 Ga0068863_100154669 3300005841 Bacteria 2195
50 Ga0068863_100714703 3300005841 Unclassified 996
51 Ga0068858_100472427 3300005842 Bacteria 1210
52 Ga0068858_101648248 3300005842 Bacteria 633
53 Ga0068860_100031066 3300005843 Bacteria 5135
54 Ga0081455_10034646 3300005937 Bacteria 4521
55 Ga0081538_10014484 3300005981 Bacteria 6171
56 Ga0081538_10032858 3300005981 Bacteria 3466
57 Ga0070717_10124809 3300006028 Bacteria 2209
58 Ga0070715_10006889 3300006163 Bacteria 3884
59 Ga0070715_10210726 3300006163 Bacteria 993
60 Ga0070715_10555715 3300006163 Bacteria 666
61 Ga0070716_100002921 3300006173 Bacteria 7965
62 Ga0070716_100208566 3300006173 Bacteria 1304
63 Ga0070716_101352359 3300006173 Unclassified 577
64 Ga0070712_100008015 3300006175 Bacteria 6625
65 Ga0075428_101038113 3300006844 Bacteria 867
66 Ga0075434_100047134 3300006871 Bacteria 4278
67 Ga0075434_100189940 3300006871 Unclassified 2074
68 Ga0068865_100321716 3300006881 Unclassified 1244
69 Ga0075436_100086168 3300006914 Unclassified 2181
70 Ga0075436_100239771 3300006914 Bacteria 1289
71 Ga0075435_100034457 3300007076 Bacteria 4012
72 Ga0075435_100074252 3300007076 Unclassified 2781
73 Ga0111539_10374060 3300009094 Bacteria 1658
74 Ga0111539_11378465 3300009094 Bacteria 818
75 Ga0105245_10043482 3300009098 Bacteria 4007
76 Ga0114129_10074636 3300009147 Bacteria 4724
77 Ga0105243_10139229 3300009148 Bacteria 2068
78 Ga0105243_10955446 3300009148 Bacteria 856
79 Ga0105241_10371117 3300009174 Bacteria 1248
80 Ga0105241_10535338 3300009174 Bacteria 1049
81 Ga0105242_10410297 3300009176 Unclassified 1267
82 Ga0105248_10101071 3300009177 Bacteria 3250
83 Ga0105238_10640513 3300009551 Bacteria 1072
84 Ga0105249_10096879 3300009553 Bacteria 2768
85 Ga0105239_10237182 3300010375 Bacteria 2047
86 Ga0157370_10243860 3300013104 Bacteria 1662
87 Ga0157370_11045976 3300013104 Bacteria 738
88 Ga0157369_10010062 3300013105 Bacteria 10799
89 Ga0157374_10530374 3300013296 Bacteria 1184
90 Ga0157378_10240731 3300013297 Bacteria 1728
91 Ga0157378_11219461 3300013297 Bacteria 792
92 Ga0163162_10019840 3300013306 Bacteria 6600
93 Ga0157372_10453544 3300013307 Bacteria 1494
94 Ga0157375_10039305 3300013308 Bacteria 4553
95 Ga0157375_11521872 3300013308 Bacteria 790
96 Ga0163163_10041387 3300014325 Bacteria 4505
97 Ga0163163_13321043 3300014325 Bacteria 502
98 Ga0157380_10296290 3300014326 Bacteria 1488
99 Ga0157377_10158128 3300014745 Bacteria 1407
100 Ga0157379_10053529 3300014968 Bacteria 3605
101 Ga0157376_11945273 3300014969 Bacteria 625
102 Ga0163161_10230564 3300017792 Bacteria 1437
103 Ga0206354_10984847 3300020081 Bacteria 685
104 Ga0213876_10119598 3300021384 Bacteria 1398
105 Ga0224712_10023651 3300022467 Bacteria 2136
106 Ga0207692_10003053 3300025898 Bacteria 6498
107 Ga0207692_10013084 3300025898 Bacteria 3589
108 Ga0207692_10567750 3300025898 Unclassified 726
109 Ga0207710_10164296 3300025900 Bacteria 1083
110 Ga0207685_10021597 3300025905 Bacteria 2160
111 Ga0207699_10001365 3300025906 Bacteria 11618
112 Ga0207699_10140336 3300025906 Bacteria 1587
113 Ga0207699_10300215 3300025906 Bacteria 1121
114 Ga0207699_11051513 3300025906 Unclassified 602
115 Ga0207705_10617686 3300025909 Unclassified 843
116 Ga0207654_10293180 3300025911 Bacteria 1104
117 Ga0207707_11581023 3300025912 Bacteria 517
118 Ga0207693_10010548 3300025915 Bacteria 7498
119 Ga0207693_10047748 3300025915 Bacteria 3363
120 Ga0207693_10484487 3300025915 Bacteria 966
121 Ga0207693_10485388 3300025915 Bacteria 965
122 Ga0207693_10806428 3300025915 Bacteria 723
123 Ga0207663_10431509 3300025916 Bacteria 1013
124 Ga0207662_10982970 3300025918 Bacteria 599
125 Ga0207649_10829915 3300025920 Bacteria 722
126 Ga0207652_11174634 3300025921 Archaea 669
127 Ga0207681_10522252 3300025923 Bacteria 974
128 Ga0207694_10138817 3300025924 Bacteria 1954
129 Ga0207687_10396199 3300025927 Bacteria 1135
130 Ga0207687_11329127 3300025927 Bacteria 618
131 Ga0207700_10001705 3300025928 Bacteria 12480
132 Ga0207700_10008858 3300025928 Bacteria 6255
133 Ga0207700_10416014 3300025928 Bacteria 1180
134 Ga0207700_10491739 3300025928 Bacteria 1085
135 Ga0207664_10057530 3300025929 Bacteria 3091
136 Ga0207664_10085602 3300025929 Bacteria 2573
137 Ga0207664_10608952 3300025929 Bacteria 981
138 Ga0207664_11777652 3300025929 Unclassified 539
139 Ga0207644_11581021 3300025931 Bacteria 550
140 Ga0207706_10035687 3300025933 Bacteria 4419
141 Ga0207686_10688554 3300025934 Bacteria 812
142 Ga0207709_10383158 3300025935 Bacteria 1071
143 Ga0207709_11002792 3300025935 Bacteria 683
144 Ga0207665_10046090 3300025939 Bacteria 2921
145 Ga0207665_10090838 3300025939 Bacteria 2116
146 Ga0207691_10063820 3300025940 Bacteria 3339
147 Ga0207711_10610033 3300025941 Bacteria 1018
148 Ga0207661_10000586 3300025944 Bacteria 23278
149 Ga0207661_10024739 3300025944 Bacteria 4554
150 Ga0207661_12081286 3300025944 Bacteria 514
151 Ga0207679_10009162 3300025945 Bacteria 6330
152 Ga0207679_10831470 3300025945 Bacteria 843
153 Ga0207712_10266213 3300025961 Bacteria 1392
154 Ga0207640_10226286 3300025981 Bacteria 1436
155 Ga0207677_10991959 3300026023 Bacteria 761
156 Ga0207703_10534617 3300026035 Bacteria 1104
157 Ga0207639_11053231 3300026041 Bacteria 762
158 Ga0207678_10979062 3300026067 Bacteria 748
159 Ga0207708_10869470 3300026075 Bacteria 779
160 Ga0207702_10003798 3300026078 Bacteria 13637
161 Ga0207702_10041705 3300026078 Bacteria 3849
162 Ga0207702_11391617 3300026078 Bacteria 695
163 Ga0207641_11892536 3300026088 Bacteria 598
164 Ga0207676_10047054 3300026095 Bacteria 3341
165 Ga0207674_10003361 3300026116 Bacteria 19633
166 Ga0207674_10216058 3300026116 Bacteria 1866
167 Ga0207674_11427359 3300026116 Unclassified 661
168 Ga0268266_10181858 3300028379 Bacteria 1915
169 Ga0268266_11679580 3300028379 Bacteria 610
170 Ga0268264_10080004 3300028381 Bacteria 2790
171 Ga0307408_100180133 3300031548 Bacteria 1694
172 Ga0307405_10006815 3300031731 Bacteria 5658
173 Ga0307413_10234223 3300031824 Bacteria 1351
174 Ga0307413_10565487 3300031824 Bacteria 925
175 Ga0307406_10165390 3300031901 Bacteria 1595
176 Ga0307407_10681521 3300031903 Bacteria 773
177 Ga0307412_10147147 3300031911 Bacteria 1733
178 Ga0307412_10650098 3300031911 Bacteria 899
179 Ga0307409_100166731 3300031995 Bacteria 1934
180 Ga0307409_100632536 3300031995 Bacteria 1062
181 Ga0307416_100045005 3300032002 Bacteria 3471
182 Ga0307416_100151051 3300032002 Bacteria 2130
183 Ga0307416_100185906 3300032002 Bacteria 1953
184 Ga0307416_102254096 3300032002 Archaea 645
185 Ga0307416_102286146 3300032002 Bacteria 641
186 Ga0307411_11294466 3300032005 Bacteria 664
187 Ga0307415_100111419 3300032126 Bacteria 2031
188 Ga0307415_101517040 3300032126 Bacteria 641
189 Ga0373953_0363590 3300035117 Bacteria 635
190 Ga0373956_0032827 3300035119 Bacteria 2280
191 Ga0373956_0172711 3300035119 Bacteria 1020
192 Ga0373957_0072162 3300035120 Bacteria 1352
193 Ga0373943_0400390 3300035170 Unclassified 792
194 Ga0373943_0622864 3300035170 Bacteria 637
195 Ga0373955_0064496 3300035172 Bacteria 2031
196 Ga0373955_0539242 3300035172 Bacteria 713
197 Ga0373924_0035902 3300035410 Bacteria 2012
198 Ga0373933_0006273 3300035724 Bacteria 6471
199 Ga0373933_0622784 3300035724 Bacteria 709
200 Ga0373937_0008624 3300036401 Bacteria 8854
201 Ga0373937_0015896 3300036401 Bacteria 6674
202 Ga0373937_0206520 3300036401 Bacteria 1847
203 Ga0373925_0015277 3300037068 Bacteria 5551
204 Ga0373925_0088372 3300037068 Bacteria 2366
205 Ga0395899_0125047 3300037312 Bacteria 1839
206 Ga0395900_0189523 3300037418 Unclassified 2087
207 Ga0395898_0363856 3300037466 Bacteria 1379
208 Ga0395905_0242290 3300037471 Bacteria 1685
209 Ga0436364_1344353 3300037853 Bacteria 3339
210 Ga0436365_0169310 3300039437 Bacteria 1472
211 Ga0436361_0438187 3300039447 Bacteria 787
212 Ga0436362_0064717 3300039453 Bacteria 835
213 Ga0439465_0005110 3300041413 Bacteria 4211
214 Ga0451853_3179711 3300041512 Bacteria 685
215 Ga0439448_0015928 3300042005 Bacteria 2283
216 Ga0439450_037375 3300042008 Bacteria 1115
217 Ga0439463_124203 3300042016 Bacteria 667
218 Ga0439435_0063285 3300042436 Bacteria 1082
219 Ga0439444_0197097 3300042437 Bacteria 506
220 Ga0439460_0180058 3300042461 Bacteria 714
221 Ga0439440_0132086 3300042993 Bacteria 703
222 Ga0439440_0163168 3300042993 Unclassified 644
223 Ga0466963_0027921 3300044694 Bacteria 3618
224 Ga0466963_0693817 3300044694 Bacteria 718
225 Ga0466970_0273701 3300044765 Bacteria 949
226 Ga0466957_0168231 3300044842 Bacteria 1427
227 Ga0466957_0588846 3300044842 Bacteria 778
228 Ga0466960_0155343 3300044901 Bacteria 1225
229 Ga0466958_0833590 3300045836 Unclassified 601
230 Ga0466967_0089538 3300045976 Unclassified 2794
231 Ga0466967_1667233 3300045976 Bacteria 635
232 Ga0495592_0022162 3300046454 Bacteria 4832
233 Ga0495592_0059163 3300046454 Bacteria 2823
234 Ga0495592_0148220 3300046454 Bacteria 1625
235 Ga0495603_0247244 3300046455 Bacteria 1027
236 Ga0495651_0000497 3300046462 Bacteria 30480
237 Ga0495651_0005931 3300046462 Bacteria 9320
238 Ga0495651_0186945 3300046462 Bacteria 1461
239 Ga0495651_0524667 3300046462 Bacteria 755
240 Ga0495653_0024208 3300046463 Bacteria 4896
241 Ga0495653_0596858 3300046463 Bacteria 679
242 Ga0495653_0613587 3300046463 Unclassified 667
243 Ga0495582_0010352 3300046473 Bacteria 5131
244 Ga0495662_0037781 3300046476 Bacteria 2332
245 Ga0495585_0099368 3300046492 Bacteria 1558
246 Ga0495608_0000564 3300046511 Bacteria 25451
247 Ga0495608_0050460 3300046511 Bacteria 2760
248 Ga0495608_0405344 3300046511 Bacteria 833
249 Ga0495618_0007489 3300046514 Bacteria 6606
250 Ga0495618_0056172 3300046514 Bacteria 2493
251 Ga0495618_0340142 3300046514 Bacteria 926
252 Ga0495628_0013457 3300046516 Bacteria 6883
253 Ga0495628_0126024 3300046516 Bacteria 1962
254 Ga0495630_0071451 3300046517 Bacteria 2612
255 Ga0495648_0404644 3300046524 Bacteria 609
256 Ga0495666_0005184 3300046526 Bacteria 6582
257 Ga0495642_0114580 3300046528 Unclassified 1154
258 Ga0495652_0002871 3300046529 Bacteria 17378
259 Ga0495652_0106333 3300046529 Bacteria 2266
260 Ga0495640_0025770 3300046533 Bacteria 4259
261 Ga0495640_0046145 3300046533 Bacteria 3020
262 Ga0495640_0077902 3300046533 Bacteria 2209
263 Ga0495587_0003938 3300046536 Bacteria 9852
264 Ga0495587_0052422 3300046536 Bacteria 2407
265 Ga0495587_0142883 3300046536 Bacteria 1365
266 Ga0495587_0219331 3300046536 Bacteria 1073
267 Ga0495598_0058339 3300046537 Unclassified 1184
268 Ga0495645_0116486 3300046543 Bacteria 1886
269 Ga0495645_0825295 3300046543 Bacteria 555
270 Ga0495633_0104540 3300046558 Unclassified 1314
271 Ga0495667_0002057 3300046559 Bacteria 13348
272 Ga0495667_0003786 3300046559 Bacteria 10157
273 Ga0495667_0889730 3300046559 Unclassified 546
274 Ga0495656_0627020 3300046615 Unclassified 576
275 Ga0495668_0338988 3300046616 Bacteria 825
276 Ga0495634_0075657 3300046642 Bacteria 2211
277 Ga0495634_0100707 3300046642 Bacteria 1867
278 Ga0495634_0245457 3300046642 Bacteria 1097
279 Ga0495635_0012884 3300046663 Bacteria 5854
280 Ga0495635_0056631 3300046663 Bacteria 2698
281 Ga0495657_0002288 3300046675 Bacteria 16179
282 Ga0495657_0003398 3300046675 Bacteria 13000
283 Ga0495657_0427544 3300046675 Bacteria 777
284 Ga0495657_0619654 3300046675 Bacteria 625
285 Ga0495599_0031522 3300046678 Bacteria 3327
286 Ga0495599_0031917 3300046678 Bacteria 3306
287 Ga0495599_0121322 3300046678 Bacteria 1625
288 Ga0495623_0007208 3300046679 Bacteria 7219
289 Ga0495623_0052273 3300046679 Bacteria 2582
290 Ga0495623_0450797 3300046679 Unclassified 685
291 Ga0495646_0019047 3300046680 Bacteria 4348
292 Ga0495646_0023028 3300046680 Bacteria 3922
293 Ga0495646_0247544 3300046680 Bacteria 956
294 Ga0495658_0674187 3300046683 Bacteria 662
295 Ga0495669_0175118 3300046684 Unclassified 1021
296 Ga0495613_0063198 3300046689 Bacteria 2709
297 Ga0495624_0239074 3300046690 Unclassified 1099
298 Ga0495649_0383228 3300046694 Bacteria 707
299 Ga0495600_0003893 3300046809 Bacteria 8863
300 Ga0495600_0008502 3300046809 Bacteria 6308
301 Ga0495604_0002040 3300047317 Bacteria 16326
302 Ga0495604_0003667 3300047317 Bacteria 12241
303 Ga0495674_0012561 3300047319 Bacteria 7979
304 Ga0495674_0247327 3300047319 Unclassified 1468
305 Ga0495674_0300067 3300047319 Bacteria 1312
306 Ga0495676_0875002 3300047321 Bacteria 576
307 Ga0495680_0003731 3300047322 Bacteria 14833
308 Ga0495680_0035557 3300047322 Bacteria 4011
309 Ga0495680_0137575 3300047322 Bacteria 1790
310 Ga0495680_0512819 3300047322 Bacteria 812
311 Ga0495684_0003190 3300047471 Bacteria 12861
312 Ga0495684_0010808 3300047471 Bacteria 7057
313 Ga0495684_0015252 3300047471 Bacteria 5919
314 Ga0495593_0170819 3300047673 Bacteria 1096
315 Ga0495602_0005533 3300048088 Bacteria 13255
316 Ga0495602_0043436 3300048088 Bacteria 4086
317 Ga0495602_0981584 3300048088 Bacteria 558
318 Ga0495614_0078509 3300048089 Bacteria 1428
319 Ga0496100_0142239 3300048903 Bacteria 1702
320 Ga0496100_0155371 3300048903 Unclassified 1636
321 Ga0496100_0293057 3300048903 Bacteria 1216
322 Ga0496101_0036676 3300048904 Bacteria 3473
323 Ga0496102_0026456 3300048905 Bacteria 5174
324 Ga0496102_0091749 3300048905 Unclassified 2812
325 Ga0496103_0867194 3300048906 Bacteria 567
326 Ga0496104_0002962 3300048907 Bacteria 14630
327 Ga0496104_0013435 3300048907 Bacteria 7378
328 Ga0496104_0115960 3300048907 Bacteria 2570
329 Ga0496104_0476680 3300048907 Bacteria 1159
330 Ga0496104_1465270 3300048907 Unclassified 585
331 Ga0496105_0000720 3300048908 Bacteria 22402
332 Ga0496105_0142985 3300048908 Bacteria 1969
333 Ga0496105_0368807 3300048908 Bacteria 1144
334 Ga0496106_0087253 3300048909 Bacteria 2404
335 Ga0496106_0156164 3300048909 Bacteria 1802
336 Ga0496106_0627753 3300048909 Bacteria 859
337 Ga0496107_0048072 3300048910 Bacteria 3073
338 Ga0496107_0370341 3300048910 Bacteria 1065
339 Ga0496108_0018161 3300048911 Bacteria 5756
340 Ga0496108_0018955 3300048911 Bacteria 5642
341 Ga0496108_0649209 3300048911 Bacteria 917
342 Ga0496108_0681915 3300048911 Bacteria 892
343 Ga0496108_0836550 3300048911 Bacteria 793
344 Ga0496109_0006132 3300048912 Bacteria 10101
345 Ga0496109_0025675 3300048912 Bacteria 5251
346 Ga0496109_0494749 3300048912 Unclassified 1154
347 Ga0496109_0641972 3300048912 Bacteria 998
348 Ga0496110_0003603 3300048913 Bacteria 11912
349 Ga0496110_0079593 3300048913 Bacteria 2918
350 Ga0496110_0143627 3300048913 Bacteria 2158
351 Ga0496110_0206525 3300048913 Bacteria 1785
352 Ga0496110_0853111 3300048913 Unclassified 816
353 Ga0496110_0916654 3300048913 Bacteria 782
354 Ga0496111_0086293 3300048914 Bacteria 2296
355 Ga0496111_0236568 3300048914 Bacteria 1356
356 Ga0496112_0014121 3300048915 Bacteria 7396
357 Ga0496112_0021392 3300048915 Bacteria 6151
358 Ga0496112_0043518 3300048915 Bacteria 4397
359 Ga0496112_0079624 3300048915 Bacteria 3241
360 Ga0496112_0808659 3300048915 Bacteria 862
361 Ga0496113_0000668 3300048916 Bacteria 17414
362 Ga0496113_0434139 3300048916 Bacteria 1055
363 Ga0496113_1133635 3300048916 Bacteria 612
364 Ga0496114_0084608 3300048917 Bacteria 2686
365 Ga0496114_0578498 3300048917 Bacteria 991
366 Ga0496115_0054908 3300048918 Bacteria 3199
367 Ga0496115_0527328 3300048918 Bacteria 946
368 Ga0496117_0024546 3300048920 Bacteria 4765
369 Ga0496124_0369839 3300048927 Bacteria 1007
370 Ga0501031_0002765 3300049568 Bacteria 11177
371 Ga0501032_0003973 3300049569 Bacteria 11212
372 Ga0501033_0011566 3300049570 Bacteria 6751
373 Ga0501033_0056885 3300049570 Bacteria 2890
374 Ga0501034_0033665 3300049571 Bacteria 5196
375 Ga0501036_0039696 3300049572 Bacteria 3982
376 Ga0501037_0328713 3300049573 Bacteria 1057
377 Ga0501038_0006161 3300049574 Bacteria 11096
378 Ga0501039_0026578 3300049575 Bacteria 4448
379 Ga0501043_0010746 3300049579 Bacteria 7169
380 Ga0501046_0011252 3300049580 Bacteria 7659
381 Ga0501047_0176852 3300049581 Bacteria 2001
382 Ga0501047_1242885 3300049581 Bacteria 558
383 Ga0501048_0004800 3300049582 Bacteria 10300
384 Ga0501067_0192641 3300049583 Bacteria 1135
385 Ga0501070_0215751 3300049586 Bacteria 1574
386 Ga0501070_0848562 3300049586 Bacteria 715
387 Ga0501073_0021420 3300049589 Bacteria 4660
388 Ga0501080_1041307 3300049742 Unclassified 708
389 Ga0501083_0537453 3300049744 Bacteria 761
390 Ga0501035_0006496 3300049822 Bacteria 10985
391 Ga0501035_0150169 3300049822 Bacteria 2022
392 Ga0501044_0012689 3300049823 Bacteria 9125
393 Ga0501045_0311027 3300049824 Bacteria 1172
394 nmdc:mga05p37_101814_c1 3300050507 Bacteria 3537
395 nmdc:mga06r32_1655981_c1 3300050510 Unclassified 577
396 nmdc:mga08y16_777862_c1 3300050511 Bacteria 951
397 nmdc:mga0n895_611434_c1 3300050512 Bacteria 1091
398 nmdc:mga0rr50_213204_c1 3300050513 Bacteria 1592
399 nmdc:mga0rr50_85512_c1 3300050513 Unclassified 2445
400 nmdc:mga08x19_1101093_c1 3300050514 Bacteria 564
401 nmdc:mga08x19_22572_c1 3300050514 Bacteria 3899
402 nmdc:mga0a205_41177_c1 3300050515 Bacteria 4449
403 Ga0495601_0563684 3300053077 Unclassified 732
404 Ga0495601_0770601 3300053077 Bacteria 611
405 Ga0495612_0090589 3300053078 Bacteria 1294
406 Ga0495612_0138095 3300053078 Bacteria 1056
407 Ga0495595_0008202 3300053084 Bacteria 4287
408 Ga0495595_0138791 3300053084 Bacteria 1192
409 Ga0495595_0151219 3300053084 Bacteria 1142
410 Ga0495595_0225978 3300053084 Bacteria 934
411 Ga0495619_0002400 3300053085 Bacteria 12303
412 Ga0495619_0015117 3300053085 Bacteria 4879
413 Ga0495619_0086866 3300053085 Bacteria 2114
414 Ga0495619_0131613 3300053085 Bacteria 1719
415 Ga0495619_0313189 3300053085 Bacteria 1087
416 Ga0500622_0000228 3300053156 Bacteria 58436
417 Ga0068868_100645551
418 Ga0006765J45826_111603
419 Ga0070658_10296516
420 Ga0070683_100007350
421 Ga0070683_100639356
422 Ga0070682_100033229
423 Ga0070682_100065275
424 Ga0068868_100118354
425 Ga0070691_10013842
426 Ga0070691_10646590
427 Ga0070661_100180650
428 Ga0070669_100049118
429 Ga0070709_10066052
430 Ga0070714_100003091
431 Ga0070714_100025386
432 Ga0070714_100147338
433 Ga0070714_100300825
434 Ga0070713_100000930
435 Ga0070713_101021510
436 Ga0070710_10002732
437 Ga0070710_10004695
438 Ga0070711_100029474
439 Ga0070705_101608767
440 Ga0070700_100535967
441 Ga0070681_11490588
442 Ga0068867_100115368
443 Ga0068867_100345549
444 Ga0070685_10169629
445 Ga0070679_100594610
446 Ga0070684_100000361
447 Ga0070684_100025813
448 Ga0070684_100134069
449 Ga0070672_100037268
450 Ga0070672_101176533
451 Ga0070686_100248620
452 Ga0070693_100346097
453 Ga0070665_100491148
454 Ga0070665_101021428
455 Ga0070665_101822670
456 Ga0070664_100035958
457 Ga0070664_100822936
458 Ga0068857_100002084
459 Ga0068857_101038269
460 Ga0068854_100233190
461 Ga0068856_100012537
462 Ga0068856_100052479
463 Ga0068864_100004311
464 Ga0068861_100040096
465 Ga0068863_100154669
466 Ga0068863_100714703
467 Ga0068858_100472427
468 Ga0068858_101648248
469 Ga0068860_100031066
470 Ga0081455_10034646
471 Ga0081538_10014484
472 Ga0081538_10032858
473 Ga0070717_10124809
474 Ga0070715_10006889
475 Ga0070715_10210726
476 Ga0070715_10555715
477 Ga0070716_100002921
478 Ga0070716_100208566
479 Ga0070716_101352359
480 Ga0070712_100008015
481 Ga0075428_101038113
482 Ga0075434_100047134
483 Ga0075434_100189940
484 Ga0068865_100321716
485 Ga0075436_100086168
486 Ga0075436_100239771
487 Ga0075435_100034457
488 Ga0075435_100074252
489 Ga0111539_10374060
490 Ga0111539_11378465
491 Ga0105245_10043482
492 Ga0114129_10074636
493 Ga0105243_10139229
494 Ga0105243_10955446
495 Ga0105241_10371117
496 Ga0105241_10535338
497 Ga0105242_10410297
498 Ga0105248_10101071
499 Ga0105238_10640513
500 Ga0105249_10096879
501 Ga0105239_10237182
502 Ga0157370_10243860
503 Ga0157370_11045976
504 Ga0157369_10010062
505 Ga0157374_10530374
506 Ga0157378_10240731
507 Ga0157378_11219461
508 Ga0163162_10019840
509 Ga0157372_10453544
510 Ga0157375_10039305
511 Ga0157375_11521872
512 Ga0163163_10041387
513 Ga0163163_13321043
514 Ga0157380_10296290
515 Ga0157377_10158128
516 Ga0157379_10053529
517 Ga0157376_11945273
518 Ga0163161_10230564
519 Ga0206354_10984847
520 Ga0213876_10119598
521 Ga0224712_10023651
522 Ga0207692_10003053
523 Ga0207692_10013084
524 Ga0207692_10567750
525 Ga0207710_10164296
526 Ga0207685_10021597
527 Ga0207699_10001365
528 Ga0207699_10140336
529 Ga0207699_10300215
530 Ga0207699_11051513
531 Ga0207705_10617686
532 Ga0207654_10293180
533 Ga0207707_11581023
534 Ga0207693_10010548
535 Ga0207693_10047748
536 Ga0207693_10484487
537 Ga0207693_10485388
538 Ga0207693_10806428
539 Ga0207663_10431509
540 Ga0207662_10982970
541 Ga0207649_10829915
542 Ga0207652_11174634
543 Ga0207681_10522252
544 Ga0207694_10138817
545 Ga0207687_10396199
546 Ga0207687_11329127
547 Ga0207700_10001705
548 Ga0207700_10008858
549 Ga0207700_10416014
550 Ga0207700_10491739
551 Ga0207664_10057530
552 Ga0207664_10085602
553 Ga0207664_10608952
554 Ga0207664_11777652
555 Ga0207644_11581021
556 Ga0207706_10035687
557 Ga0207686_10688554
558 Ga0207709_10383158
559 Ga0207709_11002792
560 Ga0207665_10046090
561 Ga0207665_10090838
562 Ga0207691_10063820
563 Ga0207711_10610033
564 Ga0207661_10000586
565 Ga0207661_10024739
566 Ga0207661_12081286
567 Ga0207679_10009162
568 Ga0207679_10831470
569 Ga0207712_10266213
570 Ga0207640_10226286
571 Ga0207677_10991959
572 Ga0207703_10534617
573 Ga0207639_11053231
574 Ga0207678_10979062
575 Ga0207708_10869470
576 Ga0207702_10003798
577 Ga0207702_10041705
578 Ga0207702_11391617
579 Ga0207641_11892536
580 Ga0207676_10047054
581 Ga0207674_10003361
582 Ga0207674_10216058
583 Ga0207674_11427359
584 Ga0268266_10181858
585 Ga0268266_11679580
586 Ga0268264_10080004
587 Ga0307408_100180133
588 Ga0307405_10006815
589 Ga0307413_10234223
590 Ga0307413_10565487
591 Ga0307406_10165390
592 Ga0307407_10681521
593 Ga0307412_10147147
594 Ga0307412_10650098
595 Ga0307409_100166731
596 Ga0307409_100632536
597 Ga0307416_100045005
598 Ga0307416_100151051
599 Ga0307416_100185906
600 Ga0307416_102254096
601 Ga0307416_102286146
602 Ga0307411_11294466
603 Ga0307415_100111419
604 Ga0307415_101517040
605 Ga0373953_0363590
606 Ga0373956_0032827
607 Ga0373956_0172711
608 Ga0373957_0072162
609 Ga0373943_0400390
610 Ga0373943_0622864
611 Ga0373955_0064496
612 Ga0373955_0539242
613 Ga0373924_0035902
614 Ga0373933_0006273
615 Ga0373933_0622784
616 Ga0373937_0008624
617 Ga0373937_0015896
618 Ga0373937_0206520
619 Ga0373925_0015277
620 Ga0373925_0088372
621 Ga0395899_0125047
622 Ga0395900_0189523
623 Ga0395898_0363856
624 Ga0395905_0242290
625 Ga0436364_1344353
626 Ga0436365_0169310
627 Ga0436361_0438187
628 Ga0436362_0064717
629 Ga0439465_0005110
630 Ga0451853_3179711
631 Ga0439448_0015928
632 Ga0439450_037375
633 Ga0439463_124203
634 Ga0439435_0063285
635 Ga0439444_0197097
636 Ga0439460_0180058
637 Ga0439440_0132086
638 Ga0439440_0163168
639 Ga0466963_0027921
640 Ga0466963_0693817
641 Ga0466970_0273701
642 Ga0466957_0168231
643 Ga0466957_0588846
644 Ga0466960_0155343
645 Ga0466958_0833590
646 Ga0466967_0089538
647 Ga0466967_1667233
648 Ga0495592_0022162
649 Ga0495592_0059163
650 Ga0495592_0148220
651 Ga0495603_0247244
652 Ga0495651_0000497
653 Ga0495651_0005931
654 Ga0495651_0186945
655 Ga0495651_0524667
656 Ga0495653_0024208
657 Ga0495653_0596858
658 Ga0495653_0613587
659 Ga0495582_0010352
660 Ga0495662_0037781
661 Ga0495585_0099368
662 Ga0495608_0000564
663 Ga0495608_0050460
664 Ga0495608_0405344
665 Ga0495618_0007489
666 Ga0495618_0056172
667 Ga0495618_0340142
668 Ga0495628_0013457
669 Ga0495628_0126024
670 Ga0495630_0071451
671 Ga0495648_0404644
672 Ga0495666_0005184
673 Ga0495642_0114580
674 Ga0495652_0002871
675 Ga0495652_0106333
676 Ga0495640_0025770
677 Ga0495640_0046145
678 Ga0495640_0077902
679 Ga0495587_0003938
680 Ga0495587_0052422
681 Ga0495587_0142883
682 Ga0495587_0219331
683 Ga0495598_0058339
684 Ga0495645_0116486
685 Ga0495645_0825295
686 Ga0495633_0104540
687 Ga0495667_0002057
688 Ga0495667_0003786
689 Ga0495667_0889730
690 Ga0495656_0627020
691 Ga0495668_0338988
692 Ga0495634_0075657
693 Ga0495634_0100707
694 Ga0495634_0245457
695 Ga0495635_0012884
696 Ga0495635_0056631
697 Ga0495657_0002288
698 Ga0495657_0003398
699 Ga0495657_0427544
700 Ga0495657_0619654
701 Ga0495599_0031522
702 Ga0495599_0031917
703 Ga0495599_0121322
704 Ga0495623_0007208
705 Ga0495623_0052273
706 Ga0495623_0450797
707 Ga0495646_0019047
708 Ga0495646_0023028
709 Ga0495646_0247544
710 Ga0495658_0674187
711 Ga0495669_0175118
712 Ga0495613_0063198
713 Ga0495624_0239074
714 Ga0495649_0383228
715 Ga0495600_0003893
716 Ga0495600_0008502
717 Ga0495604_0002040
718 Ga0495604_0003667
719 Ga0495674_0012561
720 Ga0495674_0247327
721 Ga0495674_0300067
722 Ga0495676_0875002
723 Ga0495680_0003731
724 Ga0495680_0035557
725 Ga0495680_0137575
726 Ga0495680_0512819
727 Ga0495684_0003190
728 Ga0495684_0010808
729 Ga0495684_0015252
730 Ga0495593_0170819
731 Ga0495602_0005533
732 Ga0495602_0043436
733 Ga0495602_0981584
734 Ga0495614_0078509
735 Ga0496100_0142239
736 Ga0496100_0155371
737 Ga0496100_0293057
738 Ga0496101_0036676
739 Ga0496102_0026456
740 Ga0496102_0091749
741 Ga0496103_0867194
742 Ga0496104_0002962
743 Ga0496104_0013435
744 Ga0496104_0115960
745 Ga0496104_0476680
746 Ga0496104_1465270
747 Ga0496105_0000720
748 Ga0496105_0142985
749 Ga0496105_0368807
750 Ga0496106_0087253
751 Ga0496106_0156164
752 Ga0496106_0627753
753 Ga0496107_0048072
754 Ga0496107_0370341
755 Ga0496108_0018161
756 Ga0496108_0018955
757 Ga0496108_0649209
758 Ga0496108_0681915
759 Ga0496108_0836550
760 Ga0496109_0006132
761 Ga0496109_0025675
762 Ga0496109_0494749
763 Ga0496109_0641972
764 Ga0496110_0003603
765 Ga0496110_0079593
766 Ga0496110_0143627
767 Ga0496110_0206525
768 Ga0496110_0853111
769 Ga0496110_0916654
770 Ga0496111_0086293
771 Ga0496111_0236568
772 Ga0496112_0014121
773 Ga0496112_0021392
774 Ga0496112_0043518
775 Ga0496112_0079624
776 Ga0496112_0808659
777 Ga0496113_0000668
778 Ga0496113_0434139
779 Ga0496113_1133635
780 Ga0496114_0084608
781 Ga0496114_0578498
782 Ga0496115_0054908
783 Ga0496115_0527328
784 Ga0496117_0024546
785 Ga0496124_0369839
786 Ga0501031_0002765
787 Ga0501032_0003973
788 Ga0501033_0011566
789 Ga0501033_0056885
790 Ga0501034_0033665
791 Ga0501036_0039696
792 Ga0501037_0328713
793 Ga0501038_0006161
794 Ga0501039_0026578
795 Ga0501043_0010746
796 Ga0501046_0011252
797 Ga0501047_0176852
798 Ga0501047_1242885
799 Ga0501048_0004800
800 Ga0501067_0192641
801 Ga0501070_0215751
802 Ga0501070_0848562
803 Ga0501073_0021420
804 Ga0501080_1041307
805 Ga0501083_0537453
806 Ga0501035_0006496
807 Ga0501035_0150169
808 Ga0501044_0012689
809 Ga0501045_0311027
810 nmdc:mga05p37_101814_c1
811 nmdc:mga06r32_1655981_c1
812 nmdc:mga08y16_777862_c1
813 nmdc:mga0n895_611434_c1
814 nmdc:mga0rr50_213204_c1
815 nmdc:mga0rr50_85512_c1
816 nmdc:mga08x19_1101093_c1
817 nmdc:mga08x19_22572_c1
818 nmdc:mga0a205_41177_c1
819 Ga0495601_0563684
820 Ga0495601_0770601
821 Ga0495612_0090589
822 Ga0495612_0138095
823 Ga0495595_0008202
824 Ga0495595_0138791
825 Ga0495595_0151219
826 Ga0495595_0225978
827 Ga0495619_0002400
828 Ga0495619_0015117
829 Ga0495619_0086866
830 Ga0495619_0131613
831 Ga0495619_0313189
832 Ga0500622_0000228

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

3

122

0.78

PF18029

Glyoxalase_6

Glyoxalase-like domain

3

123

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.8502 1 125
3vcx-assembly1.cif.gz_A crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.8496 3 124
3vcx-assembly1.cif.gz_B crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.8443 1 124
3vcx-assembly1.cif.gz_B crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.8316 1 124
1lqo-assembly1.cif.gz_B crystal strutcure of the fosfomycin resistance protein a (fosa) containing bound thallium cations 0.8142 1 123
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9353 74 121 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9312 74 124 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9151 74 122 3.30.720.110
2pjsB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9018 75 122 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8605 73 126 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A2V5LUB2-F1-model_v4 Glyoxalase 0.9911 1 131
AF-A0A2V5DB55-F1-model_v4 deleted 0.9896 1 132
AF-A0A1H0VVZ4-F1-model_v4 Catechol 2,3-dioxygenase 0.988 1 132 GO:0004493
GO:0046491
GO:0046872
GO:0051213
AF-A0A6H1A514-F1-model_v4 VOC family protein 0.9866 1 131 GO:0004493
GO:0046491
AF-A0A2P8E060-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9819 1 134 GO:0016829
GO:0051213

Map