F438609

General Info

Members Datasets Scaffolds Average Seq Length
415 204 830 179

Family's Representative Sequence

Representative Sequence 3300035691|Ga0373931_0117434|Ga0373931_0117434_817_1467
Length 216
Sequence MRAAVCETAADPLTTAATCLAARPDAPWAFEAFRIIPAVKLYTRTGDGGETSYFDGTRVRKDDPRLDAYGEIDELNGWLGFVRAYGLDAPFDEALSRIQRDLFAFGAQLADPADKLSPRVVKAVISDEDVHRVEALIDDVDSEVPPLRRFILPGGTPAGAALHVARTVCRRAERRLVALATPVDPVLLRYINRLSDLLFALARAVNHRQGVPETEW

Samples

Sample ID Description Type Environment
1 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
130 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
131 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
134 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
135 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
141 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
142 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
143 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
144 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
151 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
152 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
180 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
181 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
200 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
201 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 5.78
Rhizosphere 93.98
Stem 0
Stem Tuber 0
Unclassified 2.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373931_0117434 3300035691 Bacteria 1517
2 Ga0070658_10064665 3300005327 Bacteria 2984
3 Ga0068869_100213436 3300005334 Bacteria 1527
4 Ga0070666_10016263 3300005335 Bacteria 4757
5 Ga0070666_10020049 3300005335 Bacteria 4319
6 Ga0070666_10425239 3300005335 Bacteria 957
7 Ga0070680_100203160 3300005336 Bacteria 1671
8 Ga0068868_100014410 3300005338 Bacteria 5827
9 Ga0068868_100133010 3300005338 Bacteria 2037
10 Ga0068868_100575475 3300005338 Bacteria 995
11 Ga0068868_100762558 3300005338 Bacteria 870
12 Ga0068868_100855905 3300005338 Bacteria 824
13 Ga0070660_100004015 3300005339 Bacteria 10158
14 Ga0070689_100113529 3300005340 Bacteria 2157
15 Ga0070689_100992102 3300005340 Bacteria 747
16 Ga0070687_100029796 3300005343 Bacteria 2661
17 Ga0070687_100336342 3300005343 Bacteria 970
18 Ga0070668_100038335 3300005347 Bacteria 3662
19 Ga0070669_100025526 3300005353 Bacteria 4244
20 Ga0070669_100162449 3300005353 Bacteria 1736
21 Ga0070669_100229693 3300005353 Bacteria 1470
22 Ga0070675_100001310 3300005354 Bacteria 18174
23 Ga0070671_100006955 3300005355 Bacteria 9060
24 Ga0070671_100021785 3300005355 Bacteria 5234
25 Ga0070674_100010058 3300005356 Bacteria 5696
26 Ga0070674_100362699 3300005356 Bacteria 1174
27 Ga0070674_100467736 3300005356 Bacteria 1044
28 Ga0070688_100239702 3300005365 Bacteria 1286
29 Ga0070667_100032642 3300005367 Bacteria 4343
30 Ga0070667_100072506 3300005367 Bacteria 2935
31 Ga0070667_101552632 3300005367 Unclassified 622
32 Ga0070710_10072719 3300005437 Bacteria 1986
33 Ga0070701_10240357 3300005438 Bacteria 1089
34 Ga0070700_100072852 3300005441 Bacteria 2197
35 Ga0070678_100294545 3300005456 Bacteria 1377
36 Ga0070662_100181093 3300005457 Bacteria 1661
37 Ga0070681_10238789 3300005458 Bacteria 1731
38 Ga0068867_100217226 3300005459 Bacteria 1539
39 Ga0070706_100854752 3300005467 Bacteria 841
40 Ga0070707_100272720 3300005468 Bacteria 1645
41 Ga0070698_100183911 3300005471 Bacteria 2028
42 Ga0070699_100003668 3300005518 Bacteria 13600
43 Ga0070699_100042096 3300005518 Bacteria 3952
44 Ga0070699_100480940 3300005518 Bacteria 1127
45 Ga0070699_100903425 3300005518 Bacteria 809
46 Ga0070679_100277893 3300005530 Bacteria 1628
47 Ga0070697_100170877 3300005536 Bacteria 1840
48 Ga0070697_100246879 3300005536 Bacteria 1526
49 Ga0070697_100876473 3300005536 Bacteria 796
50 Ga0070672_100009866 3300005543 Bacteria 6600
51 Ga0070672_100054081 3300005543 Bacteria 3141
52 Ga0070672_100282540 3300005543 Bacteria 1403
53 Ga0070686_100221027 3300005544 Bacteria 1369
54 Ga0070695_100000785 3300005545 Bacteria 17066
55 Ga0070695_100221408 3300005545 Bacteria 1363
56 Ga0070695_100254366 3300005545 Bacteria 1280
57 Ga0070695_100359828 3300005545 Bacteria 1092
58 Ga0070696_100302401 3300005546 Bacteria 1226
59 Ga0070665_100006386 3300005548 Bacteria 12013
60 Ga0070665_100930752 3300005548 Unclassified 882
61 Ga0070704_100001151 3300005549 Bacteria 13820
62 Ga0070704_100009239 3300005549 Bacteria 5949
63 Ga0070704_100553101 3300005549 Bacteria 1006
64 Ga0070704_100586439 3300005549 Bacteria 978
65 Ga0070704_100776487 3300005549 Bacteria 855
66 Ga0068855_100025383 3300005563 Bacteria 7090
67 Ga0068855_100604686 3300005563 Bacteria 1182
68 Ga0068856_100157291 3300005614 Bacteria 2283
69 Ga0068852_101144584 3300005616 Bacteria 799
70 Ga0068859_100428607 3300005617 Bacteria 1419
71 Ga0068866_10044749 3300005718 Bacteria 2216
72 Ga0068861_100068191 3300005719 Bacteria 2748
73 Ga0068861_101345888 3300005719 Bacteria 696
74 Ga0068870_10165610 3300005840 Bacteria 1315
75 Ga0068863_100071126 3300005841 Bacteria 3291
76 Ga0068863_100145998 3300005841 Bacteria 2262
77 Ga0068863_100462842 3300005841 Bacteria 1245
78 Ga0068858_100005453 3300005842 Bacteria 12454
79 Ga0068858_100018508 3300005842 Bacteria 6522
80 Ga0068858_100170025 3300005842 Bacteria 2055
81 Ga0068858_100262510 3300005842 Bacteria 1642
82 Ga0068860_100161316 3300005843 Bacteria 2162
83 Ga0068860_100228317 3300005843 Bacteria 1809
84 Ga0068862_100017420 3300005844 Bacteria 5984
85 Ga0068862_100477490 3300005844 Bacteria 1180
86 Ga0081539_10009621 3300005985 Bacteria 8024
87 Ga0070717_10405440 3300006028 Bacteria 1225
88 Ga0075432_10123955 3300006058 Bacteria 973
89 Ga0070715_10126415 3300006163 Bacteria 1225
90 Ga0070716_100046725 3300006173 Bacteria 2438
91 Ga0070716_100332523 3300006173 Bacteria 1069
92 Ga0070712_100200554 3300006175 Bacteria 1567
93 Ga0097621_100000477 3300006237 Bacteria 28162
94 Ga0097621_100002349 3300006237 Bacteria 12970
95 Ga0097621_100045918 3300006237 Bacteria 3531
96 Ga0097621_100062283 3300006237 Bacteria 3062
97 Ga0068871_100003215 3300006358 Bacteria 11207
98 Ga0068871_100006890 3300006358 Bacteria 8090
99 Ga0068871_100090565 3300006358 Bacteria 2548
100 Ga0068871_100519342 3300006358 Bacteria 1075
101 Ga0075428_100001453 3300006844 Bacteria 25347
102 Ga0075428_100088823 3300006844 Bacteria 3371
103 Ga0075431_100180572 3300006847 Bacteria 2166
104 Ga0075431_100229273 3300006847 Bacteria 1893
105 Ga0075433_10134565 3300006852 Bacteria 2197
106 Ga0075433_10185888 3300006852 Bacteria 1849
107 Ga0075433_10220317 3300006852 Bacteria 1685
108 Ga0075433_10340526 3300006852 Bacteria 1326
109 Ga0075433_10416495 3300006852 Bacteria 1185
110 Ga0075433_10779085 3300006852 Bacteria 836
111 Ga0075434_100004294 3300006871 Bacteria 12804
112 Ga0075434_100169898 3300006871 Bacteria 2200
113 Ga0075434_100326423 3300006871 Bacteria 1555
114 Ga0075434_100660194 3300006871 Bacteria 1064
115 Ga0075434_100891953 3300006871 Bacteria 904
116 Ga0075434_101074993 3300006871 Bacteria 818
117 Ga0075429_100010738 3300006880 Bacteria 7919
118 Ga0075429_100198279 3300006880 Bacteria 1758
119 Ga0068865_100008148 3300006881 Bacteria 6466
120 Ga0068865_100355721 3300006881 Bacteria 1187
121 Ga0068865_100511561 3300006881 Bacteria 1003
122 Ga0075436_100000295 3300006914 Bacteria 31676
123 Ga0075436_100007582 3300006914 Bacteria 7413
124 Ga0075436_100033438 3300006914 Bacteria 3544
125 Ga0075436_100067660 3300006914 Bacteria 2468
126 Ga0075436_100108236 3300006914 Bacteria 1939
127 Ga0075436_100162845 3300006914 Bacteria 1573
128 Ga0075436_100726829 3300006914 Bacteria 736
129 Ga0097620_100428635 3300006931 Bacteria 1419
130 Ga0075435_100000147 3300007076 Bacteria 39845
131 Ga0075435_100002656 3300007076 Bacteria 11922
132 Ga0075435_100043539 3300007076 Bacteria 3593
133 Ga0075435_100102093 3300007076 Bacteria 2377
134 Ga0075435_100211738 3300007076 Bacteria 1645
135 Ga0075435_100287440 3300007076 Bacteria 1404
136 Ga0075435_100386706 3300007076 Bacteria 1202
137 Ga0105240_10087553 3300009093 Bacteria 3814
138 Ga0105240_10430266 3300009093 Bacteria 1481
139 Ga0111539_10003968 3300009094 Bacteria 19443
140 Ga0111539_10019925 3300009094 Bacteria 8261
141 Ga0111539_10099144 3300009094 Bacteria 3422
142 Ga0111539_10300130 3300009094 Bacteria 1869
143 Ga0111539_10686188 3300009094 Bacteria 1192
144 Ga0105245_10007131 3300009098 Bacteria 9804
145 Ga0105245_10203996 3300009098 Bacteria 1900
146 Ga0105247_10002601 3300009101 Bacteria 12198
147 Ga0105247_10021259 3300009101 Bacteria 3904
148 Ga0114129_10001820 3300009147 Bacteria 29050
149 Ga0114129_10036366 3300009147 Bacteria 6954
150 Ga0114129_10042168 3300009147 Bacteria 6426
151 Ga0114129_10042184 3300009147 Bacteria 6424
152 Ga0114129_10056418 3300009147 Bacteria 5501
153 Ga0114129_10079061 3300009147 Bacteria 4573
154 Ga0114129_10103088 3300009147 Bacteria 3945
155 Ga0114129_10121255 3300009147 Bacteria 3598
156 Ga0114129_10284133 3300009147 Bacteria 2210
157 Ga0114129_11485069 3300009147 Bacteria 833
158 Ga0105243_11087326 3300009148 Bacteria 807
159 Ga0105242_10003632 3300009176 Bacteria 12008
160 Ga0105242_10009280 3300009176 Bacteria 7552
161 Ga0105242_10032119 3300009176 Bacteria 4197
162 Ga0105242_10190537 3300009176 Bacteria 1815
163 Ga0105242_10333714 3300009176 Bacteria 1395
164 Ga0105248_10007082 3300009177 Bacteria 12281
165 Ga0105248_10007612 3300009177 Bacteria 11897
166 Ga0105248_10032035 3300009177 Bacteria 5874
167 Ga0105248_10071222 3300009177 Bacteria 3905
168 Ga0105248_10558608 3300009177 Bacteria 1291
169 Ga0105248_11599118 3300009177 Bacteria 738
170 Ga0105238_11071101 3300009551 Bacteria 828
171 Ga0105249_10655283 3300009553 Bacteria 1108
172 Ga0157378_10092213 3300013297 Bacteria 2756
173 Ga0157378_10204946 3300013297 Bacteria 1867
174 Ga0163162_10057287 3300013306 Bacteria 3925
175 Ga0163162_10396747 3300013306 Bacteria 1512
176 Ga0157375_10462321 3300013308 Bacteria 1434
177 Ga0157375_10548592 3300013308 Bacteria 1318
178 Ga0157375_10667566 3300013308 Bacteria 1195
179 Ga0157380_10059789 3300014326 Bacteria 3043
180 Ga0157380_10113028 3300014326 Bacteria 2286
181 Ga0157380_10236417 3300014326 Bacteria 1644
182 Ga0157380_11174099 3300014326 Bacteria 810
183 Ga0157379_10021777 3300014968 Bacteria 5678
184 Ga0157379_10346423 3300014968 Bacteria 1359
185 Ga0157379_10393591 3300014968 Bacteria 1273
186 Ga0157376_10019378 3300014969 Bacteria 5243
187 Ga0157376_10040382 3300014969 Bacteria 3813
188 Ga0157376_10077272 3300014969 Unclassified 2847
189 Ga0157376_10648090 3300014969 Bacteria 1056
190 Ga0207697_10042999 3300025315 Bacteria 1857
191 Ga0207713_1074539 3300025735 Bacteria 1241
192 Ga0207642_10153223 3300025899 Bacteria 1229
193 Ga0207710_10022302 3300025900 Bacteria 2718
194 Ga0207680_10076428 3300025903 Bacteria 2091
195 Ga0207680_10317714 3300025903 Bacteria 1088
196 Ga0207645_10334481 3300025907 Bacteria 1012
197 Ga0207643_10213477 3300025908 Bacteria 1179
198 Ga0207684_10872542 3300025910 Bacteria 758
199 Ga0207707_10064354 3300025912 Bacteria 3192
200 Ga0207707_10151438 3300025912 Bacteria 2028
201 Ga0207695_10077309 3300025913 Bacteria 3381
202 Ga0207695_10290506 3300025913 Bacteria 1527
203 Ga0207695_11099390 3300025913 Bacteria 675
204 Ga0207693_10087776 3300025915 Bacteria 2437
205 Ga0207660_10103483 3300025917 Bacteria 2130
206 Ga0207662_10035075 3300025918 Bacteria 2929
207 Ga0207657_10022684 3300025919 Bacteria 5865
208 Ga0207652_10109128 3300025921 Bacteria 2453
209 Ga0207646_10020802 3300025922 Bacteria 6075
210 Ga0207646_10125307 3300025922 Bacteria 2309
211 Ga0207646_10274871 3300025922 Bacteria 1522
212 Ga0207681_10170014 3300025923 Bacteria 1651
213 Ga0207681_10237377 3300025923 Bacteria 1417
214 Ga0207659_10000076 3300025926 Bacteria 62373
215 Ga0207659_10010079 3300025926 Bacteria 5922
216 Ga0207700_10015933 3300025928 Bacteria 4978
217 Ga0207690_10112053 3300025932 Bacteria 1967
218 Ga0207706_10364625 3300025933 Bacteria 1255
219 Ga0207686_10032824 3300025934 Bacteria 3093
220 Ga0207670_10065820 3300025936 Bacteria 2488
221 Ga0207670_10337517 3300025936 Bacteria 1190
222 Ga0207669_10163465 3300025937 Bacteria 1575
223 Ga0207669_10195674 3300025937 Bacteria 1463
224 Ga0207704_10009910 3300025938 Bacteria 4621
225 Ga0207704_10444231 3300025938 Bacteria 1034
226 Ga0207665_10542756 3300025939 Bacteria 902
227 Ga0207691_10013986 3300025940 Bacteria 7657
228 Ga0207691_10034581 3300025940 Bacteria 4698
229 Ga0207691_10084480 3300025940 Bacteria 2849
230 Ga0207691_10305564 3300025940 Bacteria 1366
231 Ga0207711_10044870 3300025941 Bacteria 3775
232 Ga0207711_10064653 3300025941 Bacteria 3160
233 Ga0207711_10065054 3300025941 Bacteria 3151
234 Ga0207711_10433449 3300025941 Bacteria 1223
235 Ga0207667_10073574 3300025949 Bacteria 3550
236 Ga0207712_10502753 3300025961 Bacteria 1036
237 Ga0207668_10077894 3300025972 Bacteria 2392
238 Ga0207658_10134664 3300025986 Bacteria 1990
239 Ga0207658_10429397 3300025986 Bacteria 1166
240 Ga0207677_10012042 3300026023 Bacteria 4955
241 Ga0207677_10100340 3300026023 Bacteria 2128
242 Ga0207703_10021445 3300026035 Bacteria 5057
243 Ga0207703_10039244 3300026035 Bacteria 3783
244 Ga0207703_10221443 3300026035 Bacteria 1692
245 Ga0207703_10853503 3300026035 Bacteria 871
246 Ga0207708_10052397 3300026075 Bacteria 3108
247 Ga0207708_10062935 3300026075 Bacteria 2835
248 Ga0207708_10179103 3300026075 Bacteria 1683
249 Ga0207641_10002636 3300026088 Bacteria 16427
250 Ga0207641_10161163 3300026088 Bacteria 2039
251 Ga0207641_10447268 3300026088 Bacteria 1248
252 Ga0207648_10074258 3300026089 Bacteria 2963
253 Ga0207648_10638974 3300026089 Bacteria 983
254 Ga0207648_10679255 3300026089 Bacteria 953
255 Ga0207676_10019208 3300026095 Bacteria 4981
256 Ga0207674_10329664 3300026116 Bacteria 1476
257 Ga0207675_100044108 3300026118 Bacteria 4166
258 Ga0207675_100168440 3300026118 Bacteria 2093
259 Ga0207683_10166642 3300026121 Bacteria 1994
260 Ga0207428_10030701 3300027907 Bacteria 4440
261 Ga0207428_10649940 3300027907 Bacteria 757
262 Ga0268266_10003789 3300028379 Bacteria 14802
263 Ga0268265_10005243 3300028380 Bacteria 8869
264 Ga0268265_10078900 3300028380 Bacteria 2591
265 Ga0268265_10430771 3300028380 Bacteria 1227
266 Ga0268264_10075271 3300028381 Bacteria 2870
267 Ga0268264_10097166 3300028381 Bacteria 2552
268 Ga0268264_10210778 3300028381 Bacteria 1783
269 Ga0268264_10214697 3300028381 Bacteria 1768
270 Ga0268264_10263906 3300028381 Bacteria 1606
271 Ga0268264_11381658 3300028381 Unclassified 715
272 Ga0307413_10693690 3300031824 Bacteria 845
273 Ga0307407_10160748 3300031903 Bacteria 1470
274 Ga0307407_10502796 3300031903 Bacteria 889
275 Ga0307409_100017810 3300031995 Bacteria 4749
276 Ga0307415_100262164 3300032126 Bacteria 1411
277 Ga0373934_0020961 3300035086 Bacteria 2516
278 Ga0373939_0063464 3300035114 Bacteria 1183
279 Ga0373960_0007855 3300035121 Bacteria 2538
280 Ga0373943_0091536 3300035170 Bacteria 1576
281 Ga0373946_0048279 3300035171 Bacteria 1772
282 Ga0373942_0015104 3300035207 Bacteria 1877
283 Ga0373962_0008481 3300035242 Bacteria 2530
284 Ga0373962_0020830 3300035242 Bacteria 1725
285 Ga0373947_0302464 3300035725 Bacteria 1067
286 Ga0373947_0669719 3300035725 Bacteria 708
287 Ga0373937_0277362 3300036401 Bacteria 1583
288 Ga0373937_0801147 3300036401 Unclassified 890
289 Ga0373937_1200467 3300036401 Bacteria 707
290 Ga0316582_0464895 3300036647 Bacteria 872
291 Ga0373925_0244847 3300037068 Bacteria 1437
292 Ga0373925_0807988 3300037068 Bacteria 773
293 Ga0439461_0089580 3300041410 Bacteria 736
294 Ga0439454_012877 3300042011 Bacteria 1140
295 Ga0450923_049055 3300042125 Bacteria 903
296 Ga0439446_0076940 3300042156 Bacteria 1028
297 Ga0439435_0006886 3300042436 Bacteria 2575
298 Ga0451576_0061257 3300045051 Bacteria 3924
299 Ga0451576_0434270 3300045051 Bacteria 1378
300 Ga0451576_0582849 3300045051 Bacteria 1175
301 Ga0466967_0115211 3300045976 Bacteria 2475
302 Ga0466967_0476063 3300045976 Bacteria 1223
303 Ga0495629_0126042 3300046459 Bacteria 1784
304 Ga0495580_0725195 3300046472 Unclassified 649
305 Ga0495628_0143982 3300046516 Bacteria 1818
306 Ga0495598_0179240 3300046537 Bacteria 755
307 Ga0495656_0046985 3300046615 Bacteria 1829
308 Ga0495659_0075079 3300046664 Bacteria 1273
309 Ga0495659_0099162 3300046664 Bacteria 1126
310 Ga0495658_0051848 3300046683 Bacteria 2325
311 Ga0495658_0061502 3300046683 Bacteria 2156
312 Ga0495658_0498181 3300046683 Bacteria 779
313 Ga0495581_0283673 3300047315 Bacteria 968
314 Ga0495676_0177739 3300047321 Bacteria 1494
315 Ga0495614_0232763 3300048089 Bacteria 840
316 Ga0496100_0011207 3300048903 Bacteria 5097
317 Ga0496101_0000348 3300048904 Bacteria 31198
318 Ga0496101_0223193 3300048904 Bacteria 1463
319 Ga0496102_0051122 3300048905 Bacteria 3765
320 Ga0496102_0327088 3300048905 Bacteria 1444
321 Ga0496104_0047577 3300048907 Bacteria 4042
322 Ga0496104_0414394 3300048907 Bacteria 1259
323 Ga0496105_0047891 3300048908 Bacteria 3528
324 Ga0496107_0032552 3300048910 Bacteria 3727
325 Ga0496107_0355077 3300048910 Bacteria 1091
326 Ga0496108_0008918 3300048911 Bacteria 8128
327 Ga0496109_0038774 3300048912 Bacteria 4309
328 Ga0496109_0207077 3300048912 Bacteria 1844
329 Ga0496109_0417528 3300048912 Bacteria 1268
330 Ga0496109_1318187 3300048912 Bacteria 658
331 Ga0496109_1471442 3300048912 Unclassified 616
332 Ga0496110_0808343 3300048913 Bacteria 842
333 Ga0496110_1092848 3300048913 Bacteria 706
334 Ga0496112_0008251 3300048915 Bacteria 9319
335 Ga0496112_0244400 3300048915 Bacteria 1747
336 Ga0496113_0065844 3300048916 Bacteria 2743
337 Ga0496114_0002236 3300048917 Bacteria 14743
338 Ga0496114_0114574 3300048917 Bacteria 2312
339 Ga0496115_0117559 3300048918 Bacteria 2187
340 Ga0501038_0137523 3300049574 Bacteria 2001
341 Ga0501039_0061868 3300049575 Bacteria 2900
342 Ga0501040_0028655 3300049576 Bacteria 3755
343 Ga0501040_0669351 3300049576 Bacteria 750
344 Ga0501041_0049793 3300049577 Bacteria 2552
345 Ga0501042_0019674 3300049578 Bacteria 4692
346 Ga0501046_0070160 3300049580 Bacteria 2725
347 Ga0501048_0021040 3300049582 Bacteria 4779
348 Ga0501068_0390567 3300049584 Bacteria 897
349 Ga0501072_0150075 3300049588 Bacteria 1858
350 Ga0501072_0346893 3300049588 Bacteria 1179
351 Ga0501072_0427950 3300049588 Bacteria 1049
352 Ga0501073_0001232 3300049589 Bacteria 18681
353 Ga0501074_0294882 3300049590 Unclassified 1152
354 Ga0501074_0652927 3300049590 Bacteria 743
355 Ga0501075_0066492 3300049591 Bacteria 2720
356 Ga0501076_0056891 3300049592 Bacteria 3104
357 Ga0501076_0400711 3300049592 Bacteria 1128
358 Ga0501076_0862406 3300049592 Bacteria 747
359 Ga0501077_0240767 3300049593 Unclassified 1150
360 Ga0501079_0011523 3300049741 Bacteria 6750
361 Ga0501080_0310447 3300049742 Bacteria 1429
362 Ga0501081_0023768 3300049743 Bacteria 4110
363 Ga0501081_0507874 3300049743 Bacteria 899
364 Ga0501083_0238343 3300049744 Bacteria 1184
365 Ga0501044_0341768 3300049823 Bacteria 1418
366 Ga0501045_0449962 3300049824 Bacteria 957
367 Ga0501045_0688355 3300049824 Bacteria 755
368 nmdc:mga07m45_276240_c1 3300050496 Bacteria 977
369 nmdc:mga05p37_155465_c1 3300050507 Bacteria 2795
370 nmdc:mga05p37_156666_c1 3300050507 Bacteria 2783
371 nmdc:mga05p37_2105_c1 3300050507 Bacteria 23247
372 nmdc:mga05p37_2819_c1 3300050507 Bacteria 20214
373 nmdc:mga05p37_34458_c1 3300050507 Bacteria 6202
374 nmdc:mga05p37_48251_c1 3300050507 Bacteria 5238
375 nmdc:mga05p37_9997_c1 3300050507 Bacteria 11266
376 nmdc:mga09592_375104_c1 3300050508 Bacteria 1230
377 nmdc:mga09592_594466_c1 3300050508 Bacteria 948
378 nmdc:mga0qj67_1235441_c1 3300050509 Bacteria 580
379 nmdc:mga0qj67_684670_c1 3300050509 Bacteria 816
380 nmdc:mga06r32_453754_c1 3300050510 Bacteria 1261
381 nmdc:mga06r32_8729_c2 3300050510 Bacteria 7940
382 nmdc:mga08y16_21104_c1 3300050511 Bacteria 6877
383 nmdc:mga08y16_301621_c1 3300050511 Bacteria 1651
384 nmdc:mga08y16_362385_c1 3300050511 Bacteria 1488
385 nmdc:mga08y16_82003_c1 3300050511 Bacteria 3362
386 nmdc:mga08y16_889140_c1 3300050511 Bacteria 878
387 nmdc:mga0n895_2320_c1 3300050512 Bacteria 14819
388 nmdc:mga0n895_325807_c1 3300050512 Bacteria 1556
389 nmdc:mga0n895_431470_c1 3300050512 Bacteria 1332
390 nmdc:mga0n895_608580_c1 3300050512 Bacteria 1094
391 nmdc:mga0n895_831852_c1 3300050512 Bacteria 912
392 nmdc:mga0n895_97_c2 3300050512 Bacteria 37428
393 nmdc:mga0rr50_20_c1 3300050513 Bacteria 140799
394 nmdc:mga0rr50_23267_c1 3300050513 Bacteria 4269
395 nmdc:mga0rr50_328445_c1 3300050513 Bacteria 1284
396 nmdc:mga0rr50_346147_c1 3300050513 Bacteria 1249
397 nmdc:mga0rr50_362316_c1 3300050513 Bacteria 1220
398 nmdc:mga0rr50_7259_c1 3300050513 Bacteria 6817
399 nmdc:mga0rr50_91048_c1 3300050513 Bacteria 2374
400 nmdc:mga08x19_178_c1 3300050514 Bacteria 51286
401 nmdc:mga08x19_40890_c1 3300050514 Bacteria 2952
402 nmdc:mga08x19_54541_c1 3300050514 Bacteria 2574
403 nmdc:mga08x19_67468_c1 3300050514 Bacteria 2326
404 nmdc:mga0a205_1016367_c1 3300050515 Bacteria 676
405 nmdc:mga0a205_126278_c2 3300050515 Bacteria 2019
406 nmdc:mga0a205_245270_c1 3300050515 Bacteria 1672
407 nmdc:mga0a205_387971_c1 3300050515 Bacteria 1261
408 nmdc:mga0a205_47006_c1 3300050515 Bacteria 4163
409 nmdc:mga0a205_592345_c1 3300050515 Bacteria 962
410 Ga0495601_0724321 3300053077 Bacteria 634
411 Ga0495595_0034492 3300053084 Bacteria 2289
412 Ga0495619_0129512 3300053085 Bacteria 1734
413 Ga0501084_0025570 3300054114 Bacteria 4925
414 Ga0501082_0023787 3300060353 Bacteria 5283
415 Ga0501082_0162539 3300060353 Bacteria 1941
416 Ga0373931_0117434
417 Ga0070658_10064665
418 Ga0068869_100213436
419 Ga0070666_10016263
420 Ga0070666_10020049
421 Ga0070666_10425239
422 Ga0070680_100203160
423 Ga0068868_100014410
424 Ga0068868_100133010
425 Ga0068868_100575475
426 Ga0068868_100762558
427 Ga0068868_100855905
428 Ga0070660_100004015
429 Ga0070689_100113529
430 Ga0070689_100992102
431 Ga0070687_100029796
432 Ga0070687_100336342
433 Ga0070668_100038335
434 Ga0070669_100025526
435 Ga0070669_100162449
436 Ga0070669_100229693
437 Ga0070675_100001310
438 Ga0070671_100006955
439 Ga0070671_100021785
440 Ga0070674_100010058
441 Ga0070674_100362699
442 Ga0070674_100467736
443 Ga0070688_100239702
444 Ga0070667_100032642
445 Ga0070667_100072506
446 Ga0070667_101552632
447 Ga0070710_10072719
448 Ga0070701_10240357
449 Ga0070700_100072852
450 Ga0070678_100294545
451 Ga0070662_100181093
452 Ga0070681_10238789
453 Ga0068867_100217226
454 Ga0070706_100854752
455 Ga0070707_100272720
456 Ga0070698_100183911
457 Ga0070699_100003668
458 Ga0070699_100042096
459 Ga0070699_100480940
460 Ga0070699_100903425
461 Ga0070679_100277893
462 Ga0070697_100170877
463 Ga0070697_100246879
464 Ga0070697_100876473
465 Ga0070672_100009866
466 Ga0070672_100054081
467 Ga0070672_100282540
468 Ga0070686_100221027
469 Ga0070695_100000785
470 Ga0070695_100221408
471 Ga0070695_100254366
472 Ga0070695_100359828
473 Ga0070696_100302401
474 Ga0070665_100006386
475 Ga0070665_100930752
476 Ga0070704_100001151
477 Ga0070704_100009239
478 Ga0070704_100553101
479 Ga0070704_100586439
480 Ga0070704_100776487
481 Ga0068855_100025383
482 Ga0068855_100604686
483 Ga0068856_100157291
484 Ga0068852_101144584
485 Ga0068859_100428607
486 Ga0068866_10044749
487 Ga0068861_100068191
488 Ga0068861_101345888
489 Ga0068870_10165610
490 Ga0068863_100071126
491 Ga0068863_100145998
492 Ga0068863_100462842
493 Ga0068858_100005453
494 Ga0068858_100018508
495 Ga0068858_100170025
496 Ga0068858_100262510
497 Ga0068860_100161316
498 Ga0068860_100228317
499 Ga0068862_100017420
500 Ga0068862_100477490
501 Ga0081539_10009621
502 Ga0070717_10405440
503 Ga0075432_10123955
504 Ga0070715_10126415
505 Ga0070716_100046725
506 Ga0070716_100332523
507 Ga0070712_100200554
508 Ga0097621_100000477
509 Ga0097621_100002349
510 Ga0097621_100045918
511 Ga0097621_100062283
512 Ga0068871_100003215
513 Ga0068871_100006890
514 Ga0068871_100090565
515 Ga0068871_100519342
516 Ga0075428_100001453
517 Ga0075428_100088823
518 Ga0075431_100180572
519 Ga0075431_100229273
520 Ga0075433_10134565
521 Ga0075433_10185888
522 Ga0075433_10220317
523 Ga0075433_10340526
524 Ga0075433_10416495
525 Ga0075433_10779085
526 Ga0075434_100004294
527 Ga0075434_100169898
528 Ga0075434_100326423
529 Ga0075434_100660194
530 Ga0075434_100891953
531 Ga0075434_101074993
532 Ga0075429_100010738
533 Ga0075429_100198279
534 Ga0068865_100008148
535 Ga0068865_100355721
536 Ga0068865_100511561
537 Ga0075436_100000295
538 Ga0075436_100007582
539 Ga0075436_100033438
540 Ga0075436_100067660
541 Ga0075436_100108236
542 Ga0075436_100162845
543 Ga0075436_100726829
544 Ga0097620_100428635
545 Ga0075435_100000147
546 Ga0075435_100002656
547 Ga0075435_100043539
548 Ga0075435_100102093
549 Ga0075435_100211738
550 Ga0075435_100287440
551 Ga0075435_100386706
552 Ga0105240_10087553
553 Ga0105240_10430266
554 Ga0111539_10003968
555 Ga0111539_10019925
556 Ga0111539_10099144
557 Ga0111539_10300130
558 Ga0111539_10686188
559 Ga0105245_10007131
560 Ga0105245_10203996
561 Ga0105247_10002601
562 Ga0105247_10021259
563 Ga0114129_10001820
564 Ga0114129_10036366
565 Ga0114129_10042168
566 Ga0114129_10042184
567 Ga0114129_10056418
568 Ga0114129_10079061
569 Ga0114129_10103088
570 Ga0114129_10121255
571 Ga0114129_10284133
572 Ga0114129_11485069
573 Ga0105243_11087326
574 Ga0105242_10003632
575 Ga0105242_10009280
576 Ga0105242_10032119
577 Ga0105242_10190537
578 Ga0105242_10333714
579 Ga0105248_10007082
580 Ga0105248_10007612
581 Ga0105248_10032035
582 Ga0105248_10071222
583 Ga0105248_10558608
584 Ga0105248_11599118
585 Ga0105238_11071101
586 Ga0105249_10655283
587 Ga0157378_10092213
588 Ga0157378_10204946
589 Ga0163162_10057287
590 Ga0163162_10396747
591 Ga0157375_10462321
592 Ga0157375_10548592
593 Ga0157375_10667566
594 Ga0157380_10059789
595 Ga0157380_10113028
596 Ga0157380_10236417
597 Ga0157380_11174099
598 Ga0157379_10021777
599 Ga0157379_10346423
600 Ga0157379_10393591
601 Ga0157376_10019378
602 Ga0157376_10040382
603 Ga0157376_10077272
604 Ga0157376_10648090
605 Ga0207697_10042999
606 Ga0207713_1074539
607 Ga0207642_10153223
608 Ga0207710_10022302
609 Ga0207680_10076428
610 Ga0207680_10317714
611 Ga0207645_10334481
612 Ga0207643_10213477
613 Ga0207684_10872542
614 Ga0207707_10064354
615 Ga0207707_10151438
616 Ga0207695_10077309
617 Ga0207695_10290506
618 Ga0207695_11099390
619 Ga0207693_10087776
620 Ga0207660_10103483
621 Ga0207662_10035075
622 Ga0207657_10022684
623 Ga0207652_10109128
624 Ga0207646_10020802
625 Ga0207646_10125307
626 Ga0207646_10274871
627 Ga0207681_10170014
628 Ga0207681_10237377
629 Ga0207659_10000076
630 Ga0207659_10010079
631 Ga0207700_10015933
632 Ga0207690_10112053
633 Ga0207706_10364625
634 Ga0207686_10032824
635 Ga0207670_10065820
636 Ga0207670_10337517
637 Ga0207669_10163465
638 Ga0207669_10195674
639 Ga0207704_10009910
640 Ga0207704_10444231
641 Ga0207665_10542756
642 Ga0207691_10013986
643 Ga0207691_10034581
644 Ga0207691_10084480
645 Ga0207691_10305564
646 Ga0207711_10044870
647 Ga0207711_10064653
648 Ga0207711_10065054
649 Ga0207711_10433449
650 Ga0207667_10073574
651 Ga0207712_10502753
652 Ga0207668_10077894
653 Ga0207658_10134664
654 Ga0207658_10429397
655 Ga0207677_10012042
656 Ga0207677_10100340
657 Ga0207703_10021445
658 Ga0207703_10039244
659 Ga0207703_10221443
660 Ga0207703_10853503
661 Ga0207708_10052397
662 Ga0207708_10062935
663 Ga0207708_10179103
664 Ga0207641_10002636
665 Ga0207641_10161163
666 Ga0207641_10447268
667 Ga0207648_10074258
668 Ga0207648_10638974
669 Ga0207648_10679255
670 Ga0207676_10019208
671 Ga0207674_10329664
672 Ga0207675_100044108
673 Ga0207675_100168440
674 Ga0207683_10166642
675 Ga0207428_10030701
676 Ga0207428_10649940
677 Ga0268266_10003789
678 Ga0268265_10005243
679 Ga0268265_10078900
680 Ga0268265_10430771
681 Ga0268264_10075271
682 Ga0268264_10097166
683 Ga0268264_10210778
684 Ga0268264_10214697
685 Ga0268264_10263906
686 Ga0268264_11381658
687 Ga0307413_10693690
688 Ga0307407_10160748
689 Ga0307407_10502796
690 Ga0307409_100017810
691 Ga0307415_100262164
692 Ga0373934_0020961
693 Ga0373939_0063464
694 Ga0373960_0007855
695 Ga0373943_0091536
696 Ga0373946_0048279
697 Ga0373942_0015104
698 Ga0373962_0008481
699 Ga0373962_0020830
700 Ga0373947_0302464
701 Ga0373947_0669719
702 Ga0373937_0277362
703 Ga0373937_0801147
704 Ga0373937_1200467
705 Ga0316582_0464895
706 Ga0373925_0244847
707 Ga0373925_0807988
708 Ga0439461_0089580
709 Ga0439454_012877
710 Ga0450923_049055
711 Ga0439446_0076940
712 Ga0439435_0006886
713 Ga0451576_0061257
714 Ga0451576_0434270
715 Ga0451576_0582849
716 Ga0466967_0115211
717 Ga0466967_0476063
718 Ga0495629_0126042
719 Ga0495580_0725195
720 Ga0495628_0143982
721 Ga0495598_0179240
722 Ga0495656_0046985
723 Ga0495659_0075079
724 Ga0495659_0099162
725 Ga0495658_0051848
726 Ga0495658_0061502
727 Ga0495658_0498181
728 Ga0495581_0283673
729 Ga0495676_0177739
730 Ga0495614_0232763
731 Ga0496100_0011207
732 Ga0496101_0000348
733 Ga0496101_0223193
734 Ga0496102_0051122
735 Ga0496102_0327088
736 Ga0496104_0047577
737 Ga0496104_0414394
738 Ga0496105_0047891
739 Ga0496107_0032552
740 Ga0496107_0355077
741 Ga0496108_0008918
742 Ga0496109_0038774
743 Ga0496109_0207077
744 Ga0496109_0417528
745 Ga0496109_1318187
746 Ga0496109_1471442
747 Ga0496110_0808343
748 Ga0496110_1092848
749 Ga0496112_0008251
750 Ga0496112_0244400
751 Ga0496113_0065844
752 Ga0496114_0002236
753 Ga0496114_0114574
754 Ga0496115_0117559
755 Ga0501038_0137523
756 Ga0501039_0061868
757 Ga0501040_0028655
758 Ga0501040_0669351
759 Ga0501041_0049793
760 Ga0501042_0019674
761 Ga0501046_0070160
762 Ga0501048_0021040
763 Ga0501068_0390567
764 Ga0501072_0150075
765 Ga0501072_0346893
766 Ga0501072_0427950
767 Ga0501073_0001232
768 Ga0501074_0294882
769 Ga0501074_0652927
770 Ga0501075_0066492
771 Ga0501076_0056891
772 Ga0501076_0400711
773 Ga0501076_0862406
774 Ga0501077_0240767
775 Ga0501079_0011523
776 Ga0501080_0310447
777 Ga0501081_0023768
778 Ga0501081_0507874
779 Ga0501083_0238343
780 Ga0501044_0341768
781 Ga0501045_0449962
782 Ga0501045_0688355
783 nmdc:mga07m45_276240_c1
784 nmdc:mga05p37_155465_c1
785 nmdc:mga05p37_156666_c1
786 nmdc:mga05p37_2105_c1
787 nmdc:mga05p37_2819_c1
788 nmdc:mga05p37_34458_c1
789 nmdc:mga05p37_48251_c1
790 nmdc:mga05p37_9997_c1
791 nmdc:mga09592_375104_c1
792 nmdc:mga09592_594466_c1
793 nmdc:mga0qj67_1235441_c1
794 nmdc:mga0qj67_684670_c1
795 nmdc:mga06r32_453754_c1
796 nmdc:mga06r32_8729_c2
797 nmdc:mga08y16_21104_c1
798 nmdc:mga08y16_301621_c1
799 nmdc:mga08y16_362385_c1
800 nmdc:mga08y16_82003_c1
801 nmdc:mga08y16_889140_c1
802 nmdc:mga0n895_2320_c1
803 nmdc:mga0n895_325807_c1
804 nmdc:mga0n895_431470_c1
805 nmdc:mga0n895_608580_c1
806 nmdc:mga0n895_831852_c1
807 nmdc:mga0n895_97_c2
808 nmdc:mga0rr50_20_c1
809 nmdc:mga0rr50_23267_c1
810 nmdc:mga0rr50_328445_c1
811 nmdc:mga0rr50_346147_c1
812 nmdc:mga0rr50_362316_c1
813 nmdc:mga0rr50_7259_c1
814 nmdc:mga0rr50_91048_c1
815 nmdc:mga08x19_178_c1
816 nmdc:mga08x19_40890_c1
817 nmdc:mga08x19_54541_c1
818 nmdc:mga08x19_67468_c1
819 nmdc:mga0a205_1016367_c1
820 nmdc:mga0a205_126278_c2
821 nmdc:mga0a205_245270_c1
822 nmdc:mga0a205_387971_c1
823 nmdc:mga0a205_47006_c1
824 nmdc:mga0a205_592345_c1
825 Ga0495601_0724321
826 Ga0495595_0034492
827 Ga0495619_0129512
828 Ga0501084_0025570
829 Ga0501082_0023787
830 Ga0501082_0162539

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01923

Cob_adeno_trans

Cobalamin adenosyltransferase

41

205

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zhy-assembly1.cif.gz_A crystal structure of a pduo-type atp:cobalamin adenosyltransferase from burkholderia thailandensis 0.9445 25 180
5im6-assembly1.cif.gz_A crystal structure of designed two-component self-assembling icosahedral cage i32-28 0.944 24 182
7ruu-assembly2.cif.gz_B-4 structure of human atp:cobalamin adenosyltransferase r190c bound to adenosylcobalamin 0.9428 24 182
1rty-assembly1.cif.gz_C crystal structure of bacillus subtilis yvqk, a putative atp-binding cobalamin adenosyltransferase, the north east structural genomics target sr128 0.9337 26 182
2zhy-assembly1.cif.gz_A crystal structure of a pduo-type atp:cobalamin adenosyltransferase from burkholderia thailandensis 0.9321 25 180
ID Description Score Start End Superfamily
2zhzB01 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9452 13 182 1.20.1200.10
1rtyC00 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9376 26 182 1.20.1200.10
2zhzB01 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9283 13 182 1.20.1200.10
af_Q18218_22_209_1.20.1200.10 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9236 13 182 1.20.1200.10
1rtyA00 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.9209 23 182 1.20.1200.10
ID Description Score Start End GO Terms
AF-M5CJ67-F1-model_v4 deleted 0.9557 2 182
AF-A0A7V4HC72-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9541 1 182 GO:0005524
GO:0008817
GO:0009236
AF-A0A522QMK5-F1-model_v4 Cobalamin adenosyltransferase (EC 2.5.1.-) 0.9538 2 182 GO:0005524
GO:0008817
GO:0009236
AF-A0A0S1B2L9-F1-model_v4 Corrinoid adenosyltransferase (EC 2.5.1.17) (Cob(II)alamin adenosyltransferase) (Cob(II)yrinic acid a,c-diamide adenosyltransferase) (Cobinamide/cobalamin adenosyltransferase) 0.9537 2 182 GO:0005524
GO:0008817
GO:0009236
GO:0016020
AF-A0A7J3HNR6-F1-model_v4 Cob(I)yrinic acid a,c-diamide adenosyltransferase (EC 2.5.1.17) 0.9535 3 182 GO:0005524
GO:0008817

Map