F438242

General Info

Members Datasets Scaffolds Average Seq Length
414 187 414 208

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100444487|Ga0070682_1004444871
Length 243
Sequence MAVPRPARLYDYRSYRRRGALEGFTRRRHSNPRNLGILRAGVIATASKRTVRLFSTLVPLAVVAGVFAFLAHAIIHDSRQQQLHLADAIVVFGAAEYDGRPSPVYKARLDHANALFRQGLAPLVVTTGGAAADPKFSEGGVGHDYLMRRGVPESALIAETTASDTAQSAERVAVIMRTNHMQSCIAVSDAYHVFRIRKLLEHQGLTVYLAPRADSRPKSLWQRSLAILREGASYLVWRIGMRS

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
139 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
143 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
144 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
145 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
164 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.11
Rhizosphere 94.93
Stem 0
Stem Tuber 0
Unclassified 0.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10217886 3300005328 Unclassified 1259
2 Ga0070683_100090199 3300005329 Unclassified 2878
3 Ga0070690_100060234 3300005330 Bacteria 2443
4 Ga0070690_100164807 3300005330 Bacteria 1521
5 Ga0070670_100926554 3300005331 Unclassified 791
6 Ga0068869_100024706 3300005334 Bacteria 4164
7 Ga0070680_100049786 3300005336 Unclassified 3416
8 Ga0070682_100009356 3300005337 Bacteria 5545
9 Ga0070682_100444487 3300005337 Unclassified 991
10 Ga0068868_100006273 3300005338 Bacteria 8410
11 Ga0068868_100019681 3300005338 Bacteria 5061
12 Ga0068868_100046095 3300005338 Bacteria 3413
13 Ga0068868_100558227 3300005338 Unclassified 1010
14 Ga0070660_100131506 3300005339 Unclassified 2003
15 Ga0070660_100410616 3300005339 Bacteria 1120
16 Ga0070691_10028829 3300005341 Unclassified 2596
17 Ga0070661_100032454 3300005344 Bacteria 3781
18 Ga0070668_100017159 3300005347 Bacteria 5418
19 Ga0070669_100458841 3300005353 Viruses 1051
20 Ga0070671_100370810 3300005355 Unclassified 1223
21 Ga0070673_100177264 3300005364 Unclassified 1823
22 Ga0070659_100039656 3300005366 Bacteria 3677
23 Ga0070667_100012552 3300005367 Bacteria 7007
24 Ga0070709_10074967 3300005434 Unclassified 2193
25 Ga0070714_100003563 3300005435 Bacteria 11639
26 Ga0070714_100759865 3300005435 Bacteria 937
27 Ga0070713_100007696 3300005436 Bacteria 7582
28 Ga0070713_100092804 3300005436 Bacteria 2600
29 Ga0070713_100127956 3300005436 Unclassified 2237
30 Ga0070713_100191099 3300005436 Unclassified 1845
31 Ga0070713_100482888 3300005436 Bacteria 1167
32 Ga0070713_100524249 3300005436 Unclassified 1120
33 Ga0070713_100834304 3300005436 Bacteria 885
34 Ga0070710_10201319 3300005437 Bacteria 1257
35 Ga0070710_10363090 3300005437 Unclassified 961
36 Ga0070711_100026664 3300005439 Unclassified 3788
37 Ga0070711_100055222 3300005439 Unclassified 2743
38 Ga0070705_100099578 3300005440 Bacteria 1832
39 Ga0070705_100326973 3300005440 Viruses 1109
40 Ga0070708_100004518 3300005445 Bacteria 10952
41 Ga0070678_100129987 3300005456 Bacteria 1999
42 Ga0070662_100011274 3300005457 Bacteria 5893
43 Ga0070662_100136079 3300005457 Unclassified 1900
44 Ga0070681_10000055 3300005458 Bacteria 80179
45 Ga0070681_10058614 3300005458 Unclassified 3830
46 Ga0070681_10583645 3300005458 Unclassified 1032
47 Ga0070681_10831591 3300005458 Unclassified 841
48 Ga0068867_100192008 3300005459 Viruses 1630
49 Ga0070706_100001295 3300005467 Bacteria 26667
50 Ga0070706_100188452 3300005467 Bacteria 1928
51 Ga0070706_100199493 3300005467 Bacteria 1869
52 Ga0070706_100675366 3300005467 Unclassified 958
53 Ga0070707_100188551 3300005468 Bacteria 2010
54 Ga0070707_100803492 3300005468 Unclassified 904
55 Ga0070707_101155907 3300005468 Bacteria 740
56 Ga0070699_100629184 3300005518 Unclassified 979
57 Ga0070699_100799776 3300005518 Unclassified 863
58 Ga0070699_101052843 3300005518 Unclassified 746
59 Ga0070679_100011374 3300005530 Bacteria 8478
60 Ga0070679_100039036 3300005530 Bacteria 4720
61 Ga0070679_100178411 3300005530 Bacteria 2097
62 Ga0070679_100418365 3300005530 Unclassified 1286
63 Ga0070684_100012684 3300005535 Bacteria 6762
64 Ga0070697_100000581 3300005536 Bacteria 27631
65 Ga0070697_100072130 3300005536 Bacteria 2833
66 Ga0070697_100493206 3300005536 Bacteria 1070
67 Ga0068853_100032579 3300005539 Bacteria 4415
68 Ga0068853_100106349 3300005539 Bacteria 2487
69 Ga0070686_100306755 3300005544 Viruses 1179
70 Ga0070693_100061490 3300005547 Bacteria 2183
71 Ga0070693_100157306 3300005547 Bacteria 1444
72 Ga0070693_100158189 3300005547 Unclassified 1441
73 Ga0068855_100004676 3300005563 Bacteria 16724
74 Ga0068855_100005055 3300005563 Bacteria 16097
75 Ga0068855_100110386 3300005563 Unclassified 3158
76 Ga0068855_100151683 3300005563 Bacteria 2635
77 Ga0070664_100012358 3300005564 Bacteria 6938
78 Ga0070664_100639929 3300005564 Unclassified 988
79 Ga0068857_100000041 3300005577 Bacteria 70173
80 Ga0068857_100001831 3300005577 Bacteria 17108
81 Ga0068857_100165417 3300005577 Unclassified 2008
82 Ga0068857_100650956 3300005577 Unclassified 999
83 Ga0068854_100097318 3300005578 Bacteria 2200
84 Ga0068854_100157585 3300005578 Bacteria 1756
85 Ga0068854_100805616 3300005578 Bacteria 819
86 Ga0068856_100002231 3300005614 Bacteria 20017
87 Ga0068856_100003398 3300005614 Bacteria 16113
88 Ga0068856_100009069 3300005614 Bacteria 9678
89 Ga0068856_100022418 3300005614 Bacteria 6140
90 Ga0068856_100162553 3300005614 Unclassified 2244
91 Ga0068856_100369850 3300005614 Unclassified 1452
92 Ga0068852_100095928 3300005616 Bacteria 2665
93 Ga0068852_100194563 3300005616 Bacteria 1915
94 Ga0068852_100363014 3300005616 Bacteria 1417
95 Ga0068859_100088193 3300005617 Bacteria 3151
96 Ga0068859_101306036 3300005617 Unclassified 800
97 Ga0068864_100009181 3300005618 Bacteria 8153
98 Ga0068864_100049101 3300005618 Bacteria 3630
99 Ga0068851_10288750 3300005834 Unclassified 940
100 Ga0068863_100072372 3300005841 Bacteria 3261
101 Ga0068863_100093985 3300005841 Unclassified 2846
102 Ga0068863_100124378 3300005841 Unclassified 2461
103 Ga0068858_100005503 3300005842 Bacteria 12401
104 Ga0068858_100028764 3300005842 Bacteria 5161
105 Ga0068858_100087467 3300005842 Bacteria 2898
106 Ga0068858_100193781 3300005842 Bacteria 1920
107 Ga0068858_100451632 3300005842 Unclassified 1239
108 Ga0068858_100501492 3300005842 Bacteria 1173
109 Ga0068860_100077719 3300005843 Bacteria 3157
110 Ga0068860_100235027 3300005843 Bacteria 1782
111 Ga0068860_100319279 3300005843 Bacteria 1524
112 Ga0068862_100025725 3300005844 Bacteria 4942
113 Ga0070717_10001449 3300006028 Bacteria 16366
114 Ga0070717_10007827 3300006028 Bacteria 7951
115 Ga0070717_10013246 3300006028 Bacteria 6311
116 Ga0070717_10014758 3300006028 Bacteria 6011
117 Ga0070717_10042350 3300006028 Bacteria 3714
118 Ga0070717_10053603 3300006028 Bacteria 3325
119 Ga0070717_10252281 3300006028 Bacteria 1559
120 Ga0070717_10513417 3300006028 Unclassified 1084
121 Ga0070715_10133585 3300006163 Unclassified 1197
122 Ga0070716_100005762 3300006173 Bacteria 6019
123 Ga0070716_100045060 3300006173 Bacteria 2474
124 Ga0070716_100102539 3300006173 Bacteria 1757
125 Ga0070716_100134472 3300006173 Unclassified 1568
126 Ga0070712_100006146 3300006175 Bacteria 7431
127 Ga0070712_100040410 3300006175 Bacteria 3198
128 Ga0070712_100056190 3300006175 Unclassified 2760
129 Ga0070712_100184954 3300006175 Bacteria 1626
130 Ga0070712_101053116 3300006175 Unclassified 705
131 Ga0097621_100000990 3300006237 Bacteria 19959
132 Ga0097621_100001471 3300006237 Bacteria 16119
133 Ga0097621_100001874 3300006237 Bacteria 14404
134 Ga0097621_100039199 3300006237 Unclassified 3804
135 Ga0097621_100088881 3300006237 Bacteria 2582
136 Ga0097621_100110579 3300006237 Bacteria 2321
137 Ga0097621_100659566 3300006237 Viruses 961
138 Ga0068871_100000631 3300006358 Bacteria 24196
139 Ga0068871_100002904 3300006358 Bacteria 11754
140 Ga0068871_100007871 3300006358 Bacteria 7638
141 Ga0068871_100082449 3300006358 Unclassified 2667
142 Ga0068871_100174060 3300006358 Bacteria 1846
143 Ga0075434_100020198 3300006871 Bacteria 6455
144 Ga0075436_100051572 3300006914 Bacteria 2839
145 Ga0097620_100088190 3300006931 Bacteria 3151
146 Ga0097620_101306022 3300006931 Unclassified 800
147 Ga0075435_100006321 3300007076 Bacteria 8365
148 Ga0075435_100007170 3300007076 Bacteria 7928
149 Ga0105240_10010206 3300009093 Bacteria 13218
150 Ga0105240_10023316 3300009093 Bacteria 8190
151 Ga0105240_10058500 3300009093 Bacteria 4812
152 Ga0105240_10066646 3300009093 Bacteria 4465
153 Ga0105240_10205541 3300009093 Unclassified 2305
154 Ga0105240_10238327 3300009093 Unclassified 2110
155 Ga0105240_10408241 3300009093 Bacteria 1528
156 Ga0105240_11212094 3300009093 Viruses 799
157 Ga0105245_10420599 3300009098 Unclassified 1339
158 Ga0105247_10014752 3300009101 Bacteria 4683
159 Ga0105247_10546465 3300009101 Bacteria 851
160 Ga0105243_10116380 3300009148 Bacteria 2246
161 Ga0105241_10013966 3300009174 Bacteria 5888
162 Ga0105241_10089145 3300009174 Bacteria 2430
163 Ga0105241_10374809 3300009174 Bacteria 1242
164 Ga0105241_10629868 3300009174 Unclassified 972
165 Ga0105242_10018766 3300009176 Bacteria 5411
166 Ga0105242_10030211 3300009176 Bacteria 4326
167 Ga0105248_10023339 3300009177 Bacteria 6871
168 Ga0105248_10066683 3300009177 Bacteria 4041
169 Ga0105248_10226068 3300009177 Bacteria 2106
170 Ga0105237_10070129 3300009545 Bacteria 3500
171 Ga0105237_10101749 3300009545 Bacteria 2865
172 Ga0105237_10178207 3300009545 Unclassified 2126
173 Ga0105237_10211255 3300009545 Bacteria 1941
174 Ga0105237_10425480 3300009545 Bacteria 1333
175 Ga0105238_10000533 3300009551 Bacteria 39822
176 Ga0105238_10097988 3300009551 Bacteria 2916
177 Ga0105238_10138665 3300009551 Bacteria 2409
178 Ga0105249_10085967 3300009553 Bacteria 2932
179 Ga0105239_10079927 3300010375 Unclassified 3598
180 Ga0105239_10118133 3300010375 Bacteria 2943
181 Ga0105239_10730495 3300010375 Bacteria 1133
182 Ga0157373_10006723 3300013100 Bacteria 8562
183 Ga0157373_10066764 3300013100 Unclassified 2544
184 Ga0157373_10136311 3300013100 Bacteria 1726
185 Ga0157373_10253209 3300013100 Bacteria 1246
186 Ga0157373_10736802 3300013100 Unclassified 724
187 Ga0157371_10071108 3300013102 Bacteria 2463
188 Ga0157371_10128189 3300013102 Unclassified 1805
189 Ga0157370_10013252 3300013104 Bacteria 8496
190 Ga0157369_10000170 3300013105 Bacteria 91583
191 Ga0157369_10009295 3300013105 Bacteria 11244
192 Ga0157369_10047705 3300013105 Bacteria 4649
193 Ga0157369_10125546 3300013105 Bacteria 2721
194 Ga0157369_10958896 3300013105 Bacteria 876
195 Ga0157374_10000352 3300013296 Bacteria 42585
196 Ga0157374_10001028 3300013296 Bacteria 24226
197 Ga0157374_10006490 3300013296 Bacteria 9930
198 Ga0157374_10042285 3300013296 Bacteria 4203
199 Ga0157374_11165095 3300013296 Unclassified 792
200 Ga0157378_10000085 3300013297 Bacteria 87651
201 Ga0157378_10000182 3300013297 Bacteria 60024
202 Ga0157378_10183204 3300013297 Unclassified 1971
203 Ga0163162_10024101 3300013306 Bacteria 6005
204 Ga0157372_10001051 3300013307 Bacteria 30170
205 Ga0157372_10005503 3300013307 Bacteria 13460
206 Ga0157372_10005586 3300013307 Bacteria 13369
207 Ga0157372_10014530 3300013307 Bacteria 8425
208 Ga0157372_10017422 3300013307 Bacteria 7709
209 Ga0157372_10020109 3300013307 Bacteria 7199
210 Ga0157372_10031370 3300013307 Bacteria 5819
211 Ga0157372_10965527 3300013307 Unclassified 988
212 Ga0157375_10145222 3300013308 Bacteria 2503
213 Ga0157375_11475686 3300013308 Bacteria 802
214 Ga0163163_10127136 3300014325 Unclassified 2587
215 Ga0157379_10075373 3300014968 Bacteria 3020
216 Ga0157379_10089365 3300014968 Unclassified 2763
217 Ga0157376_10019292 3300014969 Bacteria 5251
218 Ga0228598_1005923 3300024227 Bacteria 2541
219 Ga0207656_10015758 3300025321 Bacteria 2931
220 Ga0207656_10210091 3300025321 Unclassified 943
221 Ga0207692_10032494 3300025898 Unclassified 2509
222 Ga0207642_10180871 3300025899 Unclassified 1149
223 Ga0207685_10147770 3300025905 Unclassified 1060
224 Ga0207699_10069149 3300025906 Bacteria 2152
225 Ga0207699_10125448 3300025906 Unclassified 1666
226 Ga0207645_10049536 3300025907 Bacteria 2682
227 Ga0207684_10004181 3300025910 Bacteria 13709
228 Ga0207684_10424633 3300025910 Bacteria 1142
229 Ga0207684_10549098 3300025910 Unclassified 988
230 Ga0207654_10098248 3300025911 Bacteria 1799
231 Ga0207654_10380696 3300025911 Unclassified 977
232 Ga0207707_10002932 3300025912 Bacteria 15197
233 Ga0207707_10064011 3300025912 Unclassified 3200
234 Ga0207707_10147420 3300025912 Bacteria 2057
235 Ga0207707_10253462 3300025912 Bacteria 1528
236 Ga0207695_10011271 3300025913 Bacteria 10839
237 Ga0207695_10088796 3300025913 Unclassified 3110
238 Ga0207695_10123362 3300025913 Bacteria 2556
239 Ga0207695_10256665 3300025913 Unclassified 1647
240 Ga0207695_10319741 3300025913 Bacteria 1442
241 Ga0207695_10595493 3300025913 Unclassified 987
242 Ga0207671_10022252 3300025914 Bacteria 4795
243 Ga0207671_10220878 3300025914 Unclassified 1484
244 Ga0207693_10003665 3300025915 Bacteria 13111
245 Ga0207693_10038976 3300025915 Bacteria 3741
246 Ga0207693_10055944 3300025915 Bacteria 3093
247 Ga0207663_10011038 3300025916 Bacteria 4833
248 Ga0207663_10011954 3300025916 Bacteria 4677
249 Ga0207663_10026693 3300025916 Bacteria 3356
250 Ga0207663_10061672 3300025916 Unclassified 2380
251 Ga0207663_10132056 3300025916 Unclassified 1727
252 Ga0207660_10346216 3300025917 Bacteria 1190
253 Ga0207662_10081934 3300025918 Unclassified 1970
254 Ga0207657_10002163 3300025919 Bacteria 21293
255 Ga0207657_10125863 3300025919 Unclassified 2105
256 Ga0207649_10021970 3300025920 Bacteria 3682
257 Ga0207649_10563943 3300025920 Unclassified 872
258 Ga0207652_10068961 3300025921 Bacteria 3069
259 Ga0207652_10089641 3300025921 Unclassified 2701
260 Ga0207652_10165307 3300025921 Unclassified 1984
261 Ga0207646_11018722 3300025922 Bacteria 731
262 Ga0207681_10776904 3300025923 Unclassified 799
263 Ga0207694_10003097 3300025924 Bacteria 13305
264 Ga0207694_10029858 3300025924 Bacteria 4162
265 Ga0207694_10070066 3300025924 Bacteria 2739
266 Ga0207650_10247538 3300025925 Unclassified 1442
267 Ga0207687_10025102 3300025927 Bacteria 3988
268 Ga0207700_10008033 3300025928 Bacteria 6506
269 Ga0207700_10011105 3300025928 Bacteria 5728
270 Ga0207700_10035317 3300025928 Bacteria 3599
271 Ga0207700_10193924 3300025928 Bacteria 1708
272 Ga0207700_10597637 3300025928 Bacteria 982
273 Ga0207664_10017387 3300025929 Bacteria 5270
274 Ga0207664_10066305 3300025929 Bacteria 2893
275 Ga0207664_10548513 3300025929 Bacteria 1037
276 Ga0207664_10750027 3300025929 Bacteria 878
277 Ga0207644_10405886 3300025931 Unclassified 1114
278 Ga0207644_10930283 3300025931 Unclassified 729
279 Ga0207706_10001837 3300025933 Bacteria 20820
280 Ga0207709_10372642 3300025935 Unclassified 1084
281 Ga0207704_10055391 3300025938 Bacteria 2423
282 Ga0207704_10347215 3300025938 Unclassified 1154
283 Ga0207665_10034308 3300025939 Bacteria 3367
284 Ga0207665_10046004 3300025939 Bacteria 2923
285 Ga0207665_10165616 3300025939 Unclassified 1593
286 Ga0207665_10193377 3300025939 Bacteria 1479
287 Ga0207711_10022596 3300025941 Bacteria 5262
288 Ga0207689_10034032 3300025942 Bacteria 4232
289 Ga0207689_10092616 3300025942 Bacteria 2483
290 Ga0207661_10018128 3300025944 Bacteria 5229
291 Ga0207661_10036870 3300025944 Unclassified 3820
292 Ga0207661_10053473 3300025944 Unclassified 3231
293 Ga0207661_10265052 3300025944 Unclassified 1531
294 Ga0207679_10192043 3300025945 Unclassified 1699
295 Ga0207667_10001390 3300025949 Bacteria 30343
296 Ga0207667_10003723 3300025949 Bacteria 18800
297 Ga0207667_10038608 3300025949 Bacteria 5097
298 Ga0207667_10047679 3300025949 Unclassified 4534
299 Ga0207667_10446536 3300025949 Unclassified 1315
300 Ga0207712_10035208 3300025961 Bacteria 3399
301 Ga0207640_10008227 3300025981 Bacteria 5782
302 Ga0207640_10058947 3300025981 Bacteria 2531
303 Ga0207640_10086201 3300025981 Bacteria 2161
304 Ga0207658_10018767 3300025986 Bacteria 4781
305 Ga0207658_10356979 3300025986 Bacteria 1274
306 Ga0207658_10730893 3300025986 Unclassified 896
307 Ga0207677_10006797 3300026023 Bacteria 6279
308 Ga0207677_10045366 3300026023 Bacteria 2935
309 Ga0207677_10149549 3300026023 Unclassified 1799
310 Ga0207703_10027312 3300026035 Bacteria 4495
311 Ga0207703_10082929 3300026035 Bacteria 2677
312 Ga0207703_10123112 3300026035 Bacteria 2229
313 Ga0207703_10243737 3300026035 Unclassified 1617
314 Ga0207703_10815709 3300026035 Unclassified 891
315 Ga0207639_10032367 3300026041 Bacteria 3849
316 Ga0207639_10226464 3300026041 Bacteria 1618
317 Ga0207678_10000256 3300026067 Bacteria 48140
318 Ga0207702_10000089 3300026078 Bacteria 105440
319 Ga0207702_10006262 3300026078 Bacteria 10283
320 Ga0207702_10048491 3300026078 Bacteria 3582
321 Ga0207702_10367074 3300026078 Unclassified 1381
322 Ga0207641_10016566 3300026088 Bacteria 6035
323 Ga0207641_10049137 3300026088 Bacteria 3563
324 Ga0207641_10184693 3300026088 Unclassified 1912
325 Ga0207648_10031512 3300026089 Bacteria 4688
326 Ga0207648_10332089 3300026089 Bacteria 1368
327 Ga0207676_10003334 3300026095 Bacteria 11384
328 Ga0207674_10000309 3300026116 Bacteria 62067
329 Ga0207674_10450895 3300026116 Bacteria 1243
330 Ga0207674_10476828 3300026116 Bacteria 1206
331 Ga0207683_10041370 3300026121 Bacteria 4025
332 Ga0207698_10017844 3300026142 Bacteria 4823
333 Ga0207698_10021665 3300026142 Bacteria 4450
334 Ga0207698_10270266 3300026142 Bacteria 1567
335 Ga0207698_10887199 3300026142 Viruses 898
336 Ga0268266_10066528 3300028379 Unclassified 3117
337 Ga0268265_10955507 3300028380 Unclassified 844
338 Ga0268264_10197925 3300028381 Bacteria 1836
339 Ga0268264_10254839 3300028381 Unclassified 1632
340 Ga0268264_10803018 3300028381 Unclassified 940
341 Ga0265760_10002875 3300031090 Bacteria 5029
342 Ga0265330_10012545 3300031235 Bacteria 3964
343 Ga0265328_10066819 3300031239 Bacteria 1321
344 Ga0265316_10196192 3300031344 Unclassified 1498
345 Ga0265314_10014641 3300031711 Bacteria 6260
346 Ga0265314_10017493 3300031711 Bacteria 5626
347 Ga0265314_10132701 3300031711 Bacteria 1551
348 Ga0373926_0029220 3300035083 Bacteria 1937
349 Ga0373944_0169013 3300035089 Unclassified 779
350 Ga0373941_0277418 3300035115 Unclassified 662
351 Ga0373945_0192717 3300035116 Unclassified 843
352 Ga0373943_0045013 3300035170 Bacteria 2149
353 Ga0373931_0010200 3300035691 Bacteria 4512
354 Ga0373931_0095123 3300035691 Unclassified 1666
355 Ga0373931_0277116 3300035691 Unclassified 1028
356 Ga0373935_0045851 3300035692 Bacteria 2759
357 Ga0373927_0081922 3300035695 Unclassified 2092
358 Ga0373937_0009770 3300036401 Bacteria 8365
359 Ga0373937_0014186 3300036401 Bacteria 7030
360 Ga0373925_0002703 3300037068 Bacteria 14059
361 Ga0373925_0046622 3300037068 Bacteria 3223
362 Ga0436364_1331761 3300037853 Bacteria 6127
363 Ga0395901_0786251 3300038443 Bacteria 942
364 Ga0436365_0395198 3300039437 Bacteria 2343
365 Ga0436365_1362553 3300039437 Unclassified 1005
366 Ga0436363_1705636 3300039450 Unclassified 1436
367 Ga0466967_0001644 3300045976 Bacteria 13213
368 Ga0466967_0021835 3300045976 Bacteria 5208
369 Ga0466967_0324295 3300045976 Bacteria 1486
370 Ga0495590_0105555 3300046457 Bacteria 1003
371 Ga0495580_0001003 3300046472 Bacteria 24839
372 Ga0495580_0002633 3300046472 Bacteria 15592
373 Ga0495580_0012101 3300046472 Bacteria 6641
374 Ga0495580_0013609 3300046472 Bacteria 6204
375 Ga0495580_0018734 3300046472 Bacteria 5151
376 Ga0495580_0441052 3300046472 Bacteria 874
377 Ga0495582_0013841 3300046473 Bacteria 4443
378 Ga0495594_0118409 3300046499 Bacteria 1496
379 Ga0495608_0571307 3300046511 Unclassified 680
380 Ga0495630_0120000 3300046517 Bacteria 1995
381 Ga0495666_0067185 3300046526 Bacteria 1708
382 Ga0495665_0009182 3300046531 Bacteria 5358
383 Ga0495640_0261332 3300046533 Bacteria 1082
384 Ga0495667_0224008 3300046559 Bacteria 1200
385 Ga0495623_0210890 3300046679 Unclassified 1112
386 Ga0495624_0145735 3300046690 Unclassified 1449
387 Ga0495581_0064443 3300047315 Unclassified 2117
388 Ga0495676_0484840 3300047321 Unclassified 813
389 Ga0495675_0044623 3300047444 Bacteria 2824
390 Ga0495602_0047027 3300048088 Viruses 3892
391 Ga0495602_0132013 3300048088 Unclassified 1990
392 Ga0496101_0005675 3300048904 Bacteria 7964
393 Ga0496102_0081303 3300048905 Bacteria 2987
394 Ga0496102_0273674 3300048905 Unclassified 1592
395 Ga0496104_0073331 3300048907 Bacteria 3257
396 Ga0496105_0147731 3300048908 Unclassified 1933
397 Ga0496106_0146419 3300048909 Unclassified 1861
398 Ga0496108_0269784 3300048911 Unclassified 1481
399 Ga0496109_0448281 3300048912 Bacteria 1219
400 Ga0496112_0000372 3300048915 Bacteria 29345
401 Ga0496112_0005248 3300048915 Bacteria 11156
402 Ga0496112_0058047 3300048915 Bacteria 3811
403 Ga0496112_0220695 3300048915 Bacteria 1852
404 Ga0496112_0239563 3300048915 Bacteria 1767
405 Ga0496112_0586064 3300048915 Unclassified 1048
406 Ga0496113_0389653 3300048916 Unclassified 1118
407 Ga0496114_0043358 3300048917 Unclassified 3730
408 Ga0496115_0107098 3300048918 Unclassified 2295
409 Ga0501083_0086739 3300049744 Bacteria 2070
410 nmdc:mga0n895_18182_c1 3300050512 Bacteria 6498
411 nmdc:mga0rr50_4474_c1 3300050513 Bacteria 8231
412 nmdc:mga0rr50_671051_c1 3300050513 Bacteria 884
413 nmdc:mga0rr50_8107_c1 3300050513 Bacteria 6520
414 nmdc:mga08x19_31687_c1 3300050514 Bacteria 3328

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006028 Ga0070717_10252281 Ga0070717_102522812 194
2 3300037853 Ga0436364_1331761 Ga0436364_1331761_733_1326 196
3 3300039450 Ga0436363_1705636 Ga0436363_1705636_791_1384 196
4 3300005330 Ga0070690_100164807 Ga0070690_1001648072 199
5 3300005338 Ga0068868_100019681 Ga0068868_1000196812 199
6 3300005547 Ga0070693_100061490 Ga0070693_1000614902 199
7 3300005578 Ga0068854_100097318 Ga0068854_1000973182 199
8 3300005842 Ga0068858_100193781 Ga0068858_1001937813 199
9 3300005843 Ga0068860_100319279 Ga0068860_1003192792 199
10 3300006028 Ga0070717_10053603 Ga0070717_100536033 199
11 3300006237 Ga0097621_100001874 Ga0097621_10000187410 199
12 3300006358 Ga0068871_100007871 Ga0068871_1000078713 199
13 3300025931 Ga0207644_10930283 Ga0207644_109302832 199
14 3300025981 Ga0207640_10086201 Ga0207640_100862012 199
15 3300025986 Ga0207658_10356979 Ga0207658_103569792 199
16 3300026023 Ga0207677_10045366 Ga0207677_100453663 199
17 3300026035 Ga0207703_10123112 Ga0207703_101231122 199
18 3300005435 Ga0070714_100003563 Ga0070714_1000035638 200
19 3300005436 Ga0070713_100007696 Ga0070713_1000076968 200
20 3300025928 Ga0207700_10035317 Ga0207700_100353174 200
21 3300025929 Ga0207664_10017387 Ga0207664_100173872 200
22 3300031235 Ga0265330_10012545 Ga0265330_100125455 200
23 3300031239 Ga0265328_10066819 Ga0265328_100668192 200
24 3300005434 Ga0070709_10074967 Ga0070709_100749671 201
25 3300005436 Ga0070713_100127956 Ga0070713_1001279563 201
26 3300005436 Ga0070713_100482888 Ga0070713_1004828882 201
27 3300005436 Ga0070713_100834304 Ga0070713_1008343041 201
28 3300005458 Ga0070681_10583645 Ga0070681_105836452 201
29 3300005518 Ga0070699_101052843 Ga0070699_1010528431 201
30 3300005530 Ga0070679_100178411 Ga0070679_1001784112 201
31 3300005578 Ga0068854_100805616 Ga0068854_1008056161 201
32 3300005614 Ga0068856_100162553 Ga0068856_1001625532 201
33 3300005841 Ga0068863_100072372 Ga0068863_1000723721 201
34 3300005842 Ga0068858_100501492 Ga0068858_1005014922 201
35 3300006028 Ga0070717_10007827 Ga0070717_100078277 201
36 3300006173 Ga0070716_100005762 Ga0070716_1000057623 201
37 3300006175 Ga0070712_100056190 Ga0070712_1000561904 201
38 3300006237 Ga0097621_100039199 Ga0097621_1000391993 201
39 3300007076 Ga0075435_100006321 Ga0075435_1000063216 201
40 3300009093 Ga0105240_10205541 Ga0105240_102055413 201
41 3300009174 Ga0105241_10089145 Ga0105241_100891453 201
42 3300009545 Ga0105237_10425480 Ga0105237_104254802 201
43 3300013100 Ga0157373_10006723 Ga0157373_100067233 201
44 3300013105 Ga0157369_10958896 Ga0157369_109588961 201
45 3300025906 Ga0207699_10125448 Ga0207699_101254482 201
46 3300025912 Ga0207707_10253462 Ga0207707_102534622 201
47 3300025913 Ga0207695_10088796 Ga0207695_100887964 201
48 3300025914 Ga0207671_10220878 Ga0207671_102208781 201
49 3300025915 Ga0207693_10055944 Ga0207693_100559442 201
50 3300025916 Ga0207663_10061672 Ga0207663_100616723 201
51 3300025928 Ga0207700_10193924 Ga0207700_101939242 201
52 3300025928 Ga0207700_10597637 Ga0207700_105976372 201
53 3300025939 Ga0207665_10046004 Ga0207665_100460043 201
54 3300025949 Ga0207667_10446536 Ga0207667_104465362 201
55 3300025986 Ga0207658_10730893 Ga0207658_107308932 201
56 3300028381 Ga0268264_10254839 Ga0268264_102548391 201
57 3300035083 Ga0373926_0029220 Ga0373926_0029220_928_1536 201
58 3300035089 Ga0373944_0169013 Ga0373944_0169013_63_671 201
59 3300035115 Ga0373941_0277418 Ga0373941_0277418_12_620 201
60 3300035116 Ga0373945_0192717 Ga0373945_0192717_172_780 201
61 3300035170 Ga0373943_0045013 Ga0373943_0045013_410_1018 201
62 3300035691 Ga0373931_0010200 Ga0373931_0010200_3040_3648 201
63 3300037068 Ga0373925_0002703 Ga0373925_0002703_6653_7261 201
64 3300046457 Ga0495590_0105555 Ga0495590_0105555_305_934 201
65 3300046472 Ga0495580_0002633 Ga0495580_0002633_14486_15094 201
66 3300046473 Ga0495582_0013841 Ga0495582_0013841_166_774 201
67 3300046531 Ga0495665_0009182 Ga0495665_0009182_4688_5296 201
68 3300047315 Ga0495581_0064443 Ga0495581_0064443_338_946 201
69 3300048915 Ga0496112_0239563 Ga0496112_0239563_179_787 201
70 3300050513 nmdc:mga0rr50_4474_c1 nmdc:mga0rr50_4474_c1_6877_7485 201
71 3300005436 Ga0070713_100191099 Ga0070713_1001910993 202
72 3300005437 Ga0070710_10201319 Ga0070710_102013192 202
73 3300005437 Ga0070710_10363090 Ga0070710_103630901 202
74 3300005439 Ga0070711_100026664 Ga0070711_1000266642 202
75 3300005439 Ga0070711_100055222 Ga0070711_1000552222 202
76 3300006028 Ga0070717_10513417 Ga0070717_105134172 202
77 3300006163 Ga0070715_10133585 Ga0070715_101335852 202
78 3300006173 Ga0070716_100102539 Ga0070716_1001025392 202
79 3300006175 Ga0070712_100006146 Ga0070712_1000061465 202
80 3300006175 Ga0070712_100040410 Ga0070712_1000404102 202
81 3300006175 Ga0070712_100184954 Ga0070712_1001849542 202
82 3300006175 Ga0070712_101053116 Ga0070712_1010531161 202
83 3300006237 Ga0097621_100088881 Ga0097621_1000888812 202
84 3300006871 Ga0075434_100020198 Ga0075434_1000201983 202
85 3300006914 Ga0075436_100051572 Ga0075436_1000515724 202
86 3300007076 Ga0075435_100007170 Ga0075435_1000071702 202
87 3300025898 Ga0207692_10032494 Ga0207692_100324942 202
88 3300025905 Ga0207685_10147770 Ga0207685_101477701 202
89 3300025906 Ga0207699_10069149 Ga0207699_100691492 202
90 3300025915 Ga0207693_10003665 Ga0207693_100036658 202
91 3300025915 Ga0207693_10038976 Ga0207693_100389765 202
92 3300025916 Ga0207663_10011038 Ga0207663_100110383 202
93 3300025916 Ga0207663_10011954 Ga0207663_100119544 202
94 3300025916 Ga0207663_10026693 Ga0207663_100266933 202
95 3300025916 Ga0207663_10132056 Ga0207663_101320562 202
96 3300025939 Ga0207665_10193377 Ga0207665_101933772 202
97 3300031344 Ga0265316_10196192 Ga0265316_101961922 202
98 3300036401 Ga0373937_0014186 Ga0373937_0014186_4079_4690 202
99 3300038443 Ga0395901_0786251 Ga0395901_0786251_258_884 202
100 3300039437 Ga0436365_0395198 Ga0436365_0395198_590_1201 202
101 3300045976 Ga0466967_0001644 Ga0466967_0001644_4668_5279 202
102 3300046472 Ga0495580_0001003 Ga0495580_0001003_15707_16318 202
103 3300046472 Ga0495580_0013609 Ga0495580_0013609_1552_2163 202
104 3300046472 Ga0495580_0018734 Ga0495580_0018734_584_1201 202
105 3300046472 Ga0495580_0441052 Ga0495580_0441052_32_643 202
106 3300046499 Ga0495594_0118409 Ga0495594_0118409_130_741 202
107 3300046511 Ga0495608_0571307 Ga0495608_0571307_31_642 202
108 3300046559 Ga0495667_0224008 Ga0495667_0224008_490_1101 202
109 3300046679 Ga0495623_0210890 Ga0495623_0210890_36_647 202
110 3300046690 Ga0495624_0145735 Ga0495624_0145735_682_1299 202
111 3300047444 Ga0495675_0044623 Ga0495675_0044623_1184_1795 202
112 3300048088 Ga0495602_0132013 Ga0495602_0132013_290_901 202
113 3300048907 Ga0496104_0073331 Ga0496104_0073331_482_1096 202
114 3300048915 Ga0496112_0586064 Ga0496112_0586064_331_945 202
115 3300050512 nmdc:mga0n895_18182_c1 nmdc:mga0n895_18182_c1_4927_5541 202
116 3300050513 nmdc:mga0rr50_8107_c1 nmdc:mga0rr50_8107_c1_344_958 202
117 3300050514 nmdc:mga08x19_31687_c1 nmdc:mga08x19_31687_c1_2673_3287 202
118 3300005330 Ga0070690_100060234 Ga0070690_1000602344 203
119 3300005336 Ga0070680_100049786 Ga0070680_1000497863 203
120 3300005337 Ga0070682_100009356 Ga0070682_1000093565 203
121 3300005338 Ga0068868_100006273 Ga0068868_1000062735 203
122 3300005339 Ga0070660_100410616 Ga0070660_1004106162 203
123 3300005341 Ga0070691_10028829 Ga0070691_100288292 203
124 3300005344 Ga0070661_100032454 Ga0070661_1000324542 203
125 3300005347 Ga0070668_100017159 Ga0070668_1000171594 203
126 3300005366 Ga0070659_100039656 Ga0070659_1000396564 203
127 3300005367 Ga0070667_100012552 Ga0070667_1000125527 203
128 3300005435 Ga0070714_100759865 Ga0070714_1007598651 203
129 3300005440 Ga0070705_100099578 Ga0070705_1000995782 203
130 3300005445 Ga0070708_100004518 Ga0070708_1000045184 203
131 3300005457 Ga0070662_100011274 Ga0070662_1000112742 203
132 3300005458 Ga0070681_10831591 Ga0070681_108315911 203
133 3300005467 Ga0070706_100001295 Ga0070706_10000129517 203
134 3300005467 Ga0070706_100199493 Ga0070706_1001994931 203
135 3300005518 Ga0070699_100629184 Ga0070699_1006291842 203
136 3300005530 Ga0070679_100039036 Ga0070679_1000390364 203
137 3300005535 Ga0070684_100012684 Ga0070684_1000126841 203
138 3300005536 Ga0070697_100000581 Ga0070697_1000005813 203
139 3300005539 Ga0068853_100032579 Ga0068853_1000325793 203
140 3300005547 Ga0070693_100157306 Ga0070693_1001573062 203
141 3300005577 Ga0068857_100165417 Ga0068857_1001654172 203
142 3300005614 Ga0068856_100369850 Ga0068856_1003698502 203
143 3300005616 Ga0068852_100194563 Ga0068852_1001945632 203
144 3300005617 Ga0068859_100088193 Ga0068859_1000881931 203
145 3300005618 Ga0068864_100049101 Ga0068864_1000491011 203
146 3300005842 Ga0068858_100028764 Ga0068858_1000287644 203
147 3300005843 Ga0068860_100077719 Ga0068860_1000777194 203
148 3300005844 Ga0068862_100025725 Ga0068862_1000257252 203
149 3300006028 Ga0070717_10014758 Ga0070717_100147585 203
150 3300006173 Ga0070716_100045060 Ga0070716_1000450603 203
151 3300006237 Ga0097621_100110579 Ga0097621_1001105791 203
152 3300006358 Ga0068871_100174060 Ga0068871_1001740603 203
153 3300006931 Ga0097620_100088190 Ga0097620_1000881901 203
154 3300009093 Ga0105240_10023316 Ga0105240_100233166 203
155 3300009093 Ga0105240_10066646 Ga0105240_100666462 203
156 3300009101 Ga0105247_10014752 Ga0105247_100147523 203
157 3300009101 Ga0105247_10546465 Ga0105247_105464651 203
158 3300009148 Ga0105243_10116380 Ga0105243_101163802 203
159 3300009174 Ga0105241_10629868 Ga0105241_106298682 203
160 3300009176 Ga0105242_10018766 Ga0105242_100187666 203
161 3300009176 Ga0105242_10030211 Ga0105242_100302111 203
162 3300009177 Ga0105248_10066683 Ga0105248_100666831 203
163 3300009177 Ga0105248_10226068 Ga0105248_102260682 203
164 3300009545 Ga0105237_10101749 Ga0105237_101017491 203
165 3300009551 Ga0105238_10097988 Ga0105238_100979883 203
166 3300009553 Ga0105249_10085967 Ga0105249_100859671 203
167 3300010375 Ga0105239_10730495 Ga0105239_107304952 203
168 3300013100 Ga0157373_10136311 Ga0157373_101363112 203
169 3300013100 Ga0157373_10736802 Ga0157373_107368021 203
170 3300013102 Ga0157371_10071108 Ga0157371_100711083 203
171 3300013105 Ga0157369_10009295 Ga0157369_100092955 203
172 3300013105 Ga0157369_10047705 Ga0157369_100477055 203
173 3300013296 Ga0157374_10006490 Ga0157374_100064901 203
174 3300013296 Ga0157374_10042285 Ga0157374_100422854 203
175 3300013296 Ga0157374_11165095 Ga0157374_111650951 203
176 3300013297 Ga0157378_10183204 Ga0157378_101832043 203
177 3300013306 Ga0163162_10024101 Ga0163162_100241014 203
178 3300013307 Ga0157372_10005586 Ga0157372_100055862 203
179 3300013307 Ga0157372_10017422 Ga0157372_100174225 203
180 3300013307 Ga0157372_10031370 Ga0157372_100313704 203
181 3300013307 Ga0157372_10965527 Ga0157372_109655272 203
182 3300013308 Ga0157375_10145222 Ga0157375_101452223 203
183 3300013308 Ga0157375_11475686 Ga0157375_114756861 203
184 3300014325 Ga0163163_10127136 Ga0163163_101271362 203
185 3300014968 Ga0157379_10075373 Ga0157379_100753733 203
186 3300014968 Ga0157379_10089365 Ga0157379_100893652 203
187 3300014969 Ga0157376_10019292 Ga0157376_100192921 203
188 3300025321 Ga0207656_10015758 Ga0207656_100157581 203
189 3300025899 Ga0207642_10180871 Ga0207642_101808712 203
190 3300025907 Ga0207645_10049536 Ga0207645_100495362 203
191 3300025910 Ga0207684_10004181 Ga0207684_100041815 203
192 3300025910 Ga0207684_10424633 Ga0207684_104246332 203
193 3300025911 Ga0207654_10098248 Ga0207654_100982482 203
194 3300025911 Ga0207654_10380696 Ga0207654_103806961 203
195 3300025912 Ga0207707_10147420 Ga0207707_101474202 203
196 3300025913 Ga0207695_10256665 Ga0207695_102566652 203
197 3300025913 Ga0207695_10595493 Ga0207695_105954932 203
198 3300025914 Ga0207671_10022252 Ga0207671_100222522 203
199 3300025917 Ga0207660_10346216 Ga0207660_103462162 203
200 3300025918 Ga0207662_10081934 Ga0207662_100819342 203
201 3300025919 Ga0207657_10002163 Ga0207657_100021636 203
202 3300025920 Ga0207649_10021970 Ga0207649_100219704 203
203 3300025921 Ga0207652_10068961 Ga0207652_100689613 203
204 3300025923 Ga0207681_10776904 Ga0207681_107769041 203
205 3300025924 Ga0207694_10029858 Ga0207694_100298584 203
206 3300025927 Ga0207687_10025102 Ga0207687_100251021 203
207 3300025929 Ga0207664_10548513 Ga0207664_105485132 203
208 3300025929 Ga0207664_10750027 Ga0207664_107500272 203
209 3300025933 Ga0207706_10001837 Ga0207706_100018376 203
210 3300025935 Ga0207709_10372642 Ga0207709_103726422 203
211 3300025938 Ga0207704_10055391 Ga0207704_100553912 203
212 3300025938 Ga0207704_10347215 Ga0207704_103472152 203
213 3300025939 Ga0207665_10034308 Ga0207665_100343083 203
214 3300025942 Ga0207689_10092616 Ga0207689_100926163 203
215 3300025944 Ga0207661_10018128 Ga0207661_100181282 203
216 3300025949 Ga0207667_10038608 Ga0207667_100386083 203
217 3300025961 Ga0207712_10035208 Ga0207712_100352084 203
218 3300025981 Ga0207640_10058947 Ga0207640_100589472 203
219 3300025986 Ga0207658_10018767 Ga0207658_100187672 203
220 3300026035 Ga0207703_10815709 Ga0207703_108157092 203
221 3300026041 Ga0207639_10032367 Ga0207639_100323672 203
222 3300026067 Ga0207678_10000256 Ga0207678_1000025627 203
223 3300026078 Ga0207702_10367074 Ga0207702_103670742 203
224 3300026088 Ga0207641_10049137 Ga0207641_100491372 203
225 3300026089 Ga0207648_10332089 Ga0207648_103320892 203
226 3300026116 Ga0207674_10450895 Ga0207674_104508952 203
227 3300026116 Ga0207674_10476828 Ga0207674_104768281 203
228 3300026121 Ga0207683_10041370 Ga0207683_100413705 203
229 3300026142 Ga0207698_10021665 Ga0207698_100216654 203
230 3300028379 Ga0268266_10066528 Ga0268266_100665283 203
231 3300028380 Ga0268265_10955507 Ga0268265_109555071 203
232 3300035695 Ga0373927_0081922 Ga0373927_0081922_1037_1651 203
233 3300036401 Ga0373937_0009770 Ga0373937_0009770_6887_7504 203
234 3300046533 Ga0495640_0261332 Ga0495640_0261332_171_785 203
235 3300047321 Ga0495676_0484840 Ga0495676_0484840_38_652 203
236 3300048088 Ga0495602_0047027 Ga0495602_0047027_1316_1933 203
237 3300048904 Ga0496101_0005675 Ga0496101_0005675_3802_4416 203
238 3300048905 Ga0496102_0273674 Ga0496102_0273674_821_1435 203
239 3300048908 Ga0496105_0147731 Ga0496105_0147731_591_1205 203
240 3300048911 Ga0496108_0269784 Ga0496108_0269784_513_1127 203
241 3300048912 Ga0496109_0448281 Ga0496109_0448281_567_1181 203
242 3300048915 Ga0496112_0058047 Ga0496112_0058047_2459_3073 203
243 3300048916 Ga0496113_0389653 Ga0496113_0389653_437_1054 203
244 3300048917 Ga0496114_0043358 Ga0496114_0043358_690_1304 203
245 3300048918 Ga0496115_0107098 Ga0496115_0107098_1549_2163 203
246 3300005467 Ga0070706_100675366 Ga0070706_1006753662 204
247 3300006028 Ga0070717_10001449 Ga0070717_1000144914 204
248 3300006173 Ga0070716_100134472 Ga0070716_1001344722 204
249 3300025910 Ga0207684_10549098 Ga0207684_105490982 204
250 3300025939 Ga0207665_10165616 Ga0207665_101656162 204
251 3300031090 Ga0265760_10002875 Ga0265760_100028754 204
252 3300039437 Ga0436365_1362553 Ga0436365_1362553_194_811 204
253 3300049744 Ga0501083_0086739 Ga0501083_0086739_507_1124 204
254 3300050513 nmdc:mga0rr50_671051_c1 nmdc:mga0rr50_671051_c1_181_798 204
255 3300005467 Ga0070706_100188452 Ga0070706_1001884521 208
256 3300005468 Ga0070707_100188551 Ga0070707_1001885512 208
257 3300005468 Ga0070707_100803492 Ga0070707_1008034921 208
258 3300005468 Ga0070707_101155907 Ga0070707_1011559071 208
259 3300005518 Ga0070699_100799776 Ga0070699_1007997762 208
260 3300005536 Ga0070697_100072130 Ga0070697_1000721304 208
261 3300005536 Ga0070697_100493206 Ga0070697_1004932061 208
262 3300006028 Ga0070717_10013246 Ga0070717_100132464 208
263 3300024227 Ga0228598_1005923 Ga0228598_10059232 208
264 3300025922 Ga0207646_11018722 Ga0207646_110187222 208
265 3300025928 Ga0207700_10011105 Ga0207700_100111056 208
266 3300031711 Ga0265314_10014641 Ga0265314_100146416 208
267 3300031711 Ga0265314_10017493 Ga0265314_100174933 208
268 3300031711 Ga0265314_10132701 Ga0265314_101327012 208
269 3300046472 Ga0495580_0012101 Ga0495580_0012101_4205_4834 208
270 3300035692 Ga0373935_0045851 Ga0373935_0045851_1933_2607 209
271 3300037068 Ga0373925_0046622 Ga0373925_0046622_1949_2623 209
272 3300046517 Ga0495630_0120000 Ga0495630_0120000_782_1456 209
273 3300046526 Ga0495666_0067185 Ga0495666_0067185_333_1007 209
274 3300005337 Ga0070682_100444487 Ga0070682_1004444871 210
275 3300045976 Ga0466967_0021835 Ga0466967_0021835_1407_2090 211
276 3300005328 Ga0070676_10217886 Ga0070676_102178862 213
277 3300005329 Ga0070683_100090199 Ga0070683_1000901992 213
278 3300005331 Ga0070670_100926554 Ga0070670_1009265542 213
279 3300005334 Ga0068869_100024706 Ga0068869_1000247062 213
280 3300005338 Ga0068868_100046095 Ga0068868_1000460952 213
281 3300005338 Ga0068868_100558227 Ga0068868_1005582271 213
282 3300005339 Ga0070660_100131506 Ga0070660_1001315063 213
283 3300005353 Ga0070669_100458841 Ga0070669_1004588412 213
284 3300005355 Ga0070671_100370810 Ga0070671_1003708102 213
285 3300005364 Ga0070673_100177264 Ga0070673_1001772642 213
286 3300005436 Ga0070713_100092804 Ga0070713_1000928042 213
287 3300005436 Ga0070713_100524249 Ga0070713_1005242492 213
288 3300005440 Ga0070705_100326973 Ga0070705_1003269732 213
289 3300005456 Ga0070678_100129987 Ga0070678_1001299871 213
290 3300005457 Ga0070662_100136079 Ga0070662_1001360792 213
291 3300005458 Ga0070681_10000055 Ga0070681_1000005544 213
292 3300005458 Ga0070681_10058614 Ga0070681_100586145 213
293 3300005459 Ga0068867_100192008 Ga0068867_1001920081 213
294 3300005530 Ga0070679_100011374 Ga0070679_1000113742 213
295 3300005530 Ga0070679_100418365 Ga0070679_1004183652 213
296 3300005539 Ga0068853_100106349 Ga0068853_1001063493 213
297 3300005544 Ga0070686_100306755 Ga0070686_1003067552 213
298 3300005547 Ga0070693_100158189 Ga0070693_1001581892 213
299 3300005563 Ga0068855_100004676 Ga0068855_10000467610 213
300 3300005563 Ga0068855_100005055 Ga0068855_10000505511 213
301 3300005563 Ga0068855_100110386 Ga0068855_1001103865 213
302 3300005563 Ga0068855_100151683 Ga0068855_1001516832 213
303 3300005564 Ga0070664_100012358 Ga0070664_1000123587 213
304 3300005564 Ga0070664_100639929 Ga0070664_1006399291 213
305 3300005577 Ga0068857_100000041 Ga0068857_10000004110 213
306 3300005577 Ga0068857_100001831 Ga0068857_10000183112 213
307 3300005577 Ga0068857_100650956 Ga0068857_1006509562 213
308 3300005578 Ga0068854_100157585 Ga0068854_1001575852 213
309 3300005614 Ga0068856_100002231 Ga0068856_1000022318 213
310 3300005614 Ga0068856_100003398 Ga0068856_1000033986 213
311 3300005614 Ga0068856_100009069 Ga0068856_10000906910 213
312 3300005614 Ga0068856_100022418 Ga0068856_1000224186 213
313 3300005616 Ga0068852_100095928 Ga0068852_1000959283 213
314 3300005616 Ga0068852_100363014 Ga0068852_1003630142 213
315 3300005617 Ga0068859_101306036 Ga0068859_1013060361 213
316 3300005618 Ga0068864_100009181 Ga0068864_1000091814 213
317 3300005834 Ga0068851_10288750 Ga0068851_102887502 213
318 3300005841 Ga0068863_100093985 Ga0068863_1000939855 213
319 3300005841 Ga0068863_100124378 Ga0068863_1001243783 213
320 3300005842 Ga0068858_100005503 Ga0068858_1000055032 213
321 3300005842 Ga0068858_100087467 Ga0068858_1000874673 213
322 3300005842 Ga0068858_100451632 Ga0068858_1004516321 213
323 3300005843 Ga0068860_100235027 Ga0068860_1002350273 213
324 3300006028 Ga0070717_10042350 Ga0070717_100423503 213
325 3300006237 Ga0097621_100000990 Ga0097621_1000009908 213
326 3300006237 Ga0097621_100001471 Ga0097621_1000014716 213
327 3300006237 Ga0097621_100659566 Ga0097621_1006595661 213
328 3300006358 Ga0068871_100000631 Ga0068871_10000063112 213
329 3300006358 Ga0068871_100002904 Ga0068871_1000029046 213
330 3300006358 Ga0068871_100082449 Ga0068871_1000824495 213
331 3300006931 Ga0097620_101306022 Ga0097620_1013060221 213
332 3300009093 Ga0105240_10010206 Ga0105240_100102068 213
333 3300009093 Ga0105240_10058500 Ga0105240_100585004 213
334 3300009093 Ga0105240_10238327 Ga0105240_102383272 213
335 3300009093 Ga0105240_10408241 Ga0105240_104082411 213
336 3300009093 Ga0105240_11212094 Ga0105240_112120941 213
337 3300009098 Ga0105245_10420599 Ga0105245_104205991 213
338 3300009174 Ga0105241_10013966 Ga0105241_100139662 213
339 3300009174 Ga0105241_10374809 Ga0105241_103748092 213
340 3300009177 Ga0105248_10023339 Ga0105248_100233394 213
341 3300009545 Ga0105237_10070129 Ga0105237_100701293 213
342 3300009545 Ga0105237_10178207 Ga0105237_101782073 213
343 3300009545 Ga0105237_10211255 Ga0105237_102112552 213
344 3300009551 Ga0105238_10000533 Ga0105238_1000053330 213
345 3300009551 Ga0105238_10138665 Ga0105238_101386653 213
346 3300010375 Ga0105239_10079927 Ga0105239_100799273 213
347 3300010375 Ga0105239_10118133 Ga0105239_101181331 213
348 3300013100 Ga0157373_10066764 Ga0157373_100667643 213
349 3300013100 Ga0157373_10253209 Ga0157373_102532092 213
350 3300013102 Ga0157371_10128189 Ga0157371_101281893 213
351 3300013104 Ga0157370_10013252 Ga0157370_100132528 213
352 3300013105 Ga0157369_10000170 Ga0157369_1000017055 213
353 3300013105 Ga0157369_10125546 Ga0157369_101255462 213
354 3300013296 Ga0157374_10000352 Ga0157374_1000035220 213
355 3300013296 Ga0157374_10001028 Ga0157374_1000102817 213
356 3300013297 Ga0157378_10000085 Ga0157378_1000008529 213
357 3300013297 Ga0157378_10000182 Ga0157378_1000018235 213
358 3300013307 Ga0157372_10001051 Ga0157372_1000105117 213
359 3300013307 Ga0157372_10005503 Ga0157372_100055039 213
360 3300013307 Ga0157372_10014530 Ga0157372_100145304 213
361 3300013307 Ga0157372_10020109 Ga0157372_100201096 213
362 3300025321 Ga0207656_10210091 Ga0207656_102100912 213
363 3300025912 Ga0207707_10002932 Ga0207707_100029321 213
364 3300025912 Ga0207707_10064011 Ga0207707_100640114 213
365 3300025913 Ga0207695_10011271 Ga0207695_100112715 213
366 3300025913 Ga0207695_10123362 Ga0207695_101233622 213
367 3300025913 Ga0207695_10319741 Ga0207695_103197411 213
368 3300025919 Ga0207657_10125863 Ga0207657_101258633 213
369 3300025920 Ga0207649_10563943 Ga0207649_105639432 213
370 3300025921 Ga0207652_10089641 Ga0207652_100896414 213
371 3300025921 Ga0207652_10165307 Ga0207652_101653072 213
372 3300025924 Ga0207694_10003097 Ga0207694_100030978 213
373 3300025924 Ga0207694_10070066 Ga0207694_100700664 213
374 3300025925 Ga0207650_10247538 Ga0207650_102475382 213
375 3300025928 Ga0207700_10008033 Ga0207700_100080332 213
376 3300025929 Ga0207664_10066305 Ga0207664_100663054 213
377 3300025931 Ga0207644_10405886 Ga0207644_104058862 213
378 3300025941 Ga0207711_10022596 Ga0207711_100225964 213
379 3300025942 Ga0207689_10034032 Ga0207689_100340324 213
380 3300025944 Ga0207661_10036870 Ga0207661_100368703 213
381 3300025944 Ga0207661_10053473 Ga0207661_100534733 213
382 3300025944 Ga0207661_10265052 Ga0207661_102650522 213
383 3300025945 Ga0207679_10192043 Ga0207679_101920433 213
384 3300025949 Ga0207667_10001390 Ga0207667_1000139020 213
385 3300025949 Ga0207667_10003723 Ga0207667_1000372310 213
386 3300025949 Ga0207667_10047679 Ga0207667_100476793 213
387 3300025981 Ga0207640_10008227 Ga0207640_100082274 213
388 3300026023 Ga0207677_10006797 Ga0207677_100067974 213
389 3300026023 Ga0207677_10149549 Ga0207677_101495493 213
390 3300026035 Ga0207703_10027312 Ga0207703_100273121 213
391 3300026035 Ga0207703_10082929 Ga0207703_100829293 213
392 3300026035 Ga0207703_10243737 Ga0207703_102437372 213
393 3300026041 Ga0207639_10226464 Ga0207639_102264643 213
394 3300026078 Ga0207702_10000089 Ga0207702_1000008953 213
395 3300026078 Ga0207702_10006262 Ga0207702_100062622 213
396 3300026078 Ga0207702_10048491 Ga0207702_100484914 213
397 3300026088 Ga0207641_10016566 Ga0207641_100165666 213
398 3300026088 Ga0207641_10184693 Ga0207641_101846933 213
399 3300026089 Ga0207648_10031512 Ga0207648_100315124 213
400 3300026095 Ga0207676_10003334 Ga0207676_100033346 213
401 3300026116 Ga0207674_10000309 Ga0207674_1000030951 213
402 3300026142 Ga0207698_10017844 Ga0207698_100178445 213
403 3300026142 Ga0207698_10270266 Ga0207698_102702662 213
404 3300026142 Ga0207698_10887199 Ga0207698_108871991 213
405 3300028381 Ga0268264_10197925 Ga0268264_101979252 213
406 3300028381 Ga0268264_10803018 Ga0268264_108030181 213
407 3300035691 Ga0373931_0095123 Ga0373931_0095123_893_1534 213
408 3300035691 Ga0373931_0277116 Ga0373931_0277116_165_812 213
409 3300045976 Ga0466967_0324295 Ga0466967_0324295_785_1432 213
410 3300048905 Ga0496102_0081303 Ga0496102_0081303_1383_2030 213
411 3300048909 Ga0496106_0146419 Ga0496106_0146419_518_1165 213
412 3300048915 Ga0496112_0000372 Ga0496112_0000372_26506_27153 213
413 3300048915 Ga0496112_0005248 Ga0496112_0005248_7366_8007 213
414 3300048915 Ga0496112_0220695 Ga0496112_0220695_789_1436 213

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02698

DUF218

DUF218 domain

87

233

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6i8a-assembly1.cif.gz_A the crystal structure of the pol2 catalytic domain of dna polymerase epsilon carrying a p301r substitution. 0.6577 129 157
7sg3-assembly2.cif.gz_B the x-ray crystal structure of the staphylococcus aureus fatty acid kinase b1 mutant a121i-a158l to 2.35 angstrom resolution (open form chain a, palmitate bound) 0.6318 137 182
7r81-assembly1.cif.gz_P2 structure of the translating neurospora crassa ribosome arrested by cycloheximide 0.6 136 190
4cw7-assembly2.cif.gz_B structure of the fap7-rps14 complex in complex with atp 0.5844 136 189
3reg-assembly1.cif.gz_A crystal structure of ehrho1 bound to a gtp analog and magnesium 0.5702 58 134
ID Description Score Start End Superfamily
af_Q2FVR4_139_271_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8391 50 176 3.40.50.620
af_Q54FL1_98_236_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8071 57 178 3.40.50.620
af_Q2FVR4_139_271_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7991 50 176 3.40.50.620
af_P0AFY2_46_199_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7672 58 207 3.40.50.620
af_P42598_32_210_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7622 38 207 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A7V8Y2X4-F1-model_v4 YdcF family protein 0.9199 28 210 GO:0005886
AF-A0A3B8U057-F1-model_v4 deleted 0.9169 23 210
AF-A0A1Q7MT04-F1-model_v4 DUF218 domain-containing protein 0.916 35 213 GO:0005886
AF-A0A849IVT6-F1-model_v4 YdcF family protein 0.9122 31 210 GO:0005886
AF-A0A0K1XGX6-F1-model_v4 DUF218 domain-containing protein 0.9111 22 210 GO:0005886

Feature Viewer

pLDDT pTM Quality
84.79 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map