F438114

General Info

Members Datasets Scaffolds Average Seq Length
413 271 311 317

Family's Representative Sequence

Representative Sequence 3300041509|Ga0451843_0114335|Ga0451843_0114335_324_1466
Length 342
Sequence MSDAGVYVSTDELVALEARARDLRFVQKARSHQQLAGRMNSAMRGRGLTFEELRNYLPGDDIRSIDWRVTARTTKPVVRVYSEEKERPALILVDQRINMFFGSRRSMKSVTAAEAAMLCAWRILGSGDRVGGFVFGESGTSEVKPHRSRNAVIAFADRIAEKNKELRADAVSAAASGQLDAVLETVSNIGHHDHLVVVISDFDGHTARTRDLLLRLSFRNDVVCILVYDPFLLELPASGDIVVSGGGPQAELALRTASVRTSIDAFARKRGRELRAWQHELGLAMLPVSAAEETAPSDDSACPGGVSEAMLLSWERTTSRSMRLPKRCTTGSRVGRSGCSWR

Samples

Sample ID Description Type Environment
1 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
2 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
3 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
4 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
5 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
6 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
7 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
8 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
9 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
10 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
11 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
12 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
13 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
14 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
15 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
16 2643221599 Rhizobium sp. Root708 Isolate Unclassified
17 2643221607 Rhizobium sp. Root73 Isolate Unclassified
18 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
19 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
20 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
21 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
22 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
23 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
24 2643221718 Rhizobium sp. Root268 Isolate Unclassified
25 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
26 2738541293 Rhizobium sp. GV031 Isolate Unclassified
27 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
28 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
29 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
30 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
31 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
32 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
33 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
34 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
35 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
36 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
37 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
38 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
39 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
40 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
41 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
42 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
43 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
44 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
45 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
46 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
47 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
48 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
49 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
50 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
51 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
52 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
53 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
54 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
55 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
56 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
57 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
58 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
59 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
60 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
61 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
62 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
63 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
64 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
65 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
66 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
67 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
68 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
69 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
70 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
71 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
72 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
73 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
74 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
75 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
76 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
77 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
78 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
79 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
80 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
81 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
82 2996887358 Rhizobium sp. R711 Isolate Nodule
83 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
84 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
85 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
86 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
87 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
88 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
89 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
90 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
91 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
92 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
93 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
94 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
95 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
96 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
97 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
98 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
99 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
100 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
101 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
102 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
103 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
104 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
105 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
106 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
107 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
108 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
109 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
110 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
111 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
112 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
113 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
114 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
115 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
116 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
117 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
118 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
119 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
120 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
121 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
122 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
123 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
124 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
125 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
126 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
127 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
128 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
129 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
130 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
133 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
134 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
135 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
136 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
137 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
140 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
141 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
142 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
147 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
149 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
171 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
172 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
173 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
174 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
175 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
176 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
177 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
178 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
179 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
180 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
181 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
182 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
183 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
184 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
185 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
186 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
187 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
188 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
189 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
190 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
191 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
192 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
193 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
196 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
199 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
200 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
201 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
202 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
203 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
204 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
205 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
206 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
207 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
221 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
222 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
223 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
224 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
225 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
226 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
227 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
228 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
229 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
230 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
231 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
232 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
233 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
234 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
235 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
236 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
239 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
240 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
241 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
242 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
243 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
244 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
245 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
246 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
247 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
248 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
249 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
250 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
251 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
252 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
253 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
254 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
255 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
256 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
257 8005258706 Rhizobium sp. R693 Isolate Nodule
258 8005321885 Rhizobium sp. R72 Isolate Nodule
259 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
260 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
261 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
262 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
263 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
264 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
265 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
266 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
267 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
268 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
269 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
270 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
271 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.3
Metatranscriptomes 0
Isolates 24.7

Biome Distribution

Category Percentage (%)
Aerial Root 0.73
Bulb 0
Endosphere 23.24
Nodule 14.29
Rhizoplane 6.78
Rhizosphere 32.93
Stem 0
Stem Tuber 0
Unclassified 22.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000010 3300002739 Bacteria 53338
2 JGI25152J39213_1000497 3300002773 Bacteria 22123
3 JGI25152J39213_1000603 3300002773 Bacteria 19367
4 JGI25152J39213_1000711 3300002773 Bacteria 17268
5 JGI25150J39212_1000034 3300002774 Bacteria 90946
6 JGI25150J39212_1000090 3300002774 Bacteria 52878
7 JGI25159J45721_1000051 3300002987 Bacteria 57197
8 JGI25159J45721_1000934 3300002987 Bacteria 12745
9 JGI25151J46595_10000202 3300003187 Bacteria 73308
10 JGI25151J46595_10000313 3300003187 Bacteria 52878
11 JGI25153J46596_10000340 3300003215 Bacteria 33344
12 JGI25153J46596_10010595 3300003215 Bacteria 4154
13 JGI25153J46596_10013217 3300003215 Bacteria 3505
14 rootH1_10242958 3300003323 Bacteria 4135
15 JGI25160J50197_1000040 3300003354 Bacteria 154507
16 JGI25160J50197_1015529 3300003354 Bacteria 2494
17 JGI25160J50197_1015633 3300003354 Bacteria 2483
18 JGI25161J50226_1000023 3300003374 Bacteria 154507
19 JGI25161J50226_1000255 3300003374 Bacteria 31899
20 Ga0055526_1005311 3300003771 Bacteria 7460
21 Ga0055526_1021427 3300003771 Bacteria 2248
22 Ga0055524_1004540 3300003775 Bacteria 6396
23 Ga0055524_1009135 3300003775 Bacteria 4057
24 Ga0055528_1000126 3300003790 Bacteria 61346
25 Ga0055528_1005719 3300003790 Bacteria 5735
26 Ga0055540_1018549 3300003792 Bacteria 1904
27 Ga0058692_1000166 3300003856 Bacteria 40838
28 Ga0055543_1000031 3300004625 Bacteria 130583
29 Ga0055543_1000044 3300004625 Bacteria 116282
30 Ga0065165_1000249 3300005262 Bacteria 93123
31 Ga0070690_100111397 3300005330 Bacteria 1827
32 Ga0070670_100440127 3300005331 Bacteria 1154
33 Ga0068869_100008535 3300005334 Bacteria 6611
34 Ga0070682_100301003 3300005337 Bacteria 1177
35 Ga0070668_100234337 3300005347 Bacteria 1519
36 Ga0070669_100059471 3300005353 Bacteria 2806
37 Ga0070674_100117192 3300005356 Bacteria 1966
38 Ga0070663_100017120 3300005455 Bacteria 4723
39 Ga0070678_100139856 3300005456 Bacteria 1936
40 Ga0070662_100187986 3300005457 Bacteria 1631
41 Ga0068867_100204854 3300005459 Bacteria 1581
42 Ga0070665_100033748 3300005548 Bacteria 5147
43 Ga0070665_100041920 3300005548 Bacteria 4601
44 Ga0070665_100202780 3300005548 Bacteria 1984
45 Ga0068852_100635612 3300005616 Bacteria 1074
46 Ga0068861_100044180 3300005719 Bacteria 3349
47 Ga0068858_100015508 3300005842 Bacteria 7166
48 Ga0068858_100249639 3300005842 Bacteria 1685
49 Ga0068862_100348339 3300005844 Bacteria 1374
50 Ga0081455_10064733 3300005937 Bacteria 3060
51 Ga0081540_1008592 3300005983 Bacteria 7117
52 Ga0075365_10029233 3300006038 Bacteria 3520
53 Ga0075363_100000323 3300006048 Bacteria 14268
54 Ga0075363_100032337 3300006048 Bacteria 2717
55 Ga0075364_10035284 3300006051 Bacteria 3232
56 Ga0075364_10043118 3300006051 Bacteria 2932
57 Ga0075362_10047409 3300006177 Bacteria 1914
58 Ga0075367_10016478 3300006178 Bacteria 4035
59 Ga0075369_10020124 3300006186 Bacteria 2731
60 Ga0075370_10035553 3300006353 Bacteria 2796
61 Ga0105251_10079597 3300009011 Bacteria 1516
62 Ga0105250_10027739 3300009092 Bacteria 2282
63 Ga0105245_10015499 3300009098 Bacteria 6646
64 Ga0105247_10150365 3300009101 Bacteria 1534
65 Ga0105243_10237035 3300009148 Bacteria 1622
66 Ga0105241_10013180 3300009174 Bacteria 6064
67 Ga0105248_10013839 3300009177 Bacteria 8877
68 Ga0105248_10240491 3300009177 Bacteria 2038
69 Ga0105248_10269217 3300009177 Bacteria 1918
70 Ga0105237_10546196 3300009545 Bacteria 1165
71 Ga0105238_10036515 3300009551 Bacteria 4996
72 Ga0157374_10115826 3300013296 Bacteria 2582
73 Ga0157378_10470639 3300013297 Bacteria 1250
74 Ga0163162_10126790 3300013306 Bacteria 2659
75 Ga0163162_10265704 3300013306 Bacteria 1847
76 Ga0157379_10257872 3300014968 Bacteria 1584
77 Ga0209436_100043 3300025208 Bacteria 71870
78 Ga0207425_1000010 3300025245 Bacteria 572898
79 Ga0207425_1000172 3300025245 Bacteria 53044
80 Ga0209129_1000034 3300025258 Bacteria 330950
81 Ga0209129_1000263 3300025258 Bacteria 52958
82 Ga0209129_1000529 3300025258 Bacteria 26631
83 Ga0209129_1001540 3300025258 Bacteria 12707
84 Ga0209673_1000138 3300025273 Bacteria 158321
85 Ga0209673_1001863 3300025273 Bacteria 17115
86 Ga0209673_1021648 3300025273 Bacteria 2242
87 Ga0209130_1000023 3300025284 Bacteria 359355
88 Ga0209130_1000500 3300025284 Bacteria 39974
89 Ga0209025_1000022 3300025294 Bacteria 574487
90 Ga0209025_1000773 3300025294 Bacteria 53044
91 Ga0209564_1000558 3300025295 Bacteria 59623
92 Ga0209564_1001377 3300025295 Bacteria 25367
93 Ga0209564_1003944 3300025295 Bacteria 9468
94 Ga0209758_1000080 3300025297 Bacteria 261472
95 Ga0209758_1000645 3300025297 Bacteria 52915
96 Ga0209758_1000706 3300025297 Bacteria 49585
97 Ga0209758_1017735 3300025297 Bacteria 3525
98 Ga0209758_1025016 3300025297 Bacteria 2636
99 Ga0209256_1000566 3300025299 Bacteria 52813
100 Ga0209256_1009915 3300025299 Bacteria 4087
101 Ga0209256_1012278 3300025299 Bacteria 3305
102 Ga0207426_1000076 3300025302 Bacteria 320851
103 Ga0207426_1000087 3300025302 Bacteria 288870
104 Ga0207426_1000679 3300025302 Bacteria 41188
105 Ga0207426_1010709 3300025302 Bacteria 3544
106 Ga0209051_1001544 3300025303 Bacteria 19084
107 Ga0209051_1005246 3300025303 Bacteria 7648
108 Ga0207710_10008519 3300025900 Bacteria 4323
109 Ga0207654_10005913 3300025911 Bacteria 6157
110 Ga0207650_10092638 3300025925 Bacteria 2312
111 Ga0207687_10080373 3300025927 Bacteria 2353
112 Ga0207706_10073044 3300025933 Bacteria 3016
113 Ga0207686_10221074 3300025934 Bacteria 1368
114 Ga0207669_10095695 3300025937 Bacteria 1947
115 Ga0207711_10060706 3300025941 Bacteria 3258
116 Ga0207689_10005662 3300025942 Bacteria 11116
117 Ga0207667_10385211 3300025949 Bacteria 1428
118 Ga0207668_10029704 3300025972 Bacteria 3585
119 Ga0207703_10030772 3300026035 Bacteria 4241
120 Ga0207703_10197504 3300026035 Bacteria 1786
121 Ga0207678_10544274 3300026067 Bacteria 1015
122 Ga0207648_10138427 3300026089 Bacteria 2145
123 Ga0207683_10031731 3300026121 Bacteria 4586
124 Ga0209371_1000003 3300027312 Bacteria 1122971
125 Ga0268266_10001258 3300028379 Bacteria 30968
126 Ga0268266_10004620 3300028379 Bacteria 13134
127 Ga0268266_10058644 3300028379 Bacteria 3315
128 Ga0268265_10016673 3300028380 Bacteria 5054
129 Ga0268265_10368777 3300028380 Bacteria 1317
130 Ga0307517_10181914 3300028786 Bacteria 1355
131 Ga0307515_10010067 3300028794 Bacteria 18184
132 Ga0268256_1000004 3300030500 Bacteria 1122967
133 Ga0307510_10203761 3300033180 Bacteria 1509
134 Ga0439465_0007998 3300041413 Bacteria 3346
135 Ga0439465_0046042 3300041413 Bacteria 1419
136 Ga0451843_0114335 3300041509 Bacteria 1549
137 Ga0495638_0000999 3300046460 Bacteria 28400
138 Ga0495650_0040970 3300046471 Bacteria 1984
139 Ga0495585_0011277 3300046492 Bacteria 5291
140 Ga0495585_0018943 3300046492 Bacteria 3971
141 Ga0495607_0031986 3300046501 Bacteria 3217
142 Ga0495607_0168765 3300046501 Bacteria 1106
143 Ga0495583_0016375 3300046506 Bacteria 3988
144 Ga0495606_0000519 3300046507 Bacteria 62313
145 Ga0495606_0047983 3300046507 Bacteria 2813
146 Ga0495606_0060327 3300046507 Bacteria 2430
147 Ga0495606_0151234 3300046507 Bacteria 1362
148 Ga0495610_0001704 3300046512 Bacteria 19297
149 Ga0495610_0010901 3300046512 Bacteria 5609
150 Ga0495610_0027977 3300046512 Bacteria 2988
151 Ga0495616_0188775 3300046513 Bacteria 912
152 Ga0495620_0000116 3300046515 Bacteria 63936
153 Ga0495620_0045460 3300046515 Bacteria 1901
154 Ga0495620_0060842 3300046515 Bacteria 1573
155 Ga0495620_0065136 3300046515 Bacteria 1505
156 Ga0495631_0115815 3300046518 Bacteria 1152
157 Ga0495632_0036633 3300046519 Bacteria 2494
158 Ga0495632_0058463 3300046519 Bacteria 1879
159 Ga0495637_0004095 3300046520 Bacteria 7601
160 Ga0495643_0017740 3300046522 Bacteria 4154
161 Ga0495643_0046260 3300046522 Bacteria 2360
162 Ga0495648_0000741 3300046524 Bacteria 34822
163 Ga0495663_0016968 3300046525 Bacteria 2062
164 Ga0495654_0000868 3300046530 Bacteria 22753
165 Ga0495654_0025231 3300046530 Bacteria 3064
166 Ga0495633_0077956 3300046558 Bacteria 1543
167 Ga0495633_0084589 3300046558 Bacteria 1475
168 Ga0495656_0003505 3300046615 Bacteria 5308
169 Ga0495668_0042279 3300046616 Bacteria 2537
170 Ga0495668_0075763 3300046616 Bacteria 1848
171 Ga0495611_0001381 3300046648 Bacteria 12164
172 Ga0495625_0002417 3300046660 Bacteria 20226
173 Ga0495625_0007734 3300046660 Bacteria 9290
174 Ga0495625_0062114 3300046660 Bacteria 2641
175 Ga0495625_0067028 3300046660 Bacteria 2527
176 Ga0495661_0051557 3300046665 Bacteria 2484
177 Ga0495588_0000450 3300046674 Bacteria 20738
178 Ga0495588_0000528 3300046674 Bacteria 18433
179 Ga0495588_0023631 3300046674 Bacteria 3045
180 Ga0495613_0004517 3300046689 Bacteria 10435
181 Ga0495670_0000245 3300046691 Bacteria 25189
182 Ga0495670_0139326 3300046691 Bacteria 1268
183 Ga0495671_0016486 3300046692 Bacteria 3945
184 Ga0495649_0103312 3300046694 Bacteria 1513
185 Ga0495589_0061090 3300046794 Bacteria 1850
186 Ga0495660_0046557 3300046810 Bacteria 2378
187 Ga0495660_0093351 3300046810 Bacteria 1560
188 Ga0495683_0106740 3300047323 Bacteria 1341
189 Ga0495687_000105 3300047443 Bacteria 128239
190 Ga0495681_0036654 3300047470 Bacteria 2423
191 Ga0495686_0005046 3300047472 Bacteria 10588
192 Ga0495686_0027044 3300047472 Bacteria 3749
193 Ga0495686_0058483 3300047472 Bacteria 2403
194 Ga0495686_0147883 3300047472 Bacteria 1381
195 Ga0495615_0001876 3300048090 Bacteria 3235
196 Ga0496101_0148038 3300048904 Bacteria 1794
197 Ga0496101_0187786 3300048904 Bacteria 1594
198 Ga0496102_0077417 3300048905 Bacteria 3061
199 Ga0496102_0080328 3300048905 Bacteria 3004
200 Ga0496102_0346494 3300048905 Bacteria 1399
201 Ga0496104_0000486 3300048907 Bacteria 34213
202 Ga0496104_0016381 3300048907 Bacteria 6733
203 Ga0496104_0488491 3300048907 Bacteria 1142
204 Ga0496105_0027211 3300048908 Bacteria 4669
205 Ga0496105_0110313 3300048908 Bacteria 2271
206 Ga0496105_0110808 3300048908 Bacteria 2266
207 Ga0496106_0000028 3300048909 Bacteria 143296
208 Ga0496106_0037723 3300048909 Bacteria 3616
209 Ga0496106_0049861 3300048909 Bacteria 3155
210 Ga0496108_0197537 3300048911 Bacteria 1745
211 Ga0496109_0174693 3300048912 Bacteria 2016
212 Ga0496109_0190358 3300048912 Bacteria 1928
213 Ga0496109_0219752 3300048912 Bacteria 1787
214 Ga0496109_0291559 3300048912 Bacteria 1538
215 Ga0496110_0152019 3300048913 Bacteria 2096
216 Ga0496110_0191346 3300048913 Bacteria 1858
217 Ga0496111_0010788 3300048914 Bacteria 6142
218 Ga0496112_0208627 3300048915 Bacteria 1911
219 Ga0496112_0441596 3300048915 Bacteria 1239
220 Ga0496113_0401681 3300048916 Bacteria 1100
221 Ga0496115_0019332 3300048918 Bacteria 5241
222 Ga0496115_0284380 3300048918 Bacteria 1357
223 Ga0496116_0000764 3300048919 Bacteria 40872
224 Ga0496116_0000829 3300048919 Bacteria 39056
225 Ga0496116_0017328 3300048919 Bacteria 5593
226 Ga0496116_0028916 3300048919 Bacteria 4006
227 Ga0496116_0145982 3300048919 Bacteria 1322
228 Ga0496117_0006539 3300048920 Bacteria 11736
229 Ga0496117_0021460 3300048920 Bacteria 5222
230 Ga0496117_0090583 3300048920 Bacteria 1970
231 Ga0496118_0002206 3300048921 Bacteria 27024
232 Ga0496118_0010442 3300048921 Bacteria 9197
233 Ga0496118_0028783 3300048921 Bacteria 4672
234 Ga0496118_0040283 3300048921 Bacteria 3717
235 Ga0496118_0283417 3300048921 Bacteria 921
236 Ga0496119_0042493 3300048922 Bacteria 2881
237 Ga0496119_0082643 3300048922 Bacteria 1847
238 Ga0496121_0005955 3300048924 Bacteria 15411
239 Ga0496121_0012774 3300048924 Bacteria 9096
240 Ga0496121_0012814 3300048924 Bacteria 9078
241 Ga0496121_0022555 3300048924 Bacteria 6102
242 Ga0496121_0030454 3300048924 Bacteria 4955
243 Ga0496121_0035145 3300048924 Bacteria 4496
244 Ga0496121_0042144 3300048924 Bacteria 3977
245 Ga0496121_0044015 3300048924 Bacteria 3858
246 Ga0496121_0072857 3300048924 Bacteria 2756
247 Ga0496121_0226616 3300048924 Bacteria 1312
248 Ga0496121_0284900 3300048924 Bacteria 1128
249 Ga0496122_0000924 3300048925 Bacteria 53653
250 Ga0496122_0002393 3300048925 Bacteria 26784
251 Ga0496122_0002726 3300048925 Bacteria 24464
252 Ga0496122_0003365 3300048925 Bacteria 21052
253 Ga0496122_0004619 3300048925 Bacteria 16944
254 Ga0496122_0010436 3300048925 Bacteria 9575
255 Ga0496123_0003045 3300048926 Bacteria 19307
256 Ga0496123_0004494 3300048926 Bacteria 14613
257 Ga0496123_0006115 3300048926 Bacteria 11805
258 Ga0496123_0014961 3300048926 Bacteria 6396
259 Ga0496123_0017388 3300048926 Bacteria 5788
260 Ga0496123_0070665 3300048926 Bacteria 2183
261 Ga0496124_0000687 3300048927 Bacteria 55709
262 Ga0496124_0000758 3300048927 Bacteria 52830
263 Ga0496124_0003277 3300048927 Bacteria 19992
264 Ga0496124_0005004 3300048927 Bacteria 15153
265 Ga0496124_0005951 3300048927 Bacteria 13481
266 Ga0496124_0013628 3300048927 Bacteria 7926
267 Ga0496124_0024647 3300048927 Bacteria 5464
268 Ga0496124_0043591 3300048927 Bacteria 3856
269 Ga0496124_0091034 3300048927 Bacteria 2486
270 Ga0496124_0171510 3300048927 Bacteria 1679
271 Ga0496125_0002848 3300048928 Bacteria 21779
272 Ga0496125_0018713 3300048928 Bacteria 6567
273 Ga0496125_0059731 3300048928 Bacteria 3069
274 Ga0496125_0086467 3300048928 Bacteria 2371
275 Ga0496126_0002304 3300048929 Bacteria 26214
276 Ga0496126_0006874 3300048929 Bacteria 12605
277 Ga0496126_0047363 3300048929 Bacteria 3936
278 Ga0496126_0101464 3300048929 Bacteria 2517
279 Ga0496126_0122306 3300048929 Bacteria 2256
280 Ga0496126_0134008 3300048929 Bacteria 2138
281 Ga0496126_0137349 3300048929 Bacteria 2107
282 Ga0495678_019112 3300049459 Bacteria 3066
283 nmdc:mga03683_23427_c1 3300050489 Bacteria 2404
284 nmdc:mga03n38_39084_c1 3300050490 Bacteria 2056
285 nmdc:mga00v17_79003_c1 3300050491 Bacteria 2051
286 nmdc:mga0yw44_193354_c1 3300050492 Bacteria 1342
287 nmdc:mga06z11_19464_c1 3300050494 Bacteria 3122
288 nmdc:mga06z11_46538_c1 3300050494 Bacteria 2199
289 nmdc:mga07m45_162228_c1 3300050496 Bacteria 1298
290 nmdc:mga07m45_37758_c1 3300050496 Bacteria 2694
291 nmdc:mga0n895_231687_c1 3300050512 Bacteria 1874
292 Ga0500578_0025234 3300053086 Bacteria 3813
293 Ga0500583_0003899 3300053092 Bacteria 4781
294 Ga0500651_0089032 3300053093 Bacteria 1903
295 Ga0500560_000412 3300053107 Bacteria 5834
296 Ga0500572_036368 3300053111 Bacteria 1405
297 Ga0500608_000709 3300053122 Bacteria 12236
298 Ga0500618_000681 3300053125 Bacteria 20017
299 Ga0500618_000854 3300053125 Bacteria 16379
300 Ga0500618_017907 3300053125 Bacteria 1758
301 Ga0500642_0073949 3300053130 Bacteria 1555
302 Ga0500652_052774 3300053131 Bacteria 1662
303 Ga0500658_0009702 3300053134 Bacteria 3549
304 Ga0500568_0000479 3300053139 Bacteria 29607
305 Ga0500573_0024712 3300053140 Bacteria 3454
306 Ga0500574_000090 3300053141 Bacteria 10387
307 Ga0500604_0014472 3300053151 Bacteria 2149
308 Ga0500622_0000206 3300053156 Bacteria 62842
309 Ga0500638_000041 3300053162 Bacteria 37081
310 Ga0500636_0050201 3300053177 Bacteria 2454
311 Ga0500567_045219 3300053723 Bacteria 2037

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048905 Ga0496102_0080328 Ga0496102_0080328_2127_2972 270
2 3300050512 nmdc:mga0n895_231687_c1 nmdc:mga0n895_231687_c1_77_922 270
3 3300009101 Ga0105247_10150365 Ga0105247_101503652 272
4 3300025900 Ga0207710_10008519 Ga0207710_100085192 272
5 3300046691 Ga0495670_0139326 Ga0495670_0139326_264_1250 272
6 3300046794 Ga0495589_0061090 Ga0495589_0061090_580_1566 272
7 3300048924 Ga0496121_0042144 Ga0496121_0042144_732_1718 272
8 3300046513 Ga0495616_0188775 Ga0495616_0188775_44_868 274
9 3300046515 Ga0495620_0045460 Ga0495620_0045460_1053_1877 274
10 3300046515 Ga0495620_0065136 Ga0495620_0065136_33_857 274
11 3300046518 Ga0495631_0115815 Ga0495631_0115815_92_1078 274
12 3300046558 Ga0495633_0077956 Ga0495633_0077956_383_1369 274
13 3300046519 Ga0495632_0036633 Ga0495632_0036633_771_1757 275
14 3300046692 Ga0495671_0016486 Ga0495671_0016486_27_1013 275
15 3300053130 Ga0500642_0073949 Ga0500642_0073949_545_1531 275
16 3300028786 Ga0307517_10181914 Ga0307517_101819141 278
17 3300046616 Ga0495668_0042279 Ga0495668_0042279_936_1922 279
18 3300048905 Ga0496102_0346494 Ga0496102_0346494_503_1384 282
19 3300048916 Ga0496113_0401681 Ga0496113_0401681_223_1086 287
20 3300048921 Ga0496118_0283417 Ga0496118_0283417_16_879 287
21 3300053111 Ga0500572_036368 Ga0500572_036368_40_903 287
22 3300025949 Ga0207667_10385211 Ga0207667_103852112 288
23 3300050496 nmdc:mga07m45_162228_c1 nmdc:mga07m45_162228_c1_91_1077 293
24 3300026067 Ga0207678_10544274 Ga0207678_105442742 299
25 3300053177 Ga0500636_0050201 Ga0500636_0050201_41_1024 300
26 iso_pu_bacteria 2929138655 2929142777 307
27 3300041509 Ga0451843_0114335 Ga0451843_0114335_324_1466 308
28 iso_pu_bacteria 2513237103 2513712067 308
29 iso_pu_bacteria 2516653077 2517040753 308
30 iso_pu_bacteria 2529292951 2530648768 308
31 iso_pu_bacteria 2582581304 2585257975 308
32 iso_pu_bacteria 2724679232 2725949523 308
33 iso_pu_bacteria 2838729681 2838735195 308
34 iso_pu_bacteria 2838742623 2838747954 308
35 iso_pu_bacteria 2842217011 2842219794 308
36 iso_pu_bacteria 2842243621 2842249043 308
37 iso_pu_bacteria 2842257432 2842262998 308
38 iso_pu_bacteria 2844454524 2844454739 308
39 iso_pu_bacteria 2857516855 2857524144 308
40 iso_pu_bacteria 639633055 639647799 308
41 iso_pu_bacteria 8005556819 8005562542 308
42 iso_pu_bacteria 8005563573 8005566317 308
43 iso_pu_bacteria 8018163183 8018163589 308
44 iso_pu_bacteria 8057874678 8057881446 308
45 iso_pu_bacteria 2582581304 2585259247 309
46 iso_pu_bacteria 2585427594 2585843123 309
47 iso_pu_bacteria 2841851746 2841857507 309
48 iso_pu_bacteria 2857531043 2857537135 309
49 3300046530 Ga0495654_0000868 Ga0495654_0000868_7183_8115 310
50 3300053125 Ga0500618_000681 Ga0500618_000681_14719_15651 310
51 iso_pu_bacteria 2932794094 2932797656 310
52 iso_pu_bacteria 2932801729 2932802974 310
53 iso_pu_bacteria 2935883170 2935885313 310
54 3300005548 Ga0070665_100041920 Ga0070665_1000419204 311
55 3300028379 Ga0268266_10058644 Ga0268266_100586443 311
56 3300048927 Ga0496124_0000758 Ga0496124_0000758_16405_17340 311
57 3300046512 Ga0495610_0010901 Ga0495610_0010901_284_1222 312
58 3300046616 Ga0495668_0075763 Ga0495668_0075763_328_1266 312
59 3300046810 Ga0495660_0093351 Ga0495660_0093351_408_1346 312
60 3300047323 Ga0495683_0106740 Ga0495683_0106740_252_1190 312
61 3300047472 Ga0495686_0147883 Ga0495686_0147883_43_981 312
62 3300049459 Ga0495678_019112 Ga0495678_019112_663_1601 312
63 3300053086 Ga0500578_0025234 Ga0500578_0025234_2637_3575 312
64 iso_pu_bacteria 2534681796 2535517199 312
65 iso_pu_bacteria 2582581306 2585267910 312
66 iso_pu_bacteria 2582581865 2585386986 312
67 iso_pu_bacteria 2643221607 2644048758 312
68 iso_pu_bacteria 2643221636 2644201919 312
69 iso_pu_bacteria 2643221637 2644207788 312
70 iso_pu_bacteria 2643221686 2644481560 312
71 iso_pu_bacteria 2643221689 2644500032 312
72 iso_pu_bacteria 2643221718 2644651877 312
73 iso_pu_bacteria 2738541293 2738805011 312
74 iso_pu_bacteria 2818991461 2819687983 312
75 iso_pu_bacteria 2838736955 2838741776 312
76 iso_pu_bacteria 2841840854 2841845808 312
77 iso_pu_bacteria 2842140634 2842145512 312
78 iso_pu_bacteria 2842395702 2842397238 312
79 iso_pu_bacteria 2842922631 2842928100 312
80 iso_pu_bacteria 2852387548 2852393580 312
81 iso_pu_bacteria 2996887358 2996892500 312
82 iso_pu_bacteria 3005409236 3005413003 312
83 iso_pu_bacteria 8005258706 8005264873 312
84 iso_pu_bacteria 8005321885 8005327027 312
85 iso_pu_bacteria 8005542996 8005546016 312
86 iso_pu_bacteria 8005695170 8005699144 312
87 iso_pu_bacteria 8057575449 8057579765 312
88 3300002773 JGI25152J39213_1000603 JGI25152J39213_10006034 313
89 3300002774 JGI25150J39212_1000034 JGI25150J39212_100003413 313
90 3300003187 JGI25151J46595_10000202 JGI25151J46595_1000020213 313
91 3300003215 JGI25153J46596_10000340 JGI25153J46596_1000034018 313
92 3300025245 Ga0207425_1000010 Ga0207425_1000010181 313
93 3300025258 Ga0209129_1000034 Ga0209129_1000034160 313
94 3300025294 Ga0209025_1000022 Ga0209025_1000022401 313
95 3300025297 Ga0209758_1000080 Ga0209758_1000080119 313
96 3300046674 Ga0495588_0000528 Ga0495588_0000528_963_1904 313
97 3300048909 Ga0496106_0037723 Ga0496106_0037723_2607_3548 313
98 3300048919 Ga0496116_0000764 Ga0496116_0000764_13602_14543 313
99 3300048921 Ga0496118_0040283 Ga0496118_0040283_2431_3372 313
100 3300048925 Ga0496122_0003365 Ga0496122_0003365_6396_7337 313
101 3300048926 Ga0496123_0004494 Ga0496123_0004494_7812_8753 313
102 3300048927 Ga0496124_0000687 Ga0496124_0000687_844_1785 313
103 3300048927 Ga0496124_0005004 Ga0496124_0005004_75_1016 313
104 3300048929 Ga0496126_0002304 Ga0496126_0002304_18006_18947 313
105 3300053107 Ga0500560_000412 Ga0500560_000412_1542_2483 313
106 iso_pu_bacteria 2510917030 2511197463 313
107 iso_pu_bacteria 2513237104 2513720089 313
108 iso_pu_bacteria 2528768022 2528849778 313
109 iso_pu_bacteria 2582581294 2585200964 313
110 iso_pu_bacteria 2582581298 2585225061 313
111 iso_pu_bacteria 2585427529 2585547617 313
112 iso_pu_bacteria 2585427594 2585846322 313
113 iso_pu_bacteria 2599185236 2599720668 313
114 iso_pu_bacteria 2643221599 2644005312 313
115 iso_pu_bacteria 2643221634 2644191435 313
116 iso_pu_bacteria 2643221643 2644239090 313
117 iso_pu_bacteria 2824600985 2824604251 313
118 iso_pu_bacteria 2824609381 2824614276 313
119 iso_pu_bacteria 2824653114 2824658334 313
120 iso_pu_bacteria 2888419890 2888421565 313
121 iso_pu_bacteria 2919100787 2919105787 313
122 iso_pu_bacteria 2929615660 2929617743 313
123 iso_pu_bacteria 2929624759 2929627448 313
124 iso_pu_bacteria 2932784394 2932788453 313
125 iso_pu_bacteria 2932809354 2932816282 313
126 iso_pu_bacteria 2932828146 2932831535 313
127 iso_pu_bacteria 2933577622 2933579699 313
128 iso_pu_bacteria 2935616580 2935622416 313
129 iso_pu_bacteria 2935630451 2935630870 313
130 iso_pu_bacteria 2935638405 2935645155 313
131 iso_pu_bacteria 2935665750 2935671816 313
132 iso_pu_bacteria 2935703347 2935707019 313
133 iso_pu_bacteria 2935801545 2935807634 313
134 iso_pu_bacteria 2935810662 2935817097 313
135 iso_pu_bacteria 2935827899 2935834622 313
136 iso_pu_bacteria 2935837841 2935840304 313
137 iso_pu_bacteria 2935855204 2935860515 313
138 iso_pu_bacteria 2935864058 2935865446 313
139 iso_pu_bacteria 2935873716 2935878042 313
140 iso_pu_bacteria 2935959822 2935964643 313
141 iso_pu_bacteria 2935992306 2935996008 313
142 iso_pu_bacteria 2936002035 2936009521 313
143 iso_pu_bacteria 2936037263 2936043476 313
144 iso_pu_bacteria 2941507105 2941507522 313
145 iso_pu_bacteria 2941515067 2941515949 313
146 iso_pu_bacteria 2941523033 2941523343 313
147 iso_pu_bacteria 2941538514 2941541564 313
148 iso_pu_bacteria 2979100975 2979102051 313
149 iso_pu_bacteria 2984509177 2984510001 313
150 iso_pu_bacteria 2984518228 2984519299 313
151 iso_pu_bacteria 2984537506 2984538342 313
152 iso_pu_bacteria 3005452660 3005457528 313
153 iso_pu_bacteria 8006984368 8006985915 313
154 iso_pu_bacteria 8016511872 8016513609 313
155 iso_pu_bacteria 8017057580 8017062832 313
156 iso_pu_bacteria 8019576017 8019582270 313
157 iso_pu_bacteria 8019608314 8019617250 313
158 iso_pu_bacteria 8055742211 8055746642 313
159 3300005337 Ga0070682_100301003 Ga0070682_1003010031 315
160 3300046460 Ga0495638_0000999 Ga0495638_0000999_18159_19106 315
161 3300002987 JGI25159J45721_1000051 JGI25159J45721_100005122 316
162 3300003354 JGI25160J50197_1000040 JGI25160J50197_100004028 316
163 3300003374 JGI25161J50226_1000023 JGI25161J50226_100002328 316
164 3300004625 Ga0055543_1000044 Ga0055543_100004425 316
165 3300005262 Ga0065165_1000249 Ga0065165_100024928 316
166 3300006048 Ga0075363_100032337 Ga0075363_1000323373 316
167 3300025284 Ga0209130_1000500 Ga0209130_100050028 316
168 3300025297 Ga0209758_1025016 Ga0209758_10250163 316
169 3300025302 Ga0207426_1000076 Ga0207426_1000076179 316
170 3300025303 Ga0209051_1005246 Ga0209051_10052462 316
171 3300033180 Ga0307510_10203761 Ga0307510_102037612 316
172 3300046471 Ga0495650_0040970 Ga0495650_0040970_904_1854 316
173 3300046492 Ga0495585_0011277 Ga0495585_0011277_1985_2935 316
174 3300046501 Ga0495607_0031986 Ga0495607_0031986_2037_2987 316
175 3300046501 Ga0495607_0168765 Ga0495607_0168765_27_977 316
176 3300046506 Ga0495583_0016375 Ga0495583_0016375_190_1140 316
177 3300046507 Ga0495606_0000519 Ga0495606_0000519_45477_46427 316
178 3300046507 Ga0495606_0151234 Ga0495606_0151234_385_1335 316
179 3300046512 Ga0495610_0001704 Ga0495610_0001704_12705_13655 316
180 3300046512 Ga0495610_0027977 Ga0495610_0027977_138_1088 316
181 3300046515 Ga0495620_0000116 Ga0495620_0000116_19309_20259 316
182 3300046515 Ga0495620_0060842 Ga0495620_0060842_266_1216 316
183 3300046519 Ga0495632_0058463 Ga0495632_0058463_133_1083 316
184 3300046520 Ga0495637_0004095 Ga0495637_0004095_1199_2149 316
185 3300046522 Ga0495643_0017740 Ga0495643_0017740_2423_3373 316
186 3300046522 Ga0495643_0046260 Ga0495643_0046260_987_1937 316
187 3300046524 Ga0495648_0000741 Ga0495648_0000741_32177_33127 316
188 3300046525 Ga0495663_0016968 Ga0495663_0016968_511_1461 316
189 3300046530 Ga0495654_0025231 Ga0495654_0025231_951_1901 316
190 3300046558 Ga0495633_0084589 Ga0495633_0084589_300_1250 316
191 3300046615 Ga0495656_0003505 Ga0495656_0003505_2116_3066 316
192 3300046648 Ga0495611_0001381 Ga0495611_0001381_8523_9473 316
193 3300046660 Ga0495625_0002417 Ga0495625_0002417_10544_11494 316
194 3300046660 Ga0495625_0007734 Ga0495625_0007734_4417_5367 316
195 3300046660 Ga0495625_0067028 Ga0495625_0067028_706_1656 316
196 3300046665 Ga0495661_0051557 Ga0495661_0051557_622_1572 316
197 3300046674 Ga0495588_0000450 Ga0495588_0000450_8252_9202 316
198 3300046689 Ga0495613_0004517 Ga0495613_0004517_4037_4987 316
199 3300046691 Ga0495670_0000245 Ga0495670_0000245_14104_15054 316
200 3300046810 Ga0495660_0046557 Ga0495660_0046557_1397_2347 316
201 3300047443 Ga0495687_000105 Ga0495687_000105_11687_12637 316
202 3300047470 Ga0495681_0036654 Ga0495681_0036654_1100_2050 316
203 3300047472 Ga0495686_0005046 Ga0495686_0005046_8025_8975 316
204 3300048090 Ga0495615_0001876 Ga0495615_0001876_886_1836 316
205 3300048907 Ga0496104_0000486 Ga0496104_0000486_15845_16819 316
206 3300048908 Ga0496105_0110313 Ga0496105_0110313_247_1221 316
207 3300048912 Ga0496109_0190358 Ga0496109_0190358_647_1621 316
208 3300048918 Ga0496115_0019332 Ga0496115_0019332_3060_4034 316
209 3300048919 Ga0496116_0000829 Ga0496116_0000829_24346_25296 316
210 3300048920 Ga0496117_0006539 Ga0496117_0006539_1171_2121 316
211 3300048921 Ga0496118_0002206 Ga0496118_0002206_12355_13305 316
212 3300048922 Ga0496119_0042493 Ga0496119_0042493_545_1495 316
213 3300048924 Ga0496121_0022555 Ga0496121_0022555_2688_3638 316
214 3300048924 Ga0496121_0035145 Ga0496121_0035145_1713_2663 316
215 3300048924 Ga0496121_0072857 Ga0496121_0072857_684_1634 316
216 3300048924 Ga0496121_0284900 Ga0496121_0284900_47_997 316
217 3300048925 Ga0496122_0002393 Ga0496122_0002393_13439_14389 316
218 3300048926 Ga0496123_0003045 Ga0496123_0003045_6019_6969 316
219 3300048927 Ga0496124_0003277 Ga0496124_0003277_14111_15061 316
220 3300048929 Ga0496126_0122306 Ga0496126_0122306_944_1894 316
221 3300053092 Ga0500583_0003899 Ga0500583_0003899_650_1600 316
222 3300053122 Ga0500608_000709 Ga0500608_000709_1978_2928 316
223 3300053125 Ga0500618_000854 Ga0500618_000854_6118_7068 316
224 3300053125 Ga0500618_017907 Ga0500618_017907_236_1186 316
225 3300053131 Ga0500652_052774 Ga0500652_052774_183_1133 316
226 3300053140 Ga0500573_0024712 Ga0500573_0024712_2176_3126 316
227 3300053141 Ga0500574_000090 Ga0500574_000090_9260_10210 316
228 3300053162 Ga0500638_000041 Ga0500638_000041_13185_14135 316
229 3300053723 Ga0500567_045219 Ga0500567_045219_410_1360 316
230 3300002739 JGI25158J39367_1000010 JGI25158J39367_100001039 317
231 3300002773 JGI25152J39213_1000497 JGI25152J39213_100049723 317
232 3300002773 JGI25152J39213_1000711 JGI25152J39213_100071116 317
233 3300002774 JGI25150J39212_1000090 JGI25150J39212_100009047 317
234 3300002987 JGI25159J45721_1000934 JGI25159J45721_10009342 317
235 3300003187 JGI25151J46595_10000313 JGI25151J46595_1000031322 317
236 3300003215 JGI25153J46596_10010595 JGI25153J46596_100105951 317
237 3300003215 JGI25153J46596_10013217 JGI25153J46596_100132174 317
238 3300003323 rootH1_10242958 rootH1_102429584 317
239 3300003354 JGI25160J50197_1015529 JGI25160J50197_10155292 317
240 3300003354 JGI25160J50197_1015633 JGI25160J50197_10156331 317
241 3300003374 JGI25161J50226_1000255 JGI25161J50226_100025528 317
242 3300003771 Ga0055526_1005311 Ga0055526_10053116 317
243 3300003771 Ga0055526_1021427 Ga0055526_10214272 317
244 3300003775 Ga0055524_1004540 Ga0055524_10045403 317
245 3300003775 Ga0055524_1009135 Ga0055524_10091352 317
246 3300003790 Ga0055528_1000126 Ga0055528_100012658 317
247 3300003790 Ga0055528_1005719 Ga0055528_10057194 317
248 3300003792 Ga0055540_1018549 Ga0055540_10185492 317
249 3300003856 Ga0058692_1000166 Ga0058692_100016610 317
250 3300004625 Ga0055543_1000031 Ga0055543_100003191 317
251 3300005330 Ga0070690_100111397 Ga0070690_1001113972 317
252 3300005331 Ga0070670_100440127 Ga0070670_1004401271 317
253 3300005334 Ga0068869_100008535 Ga0068869_1000085353 317
254 3300005347 Ga0070668_100234337 Ga0070668_1002343372 317
255 3300005353 Ga0070669_100059471 Ga0070669_1000594712 317
256 3300005356 Ga0070674_100117192 Ga0070674_1001171923 317
257 3300005455 Ga0070663_100017120 Ga0070663_1000171203 317
258 3300005456 Ga0070678_100139856 Ga0070678_1001398561 317
259 3300005457 Ga0070662_100187986 Ga0070662_1001879862 317
260 3300005459 Ga0068867_100204854 Ga0068867_1002048542 317
261 3300005548 Ga0070665_100033748 Ga0070665_1000337483 317
262 3300005548 Ga0070665_100202780 Ga0070665_1002027801 317
263 3300005616 Ga0068852_100635612 Ga0068852_1006356121 317
264 3300005719 Ga0068861_100044180 Ga0068861_1000441803 317
265 3300005842 Ga0068858_100015508 Ga0068858_1000155084 317
266 3300005842 Ga0068858_100249639 Ga0068858_1002496392 317
267 3300005844 Ga0068862_100348339 Ga0068862_1003483392 317
268 3300005937 Ga0081455_10064733 Ga0081455_100647333 317
269 3300005983 Ga0081540_1008592 Ga0081540_10085923 317
270 3300006038 Ga0075365_10029233 Ga0075365_100292331 317
271 3300006048 Ga0075363_100000323 Ga0075363_10000032311 317
272 3300006051 Ga0075364_10035284 Ga0075364_100352843 317
273 3300006051 Ga0075364_10043118 Ga0075364_100431183 317
274 3300006177 Ga0075362_10047409 Ga0075362_100474092 317
275 3300006178 Ga0075367_10016478 Ga0075367_100164783 317
276 3300006186 Ga0075369_10020124 Ga0075369_100201243 317
277 3300006353 Ga0075370_10035553 Ga0075370_100355533 317
278 3300009011 Ga0105251_10079597 Ga0105251_100795972 317
279 3300009092 Ga0105250_10027739 Ga0105250_100277392 317
280 3300009098 Ga0105245_10015499 Ga0105245_100154993 317
281 3300009148 Ga0105243_10237035 Ga0105243_102370352 317
282 3300009174 Ga0105241_10013180 Ga0105241_100131802 317
283 3300009177 Ga0105248_10013839 Ga0105248_100138397 317
284 3300009177 Ga0105248_10240491 Ga0105248_102404913 317
285 3300009177 Ga0105248_10269217 Ga0105248_102692173 317
286 3300009545 Ga0105237_10546196 Ga0105237_105461961 317
287 3300009551 Ga0105238_10036515 Ga0105238_100365154 317
288 3300013296 Ga0157374_10115826 Ga0157374_101158263 317
289 3300013297 Ga0157378_10470639 Ga0157378_104706392 317
290 3300013306 Ga0163162_10126790 Ga0163162_101267903 317
291 3300013306 Ga0163162_10265704 Ga0163162_102657042 317
292 3300014968 Ga0157379_10257872 Ga0157379_102578722 317
293 3300025208 Ga0209436_100043 Ga0209436_10004336 317
294 3300025245 Ga0207425_1000172 Ga0207425_100017222 317
295 3300025258 Ga0209129_1000263 Ga0209129_100026321 317
296 3300025258 Ga0209129_1000529 Ga0209129_100052923 317
297 3300025258 Ga0209129_1001540 Ga0209129_10015405 317
298 3300025273 Ga0209673_1000138 Ga0209673_1000138158 317
299 3300025273 Ga0209673_1001863 Ga0209673_100186314 317
300 3300025273 Ga0209673_1021648 Ga0209673_10216482 317
301 3300025284 Ga0209130_1000023 Ga0209130_1000023326 317
302 3300025294 Ga0209025_1000773 Ga0209025_100077322 317
303 3300025295 Ga0209564_1000558 Ga0209564_100055833 317
304 3300025295 Ga0209564_1001377 Ga0209564_10013775 317
305 3300025295 Ga0209564_1003944 Ga0209564_10039444 317
306 3300025297 Ga0209758_1000645 Ga0209758_100064521 317
307 3300025297 Ga0209758_1000706 Ga0209758_100070635 317
308 3300025297 Ga0209758_1017735 Ga0209758_10177352 317
309 3300025299 Ga0209256_1000566 Ga0209256_100056649 317
310 3300025299 Ga0209256_1009915 Ga0209256_10099153 317
311 3300025299 Ga0209256_1012278 Ga0209256_10122783 317
312 3300025302 Ga0207426_1000087 Ga0207426_100008736 317
313 3300025302 Ga0207426_1000679 Ga0207426_10006794 317
314 3300025302 Ga0207426_1010709 Ga0207426_10107093 317
315 3300025303 Ga0209051_1001544 Ga0209051_10015442 317
316 3300025911 Ga0207654_10005913 Ga0207654_100059136 317
317 3300025925 Ga0207650_10092638 Ga0207650_100926383 317
318 3300025927 Ga0207687_10080373 Ga0207687_100803733 317
319 3300025933 Ga0207706_10073044 Ga0207706_100730442 317
320 3300025934 Ga0207686_10221074 Ga0207686_102210742 317
321 3300025937 Ga0207669_10095695 Ga0207669_100956953 317
322 3300025941 Ga0207711_10060706 Ga0207711_100607062 317
323 3300025942 Ga0207689_10005662 Ga0207689_100056628 317
324 3300025972 Ga0207668_10029704 Ga0207668_100297044 317
325 3300026035 Ga0207703_10030772 Ga0207703_100307722 317
326 3300026035 Ga0207703_10197504 Ga0207703_101975042 317
327 3300026089 Ga0207648_10138427 Ga0207648_101384272 317
328 3300026121 Ga0207683_10031731 Ga0207683_100317313 317
329 3300027312 Ga0209371_1000003 Ga0209371_1000003966 317
330 3300028379 Ga0268266_10001258 Ga0268266_1000125817 317
331 3300028379 Ga0268266_10004620 Ga0268266_100046204 317
332 3300028380 Ga0268265_10016673 Ga0268265_100166733 317
333 3300028380 Ga0268265_10368777 Ga0268265_103687772 317
334 3300028794 Ga0307515_10010067 Ga0307515_1001006718 317
335 3300030500 Ga0268256_1000004 Ga0268256_100000487 317
336 3300041413 Ga0439465_0007998 Ga0439465_0007998_535_1488 317
337 3300041413 Ga0439465_0046042 Ga0439465_0046042_26_979 317
338 3300046492 Ga0495585_0018943 Ga0495585_0018943_726_1679 317
339 3300046507 Ga0495606_0047983 Ga0495606_0047983_533_1486 317
340 3300046507 Ga0495606_0060327 Ga0495606_0060327_1180_2133 317
341 3300046660 Ga0495625_0062114 Ga0495625_0062114_1413_2366 317
342 3300046674 Ga0495588_0023631 Ga0495588_0023631_1094_2080 317
343 3300046694 Ga0495649_0103312 Ga0495649_0103312_360_1313 317
344 3300047472 Ga0495686_0027044 Ga0495686_0027044_497_1450 317
345 3300047472 Ga0495686_0058483 Ga0495686_0058483_452_1438 317
346 3300048904 Ga0496101_0148038 Ga0496101_0148038_552_1538 317
347 3300048904 Ga0496101_0187786 Ga0496101_0187786_115_1101 317
348 3300048905 Ga0496102_0077417 Ga0496102_0077417_771_1757 317
349 3300048907 Ga0496104_0016381 Ga0496104_0016381_4547_5533 317
350 3300048907 Ga0496104_0488491 Ga0496104_0488491_80_1066 317
351 3300048908 Ga0496105_0027211 Ga0496105_0027211_3117_4073 317
352 3300048908 Ga0496105_0110808 Ga0496105_0110808_906_1892 317
353 3300048909 Ga0496106_0000028 Ga0496106_0000028_19504_20457 317
354 3300048909 Ga0496106_0049861 Ga0496106_0049861_1723_2709 317
355 3300048911 Ga0496108_0197537 Ga0496108_0197537_167_1153 317
356 3300048912 Ga0496109_0174693 Ga0496109_0174693_679_1665 317
357 3300048912 Ga0496109_0219752 Ga0496109_0219752_366_1322 317
358 3300048912 Ga0496109_0291559 Ga0496109_0291559_503_1489 317
359 3300048913 Ga0496110_0152019 Ga0496110_0152019_85_1071 317
360 3300048913 Ga0496110_0191346 Ga0496110_0191346_839_1825 317
361 3300048914 Ga0496111_0010788 Ga0496111_0010788_3755_4708 317
362 3300048915 Ga0496112_0208627 Ga0496112_0208627_692_1678 317
363 3300048915 Ga0496112_0441596 Ga0496112_0441596_220_1206 317
364 3300048918 Ga0496115_0284380 Ga0496115_0284380_21_1007 317
365 3300048919 Ga0496116_0017328 Ga0496116_0017328_2629_3582 317
366 3300048919 Ga0496116_0028916 Ga0496116_0028916_1341_2294 317
367 3300048919 Ga0496116_0145982 Ga0496116_0145982_132_1088 317
368 3300048920 Ga0496117_0021460 Ga0496117_0021460_2427_3380 317
369 3300048920 Ga0496117_0090583 Ga0496117_0090583_308_1261 317
370 3300048921 Ga0496118_0010442 Ga0496118_0010442_4634_5587 317
371 3300048921 Ga0496118_0028783 Ga0496118_0028783_3165_4118 317
372 3300048922 Ga0496119_0082643 Ga0496119_0082643_555_1508 317
373 3300048924 Ga0496121_0005955 Ga0496121_0005955_6872_7825 317
374 3300048924 Ga0496121_0012774 Ga0496121_0012774_2778_3731 317
375 3300048924 Ga0496121_0012814 Ga0496121_0012814_6518_7504 317
376 3300048924 Ga0496121_0030454 Ga0496121_0030454_1005_1958 317
377 3300048924 Ga0496121_0044015 Ga0496121_0044015_2727_3680 317
378 3300048924 Ga0496121_0226616 Ga0496121_0226616_188_1141 317
379 3300048925 Ga0496122_0000924 Ga0496122_0000924_7766_8719 317
380 3300048925 Ga0496122_0002726 Ga0496122_0002726_16866_17819 317
381 3300048925 Ga0496122_0004619 Ga0496122_0004619_13857_14810 317
382 3300048925 Ga0496122_0010436 Ga0496122_0010436_1400_2353 317
383 3300048926 Ga0496123_0006115 Ga0496123_0006115_8680_9633 317
384 3300048926 Ga0496123_0014961 Ga0496123_0014961_1142_2095 317
385 3300048926 Ga0496123_0017388 Ga0496123_0017388_2139_3092 317
386 3300048926 Ga0496123_0070665 Ga0496123_0070665_627_1580 317
387 3300048927 Ga0496124_0005951 Ga0496124_0005951_12076_13029 317
388 3300048927 Ga0496124_0013628 Ga0496124_0013628_501_1454 317
389 3300048927 Ga0496124_0024647 Ga0496124_0024647_2512_3465 317
390 3300048927 Ga0496124_0043591 Ga0496124_0043591_1493_2446 317
391 3300048927 Ga0496124_0091034 Ga0496124_0091034_500_1453 317
392 3300048927 Ga0496124_0171510 Ga0496124_0171510_158_1114 317
393 3300048928 Ga0496125_0002848 Ga0496125_0002848_19224_20177 317
394 3300048928 Ga0496125_0018713 Ga0496125_0018713_4318_5271 317
395 3300048928 Ga0496125_0059731 Ga0496125_0059731_764_1720 317
396 3300048928 Ga0496125_0086467 Ga0496125_0086467_475_1428 317
397 3300048929 Ga0496126_0006874 Ga0496126_0006874_9244_10197 317
398 3300048929 Ga0496126_0047363 Ga0496126_0047363_1925_2878 317
399 3300048929 Ga0496126_0101464 Ga0496126_0101464_84_1070 317
400 3300048929 Ga0496126_0134008 Ga0496126_0134008_1071_2024 317
401 3300048929 Ga0496126_0137349 Ga0496126_0137349_1000_1968 317
402 3300050489 nmdc:mga03683_23427_c1 nmdc:mga03683_23427_c1_333_1319 317
403 3300050490 nmdc:mga03n38_39084_c1 nmdc:mga03n38_39084_c1_592_1578 317
404 3300050491 nmdc:mga00v17_79003_c1 nmdc:mga00v17_79003_c1_1047_2033 317
405 3300050492 nmdc:mga0yw44_193354_c1 nmdc:mga0yw44_193354_c1_182_1168 317
406 3300050494 nmdc:mga06z11_19464_c1 nmdc:mga06z11_19464_c1_614_1600 317
407 3300050494 nmdc:mga06z11_46538_c1 nmdc:mga06z11_46538_c1_829_1815 317
408 3300050496 nmdc:mga07m45_37758_c1 nmdc:mga07m45_37758_c1_1461_2447 317
409 3300053093 Ga0500651_0089032 Ga0500651_0089032_293_1246 317
410 3300053134 Ga0500658_0009702 Ga0500658_0009702_928_1881 317
411 3300053139 Ga0500568_0000479 Ga0500568_0000479_19973_20926 317
412 3300053151 Ga0500604_0014472 Ga0500604_0014472_978_1931 317
413 3300053156 Ga0500622_0000206 Ga0500622_0000206_43259_44212 317

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01882

DUF58

Protein of unknown function DUF58

47

132

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o4k-assembly1.cif.gz_6 yeast tfiih in the contracted state within the pre-initiation complex 0.6901 91 233
7n1o-assembly1.cif.gz_A the von willebrand factor a domain of human capillary morphogenesis gene ii, flexibly fused to the 1tel crystallization chaperone 0.6891 91 233
4ag5-assembly1.cif.gz_D structure of virb4 of thermoanaerobacter pseudethanolicus 0.6742 181 231
6erh-assembly1.cif.gz_A complex of xlf and heterodimer ku bound to dna 0.6728 91 235
5oqm-assembly1.cif.gz_6 structure of yeast transcription pre-initiation complex with tfiih and core mediator 0.6678 92 233
ID Description Score Start End Superfamily
af_P9WLX5_142_317_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8093 142 308 3.40.50.410
af_P9WLX5_142_317_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7446 142 308 3.40.50.410
af_A0A1D8PSH5_1_191_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.724 91 233 3.40.50.410
af_Q3LFM3_147_462_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.6526 91 234 3.40.50.410
af_G5ECR0_1_1119_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.6436 91 231 3.40.50.410
ID Description Score Start End GO Terms
AF-A0A1H5VTN7-F1-model_v4 DUF58 domain-containing protein 0.9534 96 308
AF-A0A1H5VTN7-F1-model_v4 DUF58 domain-containing protein 0.9279 96 308
AF-A0A2A4XXQ5-F1-model_v4 deleted 0.9233 90 303
AF-A0A1X7MHD6-F1-model_v4 deleted 0.9171 184 304
AF-A0A090T0D0-F1-model_v4 DUF58 domain-containing protein 0.8837 90 307

Feature Viewer

pLDDT pTM Quality
77.53 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map