F437995

General Info

Members Datasets Scaffolds Average Seq Length
413 172 826 194

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100431421|Ga0070713_1004314212
Length 223
Sequence MQWRRSTASIRMEIACSWSRTVAAIYWAWIMATQVVPRQLSIQDFVSELHKFPEAAFVATDEILAFLQRSIVDSTSLAPYLNWDRQHYTRNLIDKTALYDLIAICWEVGQVSSVHNHRDQNCWMAVTIGRLQVENFHLASQDLEHGVCKLTPTDTVEMNPTHPCAVDPRDPVHRVVNPKQFGERAVSLHIYSHPFDTCVVYSPEQGTCGVIKLHYTTVLGKPV

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
85 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
134 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
138 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
145 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
146 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
171 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.39
Rhizosphere 95.88
Stem 0
Stem Tuber 0
Unclassified 22.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100431421 3300005436 Bacteria 1235
2 rootH2_10328199 3300003320 Unclassified 1318
3 Ga0065712_10151592 3300005290 Unclassified 1365
4 Ga0065715_10185924 3300005293 Unclassified 1430
5 Ga0070676_10075347 3300005328 Bacteria 2034
6 Ga0070683_100025000 3300005329 Bacteria 5357
7 Ga0070683_100037851 3300005329 Bacteria 4418
8 Ga0070670_100001229 3300005331 Bacteria 20368
9 Ga0070670_100266114 3300005331 Unclassified 1495
10 Ga0068869_100017126 3300005334 Bacteria 4905
11 Ga0070680_100233178 3300005336 Bacteria 1555
12 Ga0070682_100085862 3300005337 Bacteria 2048
13 Ga0068868_100005981 3300005338 Bacteria 8588
14 Ga0068868_100015495 3300005338 Bacteria 5640
15 Ga0068868_100170907 3300005338 Unclassified 1799
16 Ga0068868_100271946 3300005338 Bacteria 1432
17 Ga0068868_100638203 3300005338 Bacteria 947
18 Ga0070660_100239571 3300005339 Unclassified 1477
19 Ga0070660_100599170 3300005339 Unclassified 921
20 Ga0070660_100747061 3300005339 Bacteria 821
21 Ga0070661_100010435 3300005344 Bacteria 6460
22 Ga0070661_100371370 3300005344 Unclassified 1126
23 Ga0070668_101081242 3300005347 Unclassified 723
24 Ga0070669_100818015 3300005353 Unclassified 792
25 Ga0070675_100623081 3300005354 Bacteria 979
26 Ga0070671_100131165 3300005355 Unclassified 2111
27 Ga0070671_100330532 3300005355 Bacteria 1299
28 Ga0070673_100021706 3300005364 Bacteria 4662
29 Ga0070673_100545700 3300005364 Bacteria 1053
30 Ga0070673_100789131 3300005364 Unclassified 876
31 Ga0070709_10277447 3300005434 Unclassified 1217
32 Ga0070714_100000654 3300005435 Bacteria 24583
33 Ga0070714_100061088 3300005435 Bacteria 3236
34 Ga0070714_100421818 3300005435 Bacteria 1264
35 Ga0070714_100591502 3300005435 Unclassified 1065
36 Ga0070714_100598537 3300005435 Unclassified 1059
37 Ga0070713_100006786 3300005436 Bacteria 7977
38 Ga0070713_100027603 3300005436 Unclassified 4471
39 Ga0070713_100041605 3300005436 Bacteria 3745
40 Ga0070713_100045149 3300005436 Bacteria 3609
41 Ga0070713_100066189 3300005436 Bacteria 3038
42 Ga0070713_100271520 3300005436 Bacteria 1553
43 Ga0070710_10003991 3300005437 Bacteria 6995
44 Ga0070710_10250139 3300005437 Unclassified 1139
45 Ga0070711_100011952 3300005439 Bacteria 5406
46 Ga0070711_100017129 3300005439 Bacteria 4609
47 Ga0070711_100049044 3300005439 Bacteria 2890
48 Ga0070711_100098781 3300005439 Bacteria 2120
49 Ga0070711_100633016 3300005439 Unclassified 895
50 Ga0070694_100285250 3300005444 Bacteria 1260
51 Ga0070708_100002117 3300005445 Bacteria 15325
52 Ga0070708_100019414 3300005445 Bacteria 5711
53 Ga0070708_100038007 3300005445 Bacteria 4202
54 Ga0070708_100071731 3300005445 Bacteria 3119
55 Ga0070678_100348857 3300005456 Bacteria 1272
56 Ga0070678_100380085 3300005456 Bacteria 1222
57 Ga0070681_10000242 3300005458 Bacteria 43180
58 Ga0070681_10150688 3300005458 Bacteria 2252
59 Ga0070681_10702331 3300005458 Bacteria 927
60 Ga0068867_100024941 3300005459 Bacteria 4287
61 Ga0070685_10290325 3300005466 Bacteria 1098
62 Ga0070706_100330783 3300005467 Unclassified 1421
63 Ga0070706_100523399 3300005467 Bacteria 1103
64 Ga0070707_100021783 3300005468 Bacteria 6057
65 Ga0070707_100586053 3300005468 Unclassified 1077
66 Ga0070698_100000640 3300005471 Bacteria 37599
67 Ga0070699_100024061 3300005518 Bacteria 5249
68 Ga0070679_100020650 3300005530 Bacteria 6423
69 Ga0070679_100166694 3300005530 Bacteria 2176
70 Ga0070679_100307702 3300005530 Unclassified 1535
71 Ga0070684_100013202 3300005535 Bacteria 6651
72 Ga0070684_100017648 3300005535 Bacteria 5864
73 Ga0070684_100081892 3300005535 Bacteria 2857
74 Ga0070684_100488403 3300005535 Unclassified 1140
75 Ga0070697_100000266 3300005536 Bacteria 42492
76 Ga0070697_100001096 3300005536 Bacteria 20472
77 Ga0070697_100051126 3300005536 Bacteria 3357
78 Ga0068853_100378407 3300005539 Bacteria 1322
79 Ga0070672_100259447 3300005543 Bacteria 1465
80 Ga0070696_100874324 3300005546 Bacteria 744
81 Ga0070693_100046043 3300005547 Unclassified 2475
82 Ga0070704_100725273 3300005549 Bacteria 883
83 Ga0068855_100000722 3300005563 Bacteria 40559
84 Ga0068855_100001560 3300005563 Bacteria 28791
85 Ga0068855_100004114 3300005563 Bacteria 17736
86 Ga0068855_100431809 3300005563 Unclassified 1440
87 Ga0068855_100578318 3300005563 Unclassified 1213
88 Ga0070664_100001762 3300005564 Bacteria 17341
89 Ga0070664_100080025 3300005564 Bacteria 2814
90 Ga0070664_100113703 3300005564 Unclassified 2364
91 Ga0070664_100157344 3300005564 Bacteria 2008
92 Ga0070664_100236922 3300005564 Bacteria 1637
93 Ga0068857_100000538 3300005577 Bacteria 27467
94 Ga0068857_100006262 3300005577 Bacteria 10177
95 Ga0068857_100043313 3300005577 Bacteria 3993
96 Ga0068857_100450422 3300005577 Bacteria 1203
97 Ga0068854_100003457 3300005578 Bacteria 9859
98 Ga0068854_100009800 3300005578 Bacteria 6194
99 Ga0068854_100031483 3300005578 Bacteria 3687
100 Ga0068854_100075251 3300005578 Bacteria 2479
101 Ga0068854_100162926 3300005578 Unclassified 1729
102 Ga0068854_100327096 3300005578 Unclassified 1248
103 Ga0068856_100000618 3300005614 Bacteria 38933
104 Ga0068856_100000893 3300005614 Bacteria 31927
105 Ga0068856_100008387 3300005614 Bacteria 10069
106 Ga0068856_100092686 3300005614 Bacteria 3006
107 Ga0068856_100102323 3300005614 Bacteria 2858
108 Ga0068856_100155408 3300005614 Unclassified 2297
109 Ga0068856_100202982 3300005614 Unclassified 1997
110 Ga0068856_100256292 3300005614 Bacteria 1764
111 Ga0068852_100460130 3300005616 Bacteria 1261
112 Ga0068852_100621138 3300005616 Bacteria 1086
113 Ga0068859_100011177 3300005617 Bacteria 9027
114 Ga0068864_100029695 3300005618 Bacteria 4633
115 Ga0068864_100070749 3300005618 Bacteria 3036
116 Ga0068864_100443170 3300005618 Unclassified 1241
117 Ga0068866_10029020 3300005718 Bacteria 2641
118 Ga0068866_10337562 3300005718 Bacteria 953
119 Ga0068851_10062076 3300005834 Unclassified 1917
120 Ga0068863_100003401 3300005841 Bacteria 15702
121 Ga0068863_100042291 3300005841 Bacteria 4330
122 Ga0068863_100117532 3300005841 Bacteria 2534
123 Ga0068863_100380907 3300005841 Bacteria 1377
124 Ga0068863_101571908 3300005841 Unclassified 667
125 Ga0068858_100007668 3300005842 Bacteria 10428
126 Ga0068858_100063250 3300005842 Bacteria 3424
127 Ga0068860_100146984 3300005843 Bacteria 2268
128 Ga0068860_101264898 3300005843 Bacteria 758
129 Ga0070717_10015883 3300006028 Bacteria 5824
130 Ga0070717_10021626 3300006028 Bacteria 5072
131 Ga0070717_10042615 3300006028 Bacteria 3702
132 Ga0070717_10045736 3300006028 Bacteria 3579
133 Ga0070717_10055855 3300006028 Bacteria 3259
134 Ga0070717_10064566 3300006028 Unclassified 3041
135 Ga0070717_10438048 3300006028 Bacteria 1177
136 Ga0070717_10500877 3300006028 Bacteria 1098
137 Ga0070715_10119755 3300006163 Unclassified 1253
138 Ga0070716_100000789 3300006173 Bacteria 13606
139 Ga0070716_100036568 3300006173 Bacteria 2708
140 Ga0070716_100055532 3300006173 Unclassified 2267
141 Ga0070716_100131580 3300006173 Bacteria 1582
142 Ga0070712_100109493 3300006175 Bacteria 2059
143 Ga0070712_100651172 3300006175 Unclassified 895
144 Ga0070712_100817330 3300006175 Unclassified 800
145 Ga0097621_100000058 3300006237 Bacteria 58363
146 Ga0097621_100000214 3300006237 Bacteria 38208
147 Ga0097621_100030367 3300006237 Bacteria 4277
148 Ga0097621_100059933 3300006237 Unclassified 3118
149 Ga0068871_100000167 3300006358 Bacteria 43972
150 Ga0068871_100003579 3300006358 Bacteria 10677
151 Ga0068871_100030033 3300006358 Unclassified 4276
152 Ga0068871_100071348 3300006358 Bacteria 2856
153 Ga0075433_10014761 3300006852 Bacteria 6393
154 Ga0075434_100004944 3300006871 Bacteria 12086
155 Ga0075434_100010007 3300006871 Bacteria 8876
156 Ga0068865_100005531 3300006881 Bacteria 7665
157 Ga0068865_100007090 3300006881 Bacteria 6881
158 Ga0075436_100220376 3300006914 Bacteria 1346
159 Ga0075436_100458192 3300006914 Bacteria 929
160 Ga0097620_100011177 3300006931 Bacteria 9027
161 Ga0075435_100039805 3300007076 Bacteria 3752
162 Ga0075435_100152590 3300007076 Unclassified 1943
163 Ga0105240_10021300 3300009093 Bacteria 8623
164 Ga0105240_10122142 3300009093 Bacteria 3135
165 Ga0105240_10123526 3300009093 Unclassified 3114
166 Ga0105240_10280979 3300009093 Bacteria 1912
167 Ga0105245_10135157 3300009098 Bacteria 2317
168 Ga0105241_10063044 3300009174 Bacteria 2859
169 Ga0105241_10065573 3300009174 Bacteria 2806
170 Ga0105241_10098075 3300009174 Bacteria 2325
171 Ga0105241_10503277 3300009174 Bacteria 1081
172 Ga0105241_10656766 3300009174 Unclassified 953
173 Ga0105248_10059490 3300009177 Bacteria 4292
174 Ga0105237_10031384 3300009545 Bacteria 5388
175 Ga0105237_10091744 3300009545 Bacteria 3027
176 Ga0105237_10109165 3300009545 Unclassified 2758
177 Ga0105237_10204584 3300009545 Bacteria 1974
178 Ga0105237_10215172 3300009545 Bacteria 1921
179 Ga0105237_10422268 3300009545 Bacteria 1339
180 Ga0105238_10000552 3300009551 Bacteria 39122
181 Ga0105238_10023473 3300009551 Bacteria 6286
182 Ga0105238_10173673 3300009551 Bacteria 2131
183 Ga0105238_10581630 3300009551 Bacteria 1126
184 Ga0105238_10863647 3300009551 Bacteria 922
185 Ga0105238_10934078 3300009551 Bacteria 887
186 Ga0105239_10268239 3300010375 Bacteria 1919
187 Ga0105239_10338979 3300010375 Bacteria 1696
188 Ga0105246_10083568 3300011119 Bacteria 2282
189 Ga0157373_10000659 3300013100 Bacteria 27128
190 Ga0157373_10084789 3300013100 Bacteria 2233
191 Ga0157373_10136503 3300013100 Bacteria 1725
192 Ga0157373_10654591 3300013100 Unclassified 767
193 Ga0157371_10027632 3300013102 Bacteria 4114
194 Ga0157371_10049784 3300013102 Bacteria 2976
195 Ga0157371_10191844 3300013102 Bacteria 1463
196 Ga0157371_10316590 3300013102 Unclassified 1132
197 Ga0157370_10049849 3300013104 Bacteria 4005
198 Ga0157370_10105030 3300013104 Bacteria 2644
199 Ga0157370_10784094 3300013104 Unclassified 868
200 Ga0157369_10000592 3300013105 Bacteria 47171
201 Ga0157369_10041352 3300013105 Bacteria 5031
202 Ga0157369_10114559 3300013105 Bacteria 2863
203 Ga0157369_10369346 3300013105 Unclassified 1489
204 Ga0157369_11319406 3300013105 Unclassified 735
205 Ga0157374_10000181 3300013296 Bacteria 58388
206 Ga0157374_10000441 3300013296 Bacteria 37640
207 Ga0157374_10009929 3300013296 Bacteria 8173
208 Ga0157374_10062920 3300013296 Bacteria 3479
209 Ga0157374_10148620 3300013296 Unclassified 2277
210 Ga0157374_10159539 3300013296 Bacteria 2196
211 Ga0157378_10000680 3300013297 Bacteria 31989
212 Ga0157378_10000980 3300013297 Bacteria 26121
213 Ga0157378_10100818 3300013297 Bacteria 2637
214 Ga0163162_10148506 3300013306 Bacteria 2461
215 Ga0157372_10000685 3300013307 Bacteria 37210
216 Ga0157372_10003362 3300013307 Bacteria 17262
217 Ga0157372_10005129 3300013307 Bacteria 13922
218 Ga0157372_10019503 3300013307 Bacteria 7312
219 Ga0157372_10093486 3300013307 Bacteria 3422
220 Ga0157372_10119641 3300013307 Bacteria 3024
221 Ga0157372_10139700 3300013307 Unclassified 2790
222 Ga0157372_10204265 3300013307 Bacteria 2289
223 Ga0157372_10287235 3300013307 Unclassified 1913
224 Ga0163163_10067026 3300014325 Bacteria 3567
225 Ga0163163_10456439 3300014325 Unclassified 1338
226 Ga0157376_10005601 3300014969 Bacteria 8785
227 Ga0157376_10010065 3300014969 Bacteria 6905
228 Ga0157376_10205448 3300014969 Bacteria 1815
229 Ga0182006_1076902 3300015261 Unclassified 1225
230 Ga0182005_1012608 3300015265 Bacteria 2385
231 Ga0207692_10009928 3300025898 Bacteria 3992
232 Ga0207692_10215734 3300025898 Unclassified 1135
233 Ga0207642_10158080 3300025899 Bacteria 1214
234 Ga0207642_10176917 3300025899 Bacteria 1159
235 Ga0207647_10065984 3300025904 Bacteria 2196
236 Ga0207647_10107950 3300025904 Bacteria 1647
237 Ga0207699_10280028 3300025906 Unclassified 1159
238 Ga0207684_10163429 3300025910 Bacteria 1918
239 Ga0207654_10043351 3300025911 Unclassified 2550
240 Ga0207654_10168159 3300025911 Bacteria 1422
241 Ga0207654_10187221 3300025911 Bacteria 1354
242 Ga0207654_10381962 3300025911 Bacteria 976
243 Ga0207707_10037901 3300025912 Bacteria 4212
244 Ga0207707_10110888 3300025912 Bacteria 2398
245 Ga0207695_10006402 3300025913 Bacteria 15296
246 Ga0207695_10111237 3300025913 Bacteria 2718
247 Ga0207695_10183990 3300025913 Unclassified 2009
248 Ga0207695_10381162 3300025913 Unclassified 1296
249 Ga0207671_10046184 3300025914 Unclassified 3222
250 Ga0207671_10114467 3300025914 Bacteria 2056
251 Ga0207671_10218786 3300025914 Bacteria 1492
252 Ga0207693_10019250 3300025915 Bacteria 5432
253 Ga0207693_10164487 3300025915 Bacteria 1746
254 Ga0207693_10407466 3300025915 Unclassified 1063
255 Ga0207663_10065182 3300025916 Bacteria 2327
256 Ga0207663_10428190 3300025916 Unclassified 1017
257 Ga0207660_10244970 3300025917 Bacteria 1413
258 Ga0207657_10012664 3300025919 Bacteria 8313
259 Ga0207649_10006762 3300025920 Bacteria 6230
260 Ga0207649_10128151 3300025920 Unclassified 1720
261 Ga0207649_10142248 3300025920 Bacteria 1643
262 Ga0207652_10055703 3300025921 Bacteria 3402
263 Ga0207652_10153420 3300025921 Unclassified 2063
264 Ga0207652_10180090 3300025921 Unclassified 1899
265 Ga0207646_10019517 3300025922 Bacteria 6299
266 Ga0207646_10164784 3300025922 Bacteria 2001
267 Ga0207681_10784061 3300025923 Bacteria 796
268 Ga0207694_10177154 3300025924 Bacteria 1728
269 Ga0207650_10060781 3300025925 Bacteria 2820
270 Ga0207650_10294687 3300025925 Bacteria 1324
271 Ga0207700_10052296 3300025928 Bacteria 3053
272 Ga0207700_10181288 3300025928 Unclassified 1763
273 Ga0207700_10231286 3300025928 Bacteria 1572
274 Ga0207700_10430208 3300025928 Bacteria 1161
275 Ga0207664_10018975 3300025929 Bacteria 5074
276 Ga0207664_10034502 3300025929 Bacteria 3897
277 Ga0207664_10119659 3300025929 Bacteria 2202
278 Ga0207664_10414869 3300025929 Bacteria 1199
279 Ga0207664_10587775 3300025929 Unclassified 1000
280 Ga0207664_11187735 3300025929 Unclassified 681
281 Ga0207644_10481528 3300025931 Unclassified 1022
282 Ga0207706_10064089 3300025933 Unclassified 3236
283 Ga0207706_10502822 3300025933 Bacteria 1046
284 Ga0207704_10010594 3300025938 Bacteria 4503
285 Ga0207704_10656874 3300025938 Bacteria 864
286 Ga0207665_10000394 3300025939 Bacteria 29974
287 Ga0207665_10099103 3300025939 Bacteria 2032
288 Ga0207665_10120956 3300025939 Bacteria 1849
289 Ga0207665_10131566 3300025939 Bacteria 1777
290 Ga0207665_10208060 3300025939 Bacteria 1428
291 Ga0207665_10312278 3300025939 Unclassified 1178
292 Ga0207691_10414797 3300025940 Bacteria 1148
293 Ga0207711_10016250 3300025941 Bacteria 6181
294 Ga0207689_10047307 3300025942 Bacteria 3553
295 Ga0207661_10016752 3300025944 Bacteria 5411
296 Ga0207661_10033482 3300025944 Bacteria 3989
297 Ga0207661_10059024 3300025944 Bacteria 3090
298 Ga0207679_10001101 3300025945 Bacteria 17213
299 Ga0207679_10067267 3300025945 Unclassified 2688
300 Ga0207679_10377211 3300025945 Bacteria 1242
301 Ga0207679_10464172 3300025945 Bacteria 1125
302 Ga0207667_10005570 3300025949 Bacteria 15370
303 Ga0207667_10007905 3300025949 Bacteria 12698
304 Ga0207667_10021181 3300025949 Bacteria 7208
305 Ga0207667_10125798 3300025949 Unclassified 2640
306 Ga0207667_10207222 3300025949 Unclassified 2010
307 Ga0207667_10332877 3300025949 Bacteria 1550
308 Ga0207667_10560004 3300025949 Bacteria 1155
309 Ga0207651_10125894 3300025960 Bacteria 1952
310 Ga0207651_11038111 3300025960 Unclassified 733
311 Ga0207640_10104494 3300025981 Bacteria 1994
312 Ga0207640_10414099 3300025981 Unclassified 1101
313 Ga0207677_10005164 3300026023 Bacteria 7066
314 Ga0207677_10011560 3300026023 Bacteria 5039
315 Ga0207677_10114055 3300026023 Bacteria 2018
316 Ga0207703_10003085 3300026035 Bacteria 14092
317 Ga0207703_10047962 3300026035 Bacteria 3445
318 Ga0207703_10064182 3300026035 Bacteria 3013
319 Ga0207639_10166756 3300026041 Bacteria 1861
320 Ga0207702_10000962 3300026078 Bacteria 29642
321 Ga0207702_10003902 3300026078 Bacteria 13422
322 Ga0207702_10005623 3300026078 Bacteria 10934
323 Ga0207702_10018797 3300026078 Bacteria 5715
324 Ga0207702_10158715 3300026078 Unclassified 2064
325 Ga0207702_10400320 3300026078 Bacteria 1324
326 Ga0207641_10002104 3300026088 Bacteria 18817
327 Ga0207641_10041566 3300026088 Bacteria 3853
328 Ga0207641_10084675 3300026088 Unclassified 2761
329 Ga0207641_10418840 3300026088 Bacteria 1289
330 Ga0207648_10005882 3300026089 Bacteria 12274
331 Ga0207676_10022265 3300026095 Bacteria 4659
332 Ga0207676_10030739 3300026095 Bacteria 4034
333 Ga0207676_10095615 3300026095 Bacteria 2450
334 Ga0207674_10000867 3300026116 Bacteria 39599
335 Ga0207674_10013153 3300026116 Bacteria 9210
336 Ga0207674_10044268 3300026116 Bacteria 4584
337 Ga0207674_10683604 3300026116 Bacteria 991
338 Ga0207683_10418679 3300026121 Bacteria 1234
339 Ga0207698_10324875 3300026142 Bacteria 1443
340 Ga0268264_10063800 3300028381 Bacteria 3098
341 Ga0268264_11098928 3300028381 Bacteria 803
342 Ga0265338_10075110 3300028800 Bacteria 2870
343 Ga0265770_1020038 3300030878 Unclassified 1054
344 Ga0265760_10001349 3300031090 Bacteria 7203
345 Ga0265760_10018600 3300031090 Unclassified 2001
346 Ga0373926_0003307 3300035083 Bacteria 5181
347 Ga0373936_0013961 3300035113 Bacteria 3068
348 Ga0373945_0196227 3300035116 Unclassified 836
349 Ga0373943_0008158 3300035170 Bacteria 4700
350 Ga0373943_0060672 3300035170 Bacteria 1888
351 Ga0373943_0445703 3300035170 Unclassified 752
352 Ga0373946_0077872 3300035171 Bacteria 1446
353 Ga0373955_0038440 3300035172 Bacteria 2550
354 Ga0373931_0016550 3300035691 Bacteria 3632
355 Ga0373927_0031982 3300035695 Bacteria 3427
356 Ga0373927_0033314 3300035695 Bacteria 3355
357 Ga0373927_0050597 3300035695 Bacteria 2687
358 Ga0373947_0003476 3300035725 Bacteria 9313
359 Ga0373937_0773952 3300036401 Unclassified 907
360 Ga0373925_0000640 3300037068 Bacteria 32919
361 Ga0373925_0005489 3300037068 Bacteria 9437
362 Ga0373925_0198073 3300037068 Bacteria 1596
363 Ga0373925_0311435 3300037068 Bacteria 1273
364 Ga0436364_1497996 3300037853 Bacteria 1785
365 Ga0436360_0212086 3300039438 Bacteria 1085
366 Ga0436363_0512353 3300039450 Unclassified 1009
367 Ga0466963_0193543 3300044694 Bacteria 1421
368 Ga0453684_0887654 3300044712 Unclassified 956
369 Ga0466970_0370948 3300044765 Bacteria 814
370 Ga0466959_0168651 3300045049 Bacteria 1536
371 Ga0451576_0512503 3300045051 Bacteria 1260
372 Ga0466967_0030059 3300045976 Bacteria 4554
373 Ga0466967_0097512 3300045976 Bacteria 2683
374 Ga0466967_0343550 3300045976 Bacteria 1444
375 Ga0495580_0000050 3300046472 Bacteria 68142
376 Ga0495580_0000646 3300046472 Bacteria 29584
377 Ga0495580_0029552 3300046472 Bacteria 3976
378 Ga0495580_0039012 3300046472 Bacteria 3398
379 Ga0495580_0128742 3300046472 Bacteria 1756
380 Ga0495580_0369920 3300046472 Unclassified 969
381 Ga0495582_0000070 3300046473 Bacteria 51509
382 Ga0495666_0025627 3300046526 Bacteria 2912
383 Ga0495665_0001083 3300046531 Bacteria 14388
384 Ga0495665_0080284 3300046531 Bacteria 1716
385 Ga0495665_0177104 3300046531 Unclassified 1109
386 Ga0495669_0010300 3300046684 Bacteria 3951
387 Ga0495669_0111291 3300046684 Bacteria 1278
388 Ga0495581_0006950 3300047315 Bacteria 6554
389 Ga0495581_0007293 3300047315 Bacteria 6398
390 Ga0495581_0187618 3300047315 Bacteria 1209
391 Ga0495593_0157350 3300047673 Bacteria 1148
392 Ga0495602_0017207 3300048088 Bacteria 7249
393 Ga0496101_0065694 3300048904 Unclassified 2645
394 Ga0496103_0085207 3300048906 Unclassified 1991
395 Ga0496104_0257787 3300048907 Bacteria 1657
396 Ga0496104_0471921 3300048907 Bacteria 1166
397 Ga0496108_0105147 3300048911 Unclassified 2410
398 Ga0496108_0158743 3300048911 Bacteria 1954
399 Ga0496110_0015779 3300048913 Bacteria 6297
400 Ga0496111_0048471 3300048914 Unclassified 3060
401 Ga0496112_0002776 3300048915 Bacteria 14204
402 Ga0496112_0003332 3300048915 Bacteria 13257
403 Ga0496112_0127464 3300048915 Bacteria 2516
404 Ga0496112_0256977 3300048915 Unclassified 1697
405 Ga0496112_0420688 3300048915 Bacteria 1275
406 Ga0496113_0142093 3300048916 Unclassified 1889
407 nmdc:mga0n895_18347_c1 3300050512 Bacteria 6471
408 nmdc:mga0n895_4256_c1 3300050512 Bacteria 11707
409 nmdc:mga0rr50_281656_c1 3300050513 Unclassified 1387
410 nmdc:mga0rr50_7707_c1 3300050513 Bacteria 6667
411 nmdc:mga08x19_490296_c1 3300050514 Bacteria 867
412 nmdc:mga0a205_15604_c1 3300050515 Bacteria 7099
413 nmdc:mga0a205_252653_c1 3300050515 Bacteria 1642
414 Ga0070713_100431421
415 rootH2_10328199
416 Ga0065712_10151592
417 Ga0065715_10185924
418 Ga0070676_10075347
419 Ga0070683_100025000
420 Ga0070683_100037851
421 Ga0070670_100001229
422 Ga0070670_100266114
423 Ga0068869_100017126
424 Ga0070680_100233178
425 Ga0070682_100085862
426 Ga0068868_100005981
427 Ga0068868_100015495
428 Ga0068868_100170907
429 Ga0068868_100271946
430 Ga0068868_100638203
431 Ga0070660_100239571
432 Ga0070660_100599170
433 Ga0070660_100747061
434 Ga0070661_100010435
435 Ga0070661_100371370
436 Ga0070668_101081242
437 Ga0070669_100818015
438 Ga0070675_100623081
439 Ga0070671_100131165
440 Ga0070671_100330532
441 Ga0070673_100021706
442 Ga0070673_100545700
443 Ga0070673_100789131
444 Ga0070709_10277447
445 Ga0070714_100000654
446 Ga0070714_100061088
447 Ga0070714_100421818
448 Ga0070714_100591502
449 Ga0070714_100598537
450 Ga0070713_100006786
451 Ga0070713_100027603
452 Ga0070713_100041605
453 Ga0070713_100045149
454 Ga0070713_100066189
455 Ga0070713_100271520
456 Ga0070710_10003991
457 Ga0070710_10250139
458 Ga0070711_100011952
459 Ga0070711_100017129
460 Ga0070711_100049044
461 Ga0070711_100098781
462 Ga0070711_100633016
463 Ga0070694_100285250
464 Ga0070708_100002117
465 Ga0070708_100019414
466 Ga0070708_100038007
467 Ga0070708_100071731
468 Ga0070678_100348857
469 Ga0070678_100380085
470 Ga0070681_10000242
471 Ga0070681_10150688
472 Ga0070681_10702331
473 Ga0068867_100024941
474 Ga0070685_10290325
475 Ga0070706_100330783
476 Ga0070706_100523399
477 Ga0070707_100021783
478 Ga0070707_100586053
479 Ga0070698_100000640
480 Ga0070699_100024061
481 Ga0070679_100020650
482 Ga0070679_100166694
483 Ga0070679_100307702
484 Ga0070684_100013202
485 Ga0070684_100017648
486 Ga0070684_100081892
487 Ga0070684_100488403
488 Ga0070697_100000266
489 Ga0070697_100001096
490 Ga0070697_100051126
491 Ga0068853_100378407
492 Ga0070672_100259447
493 Ga0070696_100874324
494 Ga0070693_100046043
495 Ga0070704_100725273
496 Ga0068855_100000722
497 Ga0068855_100001560
498 Ga0068855_100004114
499 Ga0068855_100431809
500 Ga0068855_100578318
501 Ga0070664_100001762
502 Ga0070664_100080025
503 Ga0070664_100113703
504 Ga0070664_100157344
505 Ga0070664_100236922
506 Ga0068857_100000538
507 Ga0068857_100006262
508 Ga0068857_100043313
509 Ga0068857_100450422
510 Ga0068854_100003457
511 Ga0068854_100009800
512 Ga0068854_100031483
513 Ga0068854_100075251
514 Ga0068854_100162926
515 Ga0068854_100327096
516 Ga0068856_100000618
517 Ga0068856_100000893
518 Ga0068856_100008387
519 Ga0068856_100092686
520 Ga0068856_100102323
521 Ga0068856_100155408
522 Ga0068856_100202982
523 Ga0068856_100256292
524 Ga0068852_100460130
525 Ga0068852_100621138
526 Ga0068859_100011177
527 Ga0068864_100029695
528 Ga0068864_100070749
529 Ga0068864_100443170
530 Ga0068866_10029020
531 Ga0068866_10337562
532 Ga0068851_10062076
533 Ga0068863_100003401
534 Ga0068863_100042291
535 Ga0068863_100117532
536 Ga0068863_100380907
537 Ga0068863_101571908
538 Ga0068858_100007668
539 Ga0068858_100063250
540 Ga0068860_100146984
541 Ga0068860_101264898
542 Ga0070717_10015883
543 Ga0070717_10021626
544 Ga0070717_10042615
545 Ga0070717_10045736
546 Ga0070717_10055855
547 Ga0070717_10064566
548 Ga0070717_10438048
549 Ga0070717_10500877
550 Ga0070715_10119755
551 Ga0070716_100000789
552 Ga0070716_100036568
553 Ga0070716_100055532
554 Ga0070716_100131580
555 Ga0070712_100109493
556 Ga0070712_100651172
557 Ga0070712_100817330
558 Ga0097621_100000058
559 Ga0097621_100000214
560 Ga0097621_100030367
561 Ga0097621_100059933
562 Ga0068871_100000167
563 Ga0068871_100003579
564 Ga0068871_100030033
565 Ga0068871_100071348
566 Ga0075433_10014761
567 Ga0075434_100004944
568 Ga0075434_100010007
569 Ga0068865_100005531
570 Ga0068865_100007090
571 Ga0075436_100220376
572 Ga0075436_100458192
573 Ga0097620_100011177
574 Ga0075435_100039805
575 Ga0075435_100152590
576 Ga0105240_10021300
577 Ga0105240_10122142
578 Ga0105240_10123526
579 Ga0105240_10280979
580 Ga0105245_10135157
581 Ga0105241_10063044
582 Ga0105241_10065573
583 Ga0105241_10098075
584 Ga0105241_10503277
585 Ga0105241_10656766
586 Ga0105248_10059490
587 Ga0105237_10031384
588 Ga0105237_10091744
589 Ga0105237_10109165
590 Ga0105237_10204584
591 Ga0105237_10215172
592 Ga0105237_10422268
593 Ga0105238_10000552
594 Ga0105238_10023473
595 Ga0105238_10173673
596 Ga0105238_10581630
597 Ga0105238_10863647
598 Ga0105238_10934078
599 Ga0105239_10268239
600 Ga0105239_10338979
601 Ga0105246_10083568
602 Ga0157373_10000659
603 Ga0157373_10084789
604 Ga0157373_10136503
605 Ga0157373_10654591
606 Ga0157371_10027632
607 Ga0157371_10049784
608 Ga0157371_10191844
609 Ga0157371_10316590
610 Ga0157370_10049849
611 Ga0157370_10105030
612 Ga0157370_10784094
613 Ga0157369_10000592
614 Ga0157369_10041352
615 Ga0157369_10114559
616 Ga0157369_10369346
617 Ga0157369_11319406
618 Ga0157374_10000181
619 Ga0157374_10000441
620 Ga0157374_10009929
621 Ga0157374_10062920
622 Ga0157374_10148620
623 Ga0157374_10159539
624 Ga0157378_10000680
625 Ga0157378_10000980
626 Ga0157378_10100818
627 Ga0163162_10148506
628 Ga0157372_10000685
629 Ga0157372_10003362
630 Ga0157372_10005129
631 Ga0157372_10019503
632 Ga0157372_10093486
633 Ga0157372_10119641
634 Ga0157372_10139700
635 Ga0157372_10204265
636 Ga0157372_10287235
637 Ga0163163_10067026
638 Ga0163163_10456439
639 Ga0157376_10005601
640 Ga0157376_10010065
641 Ga0157376_10205448
642 Ga0182006_1076902
643 Ga0182005_1012608
644 Ga0207692_10009928
645 Ga0207692_10215734
646 Ga0207642_10158080
647 Ga0207642_10176917
648 Ga0207647_10065984
649 Ga0207647_10107950
650 Ga0207699_10280028
651 Ga0207684_10163429
652 Ga0207654_10043351
653 Ga0207654_10168159
654 Ga0207654_10187221
655 Ga0207654_10381962
656 Ga0207707_10037901
657 Ga0207707_10110888
658 Ga0207695_10006402
659 Ga0207695_10111237
660 Ga0207695_10183990
661 Ga0207695_10381162
662 Ga0207671_10046184
663 Ga0207671_10114467
664 Ga0207671_10218786
665 Ga0207693_10019250
666 Ga0207693_10164487
667 Ga0207693_10407466
668 Ga0207663_10065182
669 Ga0207663_10428190
670 Ga0207660_10244970
671 Ga0207657_10012664
672 Ga0207649_10006762
673 Ga0207649_10128151
674 Ga0207649_10142248
675 Ga0207652_10055703
676 Ga0207652_10153420
677 Ga0207652_10180090
678 Ga0207646_10019517
679 Ga0207646_10164784
680 Ga0207681_10784061
681 Ga0207694_10177154
682 Ga0207650_10060781
683 Ga0207650_10294687
684 Ga0207700_10052296
685 Ga0207700_10181288
686 Ga0207700_10231286
687 Ga0207700_10430208
688 Ga0207664_10018975
689 Ga0207664_10034502
690 Ga0207664_10119659
691 Ga0207664_10414869
692 Ga0207664_10587775
693 Ga0207664_11187735
694 Ga0207644_10481528
695 Ga0207706_10064089
696 Ga0207706_10502822
697 Ga0207704_10010594
698 Ga0207704_10656874
699 Ga0207665_10000394
700 Ga0207665_10099103
701 Ga0207665_10120956
702 Ga0207665_10131566
703 Ga0207665_10208060
704 Ga0207665_10312278
705 Ga0207691_10414797
706 Ga0207711_10016250
707 Ga0207689_10047307
708 Ga0207661_10016752
709 Ga0207661_10033482
710 Ga0207661_10059024
711 Ga0207679_10001101
712 Ga0207679_10067267
713 Ga0207679_10377211
714 Ga0207679_10464172
715 Ga0207667_10005570
716 Ga0207667_10007905
717 Ga0207667_10021181
718 Ga0207667_10125798
719 Ga0207667_10207222
720 Ga0207667_10332877
721 Ga0207667_10560004
722 Ga0207651_10125894
723 Ga0207651_11038111
724 Ga0207640_10104494
725 Ga0207640_10414099
726 Ga0207677_10005164
727 Ga0207677_10011560
728 Ga0207677_10114055
729 Ga0207703_10003085
730 Ga0207703_10047962
731 Ga0207703_10064182
732 Ga0207639_10166756
733 Ga0207702_10000962
734 Ga0207702_10003902
735 Ga0207702_10005623
736 Ga0207702_10018797
737 Ga0207702_10158715
738 Ga0207702_10400320
739 Ga0207641_10002104
740 Ga0207641_10041566
741 Ga0207641_10084675
742 Ga0207641_10418840
743 Ga0207648_10005882
744 Ga0207676_10022265
745 Ga0207676_10030739
746 Ga0207676_10095615
747 Ga0207674_10000867
748 Ga0207674_10013153
749 Ga0207674_10044268
750 Ga0207674_10683604
751 Ga0207683_10418679
752 Ga0207698_10324875
753 Ga0268264_10063800
754 Ga0268264_11098928
755 Ga0265338_10075110
756 Ga0265770_1020038
757 Ga0265760_10001349
758 Ga0265760_10018600
759 Ga0373926_0003307
760 Ga0373936_0013961
761 Ga0373945_0196227
762 Ga0373943_0008158
763 Ga0373943_0060672
764 Ga0373943_0445703
765 Ga0373946_0077872
766 Ga0373955_0038440
767 Ga0373931_0016550
768 Ga0373927_0031982
769 Ga0373927_0033314
770 Ga0373927_0050597
771 Ga0373947_0003476
772 Ga0373937_0773952
773 Ga0373925_0000640
774 Ga0373925_0005489
775 Ga0373925_0198073
776 Ga0373925_0311435
777 Ga0436364_1497996
778 Ga0436360_0212086
779 Ga0436363_0512353
780 Ga0466963_0193543
781 Ga0453684_0887654
782 Ga0466970_0370948
783 Ga0466959_0168651
784 Ga0451576_0512503
785 Ga0466967_0030059
786 Ga0466967_0097512
787 Ga0466967_0343550
788 Ga0495580_0000050
789 Ga0495580_0000646
790 Ga0495580_0029552
791 Ga0495580_0039012
792 Ga0495580_0128742
793 Ga0495580_0369920
794 Ga0495582_0000070
795 Ga0495666_0025627
796 Ga0495665_0001083
797 Ga0495665_0080284
798 Ga0495665_0177104
799 Ga0495669_0010300
800 Ga0495669_0111291
801 Ga0495581_0006950
802 Ga0495581_0007293
803 Ga0495581_0187618
804 Ga0495593_0157350
805 Ga0495602_0017207
806 Ga0496101_0065694
807 Ga0496103_0085207
808 Ga0496104_0257787
809 Ga0496104_0471921
810 Ga0496108_0105147
811 Ga0496108_0158743
812 Ga0496110_0015779
813 Ga0496111_0048471
814 Ga0496112_0002776
815 Ga0496112_0003332
816 Ga0496112_0127464
817 Ga0496112_0256977
818 Ga0496112_0420688
819 Ga0496113_0142093
820 nmdc:mga0n895_18347_c1
821 nmdc:mga0n895_4256_c1
822 nmdc:mga0rr50_281656_c1
823 nmdc:mga0rr50_7707_c1
824 nmdc:mga08x19_490296_c1
825 nmdc:mga0a205_15604_c1
826 nmdc:mga0a205_252653_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05995

CDO_I

Cysteine dioxygenase type I

31

204

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dct-assembly1.cif.gz_A crystal structure of the tt1209 from thermus thermophilus hb8 0.8972 47 163
4z82-assembly1.cif.gz_A cysteine bound rat cysteine dioxygenase c164s variant at ph 8.1 0.8967 6 193
6u4v-assembly1.cif.gz_A non-crosslinked wild type cysteine dioxygenase 0.8922 6 193
4z82-assembly1.cif.gz_A cysteine bound rat cysteine dioxygenase c164s variant at ph 8.1 0.8831 6 193
6u4v-assembly1.cif.gz_A non-crosslinked wild type cysteine dioxygenase 0.8831 6 193
ID Description Score Start End Superfamily
3elnA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8634 3 193 2.60.120.10
3elnA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8548 3 193 2.60.120.10
4qmaA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.833 48 185 2.60.120.10
5jspB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8224 66 162 2.60.120.10
af_Q8IAA1_67_212_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8199 60 172 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2V9YC53-F1-model_v4 Cysteine dioxygenase 0.9985 60 193 GO:0008198
GO:0017172
GO:0019448
AF-A0A2V7WTU1-F1-model_v4 Cysteine dioxygenase 0.9978 9 193 GO:0008198
GO:0017172
GO:0019448
AF-A0A2V9MZL9-F1-model_v4 Uncharacterized protein 0.992 95 193
AF-A0A2W0AJK7-F1-model_v4 Cysteine dioxygenase 0.9908 1 193 GO:0008198
GO:0017172
GO:0019448
AF-A0A2W0AJK7-F1-model_v4 Cysteine dioxygenase 0.9857 1 193 GO:0008198
GO:0017172
GO:0019448

Map