F437797

General Info

Members Datasets Scaffolds Average Seq Length
412 195 412 141

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10649121|Ga0105237_106491213
Length 150
Sequence MATEQQEHLKIEELQQLSPDQIEVMAGRDRENLEGWIPALATEAEVKDAFEKAFDYRGDVTLTLKSGEVVEGYIYDRRQGSTLENSLVRVMPSKGEDRSRRSIPYSEIAALNFSGRDTAAGKTFEAWVKKYWEKKAAGEKNIQIEPEKLD

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
139 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
140 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
141 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
142 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
143 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
146 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
149 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
150 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
151 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
152 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
153 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
154 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
164 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
165 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
166 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
167 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.06
Metatranscriptomes 1.94
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 2.91
Rhizosphere 94.9
Stem 0
Stem Tuber 0
Unclassified 1.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10052997 3300003320 Unclassified 1562
2 rootH2_10112230 3300003320 Bacteria 1486
3 Ga0065712_10212787 3300005290 Unclassified 1061
4 Ga0070658_10079868 3300005327 Unclassified 2686
5 Ga0070683_100004411 3300005329 Bacteria 11593
6 Ga0070683_100074194 3300005329 Bacteria 3177
7 Ga0070683_100279477 3300005329 Bacteria 1588
8 Ga0070690_100101837 3300005330 Bacteria 1905
9 Ga0070670_100007161 3300005331 Bacteria 9447
10 Ga0070670_100138839 3300005331 Bacteria 2101
11 Ga0068869_100009801 3300005334 Bacteria 6221
12 Ga0070666_10038326 3300005335 Bacteria 3188
13 Ga0070680_100013637 3300005336 Bacteria 6335
14 Ga0070680_100210381 3300005336 Bacteria 1641
15 Ga0068868_100000977 3300005338 Bacteria 19488
16 Ga0068868_100065225 3300005338 Bacteria 2892
17 Ga0068868_100097960 3300005338 Bacteria 2370
18 Ga0070660_100015353 3300005339 Bacteria 5527
19 Ga0070660_100967368 3300005339 Bacteria 719
20 Ga0070689_100956057 3300005340 Bacteria 760
21 Ga0070687_100173242 3300005343 Unclassified 1286
22 Ga0070661_100032414 3300005344 Bacteria 3783
23 Ga0070661_100063804 3300005344 Unclassified 2706
24 Ga0070661_100215697 3300005344 Bacteria 1470
25 Ga0070668_100410470 3300005347 Unclassified 1158
26 Ga0070675_100372530 3300005354 Bacteria 1270
27 Ga0070671_100483294 3300005355 Bacteria 1064
28 Ga0070674_101204360 3300005356 Bacteria 672
29 Ga0070673_100043548 3300005364 Bacteria 3470
30 Ga0070673_100068475 3300005364 Bacteria 2842
31 Ga0070667_100567948 3300005367 Bacteria 1043
32 Ga0070714_100031531 3300005435 Bacteria 4423
33 Ga0070714_100082996 3300005435 Bacteria 2793
34 Ga0070714_100168191 3300005435 Unclassified 1988
35 Ga0070714_100238992 3300005435 Bacteria 1676
36 Ga0070713_100012512 3300005436 Bacteria 6228
37 Ga0070713_100529258 3300005436 Bacteria 1114
38 Ga0070713_101734166 3300005436 Bacteria 606
39 Ga0070711_100041031 3300005439 Bacteria 3124
40 Ga0070711_100066264 3300005439 Bacteria 2529
41 Ga0070708_100040260 3300005445 Bacteria 4092
42 Ga0070662_100156621 3300005457 Bacteria 1779
43 Ga0070662_100187820 3300005457 Bacteria 1632
44 Ga0070681_10003258 3300005458 Bacteria 15139
45 Ga0070681_10055499 3300005458 Bacteria 3944
46 Ga0070681_11194819 3300005458 Unclassified 682
47 Ga0068867_100002729 3300005459 Bacteria 12447
48 Ga0068867_100366057 3300005459 Bacteria 1207
49 Ga0070707_100452153 3300005468 Bacteria 1245
50 Ga0070679_100005928 3300005530 Bacteria 11354
51 Ga0070679_100118202 3300005530 Bacteria 2636
52 Ga0070679_100191837 3300005530 Bacteria 2012
53 Ga0070679_100206606 3300005530 Bacteria 1928
54 Ga0070684_100113398 3300005535 Bacteria 2433
55 Ga0070684_100565183 3300005535 Bacteria 1056
56 Ga0070697_100590136 3300005536 Bacteria 976
57 Ga0068853_100461875 3300005539 Bacteria 1195
58 Ga0068853_100567793 3300005539 Bacteria 1076
59 Ga0068853_100637875 3300005539 Bacteria 1013
60 Ga0068853_101209828 3300005539 Bacteria 729
61 Ga0068853_101326621 3300005539 Bacteria 695
62 Ga0070672_100001063 3300005543 Bacteria 16743
63 Ga0070693_100224261 3300005547 Bacteria 1233
64 Ga0070665_100014033 3300005548 Bacteria 8054
65 Ga0070665_100181188 3300005548 Bacteria 2107
66 Ga0068855_100009663 3300005563 Bacteria 11640
67 Ga0068855_100015585 3300005563 Bacteria 9147
68 Ga0068855_100019740 3300005563 Bacteria 8093
69 Ga0068855_100076983 3300005563 Bacteria 3870
70 Ga0070664_100004851 3300005564 Bacteria 10777
71 Ga0068857_100004083 3300005577 Bacteria 12299
72 Ga0068857_100185241 3300005577 Bacteria 1895
73 Ga0068857_100876267 3300005577 Bacteria 860
74 Ga0068854_100033521 3300005578 Bacteria 3581
75 Ga0068854_100414299 3300005578 Bacteria 1118
76 Ga0068854_101548406 3300005578 Unclassified 603
77 Ga0068856_100000916 3300005614 Bacteria 31561
78 Ga0068856_100002146 3300005614 Bacteria 20446
79 Ga0068856_100038548 3300005614 Bacteria 4692
80 Ga0068856_100116925 3300005614 Bacteria 2667
81 Ga0068856_100142795 3300005614 Bacteria 2401
82 Ga0068856_100257797 3300005614 Bacteria 1759
83 Ga0068856_101008846 3300005614 Unclassified 851
84 Ga0068856_101620318 3300005614 Unclassified 660
85 Ga0068852_100000009 3300005616 Bacteria 149600
86 Ga0068852_100063446 3300005616 Bacteria 3217
87 Ga0068852_100342508 3300005616 Bacteria 1457
88 Ga0068852_100385007 3300005616 Bacteria 1376
89 Ga0068859_100000418 3300005617 Bacteria 42477
90 Ga0068859_100711242 3300005617 Bacteria 1095
91 Ga0068864_100001207 3300005618 Bacteria 21455
92 Ga0068864_100543222 3300005618 Bacteria 1122
93 Ga0068866_10079592 3300005718 Bacteria 1756
94 Ga0068851_10089914 3300005834 Bacteria 1615
95 Ga0068870_10051365 3300005840 Bacteria 2182
96 Ga0068863_100066586 3300005841 Unclassified 3407
97 Ga0068863_100199683 3300005841 Bacteria 1923
98 Ga0068863_100757916 3300005841 Unclassified 967
99 Ga0068863_100758561 3300005841 Bacteria 966
100 Ga0068858_100010741 3300005842 Bacteria 8659
101 Ga0068858_100044802 3300005842 Bacteria 4100
102 Ga0068858_100184206 3300005842 Unclassified 1972
103 Ga0068860_100005689 3300005843 Bacteria 12584
104 Ga0068860_100624841 3300005843 Bacteria 1084
105 Ga0070717_10944813 3300006028 Bacteria 785
106 Ga0070717_11355492 3300006028 Unclassified 646
107 Ga0070712_100115100 3300006175 Bacteria 2015
108 Ga0070712_100483134 3300006175 Bacteria 1036
109 Ga0070712_100510045 3300006175 Bacteria 1009
110 Ga0070712_101403492 3300006175 Unclassified 609
111 Ga0097621_100085364 3300006237 Bacteria 2633
112 Ga0097621_100112546 3300006237 Bacteria 2301
113 Ga0068871_100058109 3300006358 Bacteria 3148
114 Ga0068871_100092657 3300006358 Bacteria 2520
115 Ga0068865_100034242 3300006881 Bacteria 3407
116 Ga0075436_100231106 3300006914 Unclassified 1314
117 Ga0097620_100000418 3300006931 Bacteria 42477
118 Ga0097620_100711377 3300006931 Bacteria 1095
119 Ga0105240_10000148 3300009093 Bacteria 142265
120 Ga0105240_10001474 3300009093 Bacteria 40151
121 Ga0105240_10017072 3300009093 Bacteria 9801
122 Ga0105240_10026818 3300009093 Bacteria 7556
123 Ga0105240_10067694 3300009093 Bacteria 4426
124 Ga0105240_10154475 3300009093 Bacteria 2731
125 Ga0105240_10282630 3300009093 Bacteria 1906
126 Ga0105240_11903464 3300009093 Unclassified 619
127 Ga0105245_10860272 3300009098 Bacteria 947
128 Ga0105247_10051351 3300009101 Bacteria 2539
129 Ga0105247_10411538 3300009101 Unclassified 966
130 Ga0105243_10250202 3300009148 Bacteria 1582
131 Ga0105241_10039831 3300009174 Bacteria 3545
132 Ga0105241_10174250 3300009174 Bacteria 1779
133 Ga0105241_10211294 3300009174 Bacteria 1626
134 Ga0105241_10995299 3300009174 Unclassified 784
135 Ga0105241_11648709 3300009174 Bacteria 622
136 Ga0105242_10052652 3300009176 Bacteria 3322
137 Ga0105242_10663758 3300009176 Bacteria 1016
138 Ga0105248_10000004 3300009177 Bacteria 695244
139 Ga0105248_10001829 3300009177 Bacteria 23588
140 Ga0105248_13140357 3300009177 Unclassified 526
141 Ga0105237_10007053 3300009545 Bacteria 12359
142 Ga0105237_10010661 3300009545 Bacteria 9765
143 Ga0105237_10057258 3300009545 Bacteria 3901
144 Ga0105237_10164025 3300009545 Bacteria 2221
145 Ga0105237_10649121 3300009545 Bacteria 1062
146 Ga0105237_11071337 3300009545 Unclassified 813
147 Ga0105238_10006069 3300009551 Bacteria 11983
148 Ga0105238_10050591 3300009551 Bacteria 4182
149 Ga0105238_10062798 3300009551 Bacteria 3715
150 Ga0105238_10077665 3300009551 Bacteria 3311
151 Ga0105239_10084545 3300010375 Bacteria 3495
152 Ga0105239_10615574 3300010375 Bacteria 1239
153 Ga0105239_13655150 3300010375 Bacteria 500
154 Ga0105246_10020248 3300011119 Bacteria 4265
155 Ga0105246_10093191 3300011119 Unclassified 2175
156 Ga0157373_10027038 3300013100 Bacteria 4140
157 Ga0157373_10275584 3300013100 Bacteria 1191
158 Ga0157373_11181932 3300013100 Unclassified 576
159 Ga0157371_10655651 3300013102 Bacteria 783
160 Ga0157370_10001908 3300013104 Bacteria 25647
161 Ga0157370_10013011 3300013104 Bacteria 8595
162 Ga0157370_10114251 3300013104 Bacteria 2523
163 Ga0157369_10000035 3300013105 Bacteria 191300
164 Ga0157369_10035416 3300013105 Bacteria 5473
165 Ga0157369_10036867 3300013105 Bacteria 5355
166 Ga0157369_10061361 3300013105 Bacteria 4053
167 Ga0157369_10064089 3300013105 Bacteria 3958
168 Ga0157369_10088346 3300013105 Unclassified 3308
169 Ga0157369_10175025 3300013105 Bacteria 2259
170 Ga0157369_10259485 3300013105 Bacteria 1812
171 Ga0157369_10531781 3300013105 Bacteria 1216
172 Ga0157374_10001749 3300013296 Bacteria 18238
173 Ga0157374_10072350 3300013296 Bacteria 3253
174 Ga0157374_10455667 3300013296 Bacteria 1281
175 Ga0157374_10544677 3300013296 Bacteria 1168
176 Ga0157374_10743811 3300013296 Bacteria 995
177 Ga0157378_10000388 3300013297 Bacteria 43382
178 Ga0157378_10000672 3300013297 Bacteria 32242
179 Ga0157378_10016166 3300013297 Bacteria 6534
180 Ga0157378_10437047 3300013297 Bacteria 1296
181 Ga0163162_10542137 3300013306 Unclassified 1292
182 Ga0163162_10784970 3300013306 Bacteria 1071
183 Ga0157372_10000049 3300013307 Bacteria 142350
184 Ga0157372_10001589 3300013307 Bacteria 24720
185 Ga0157372_10002152 3300013307 Bacteria 21430
186 Ga0157372_10005916 3300013307 Bacteria 13022
187 Ga0157372_10008238 3300013307 Bacteria 11079
188 Ga0157372_10066228 3300013307 Bacteria 4058
189 Ga0157372_10069876 3300013307 Bacteria 3950
190 Ga0157372_10276110 3300013307 Bacteria 1953
191 Ga0157372_10996386 3300013307 Bacteria 970
192 Ga0157372_12383707 3300013307 Bacteria 608
193 Ga0157375_10072281 3300013308 Bacteria 3465
194 Ga0157375_10130216 3300013308 Bacteria 2634
195 Ga0163163_10855780 3300014325 Bacteria 973
196 Ga0157377_10589582 3300014745 Bacteria 791
197 Ga0157379_10246399 3300014968 Bacteria 1621
198 Ga0157376_10831839 3300014969 Bacteria 938
199 Ga0163161_10007132 3300017792 Bacteria 7726
200 Ga0206356_11053223 3300020070 Bacteria 1001
201 Ga0206356_11480910 3300020070 Bacteria 858
202 Ga0206351_10648075 3300020077 Bacteria 686
203 Ga0206352_10260040 3300020078 Unclassified 1037
204 Ga0154015_1325885 3300020610 Bacteria 742
205 Ga0224712_10177344 3300022467 Bacteria 958
206 Ga0224572_1008204 3300024225 Bacteria 1928
207 Ga0209233_1000980 3300025261 Bacteria 12250
208 Ga0207697_10022000 3300025315 Bacteria 2612
209 Ga0207656_10106532 3300025321 Bacteria 1291
210 Ga0207692_10023508 3300025898 Bacteria 2851
211 Ga0207642_10084132 3300025899 Bacteria 1553
212 Ga0207647_10055991 3300025904 Bacteria 2421
213 Ga0207643_10072745 3300025908 Bacteria 1980
214 Ga0207705_10167350 3300025909 Bacteria 1654
215 Ga0207654_10030722 3300025911 Bacteria 2952
216 Ga0207654_10214520 3300025911 Bacteria 1273
217 Ga0207707_10011242 3300025912 Bacteria 7790
218 Ga0207707_10080845 3300025912 Bacteria 2837
219 Ga0207707_10118077 3300025912 Bacteria 2319
220 Ga0207695_10000105 3300025913 Bacteria 254764
221 Ga0207695_10008132 3300025913 Bacteria 13189
222 Ga0207695_10017583 3300025913 Bacteria 8310
223 Ga0207695_10025983 3300025913 Bacteria 6543
224 Ga0207695_10027299 3300025913 Bacteria 6360
225 Ga0207695_10112325 3300025913 Bacteria 2703
226 Ga0207695_10153523 3300025913 Bacteria 2239
227 Ga0207695_10177870 3300025913 Bacteria 2049
228 Ga0207695_10182210 3300025913 Bacteria 2021
229 Ga0207693_10066174 3300025915 Unclassified 2830
230 Ga0207693_10646324 3300025915 Unclassified 822
231 Ga0207663_10050923 3300025916 Bacteria 2576
232 Ga0207663_10424468 3300025916 Bacteria 1021
233 Ga0207663_11294148 3300025916 Unclassified 587
234 Ga0207660_10020026 3300025917 Bacteria 4483
235 Ga0207660_10044584 3300025917 Bacteria 3120
236 Ga0207657_10004170 3300025919 Bacteria 15323
237 Ga0207649_10058173 3300025920 Bacteria 2420
238 Ga0207649_10298055 3300025920 Bacteria 1178
239 Ga0207652_10013107 3300025921 Bacteria 6711
240 Ga0207652_10119419 3300025921 Bacteria 2345
241 Ga0207652_10187860 3300025921 Bacteria 1858
242 Ga0207681_10707742 3300025923 Bacteria 838
243 Ga0207694_10153253 3300025924 Bacteria 1857
244 Ga0207694_10368423 3300025924 Bacteria 1191
245 Ga0207694_10387689 3300025924 Bacteria 1160
246 Ga0207650_10015022 3300025925 Bacteria 5386
247 Ga0207687_10519376 3300025927 Bacteria 996
248 Ga0207700_10012704 3300025928 Bacteria 5443
249 Ga0207700_10047618 3300025928 Bacteria 3179
250 Ga0207700_10323770 3300025928 Bacteria 1336
251 Ga0207700_10478794 3300025928 Unclassified 1100
252 Ga0207700_11630092 3300025928 Bacteria 570
253 Ga0207664_10046993 3300025929 Bacteria 3390
254 Ga0207664_10090509 3300025929 Unclassified 2507
255 Ga0207664_10111222 3300025929 Bacteria 2279
256 Ga0207664_10233543 3300025929 Bacteria 1599
257 Ga0207664_11052364 3300025929 Bacteria 728
258 Ga0207706_10042902 3300025933 Bacteria 4009
259 Ga0207706_11397196 3300025933 Bacteria 575
260 Ga0207704_10114432 3300025938 Unclassified 1831
261 Ga0207691_10012573 3300025940 Bacteria 8113
262 Ga0207711_10000032 3300025941 Bacteria 199046
263 Ga0207711_10091885 3300025941 Bacteria 2670
264 Ga0207689_10070918 3300025942 Bacteria 2862
265 Ga0207661_10016724 3300025944 Bacteria 5415
266 Ga0207661_10021122 3300025944 Bacteria 4877
267 Ga0207661_10237994 3300025944 Bacteria 1614
268 Ga0207679_10032028 3300025945 Bacteria 3686
269 Ga0207667_10000079 3300025949 Bacteria 163341
270 Ga0207667_10009046 3300025949 Bacteria 11779
271 Ga0207667_10032407 3300025949 Bacteria 5632
272 Ga0207667_10033068 3300025949 Bacteria 5564
273 Ga0207667_10168748 3300025949 Bacteria 2249
274 Ga0207667_12129290 3300025949 Unclassified 519
275 Ga0207651_10055915 3300025960 Bacteria 2713
276 Ga0207668_10374472 3300025972 Bacteria 1197
277 Ga0207658_10026422 3300025986 Bacteria 4070
278 Ga0207677_10009772 3300026023 Bacteria 5405
279 Ga0207677_10039899 3300026023 Bacteria 3091
280 Ga0207677_10173551 3300026023 Bacteria 1688
281 Ga0207703_10098541 3300026035 Bacteria 2472
282 Ga0207703_10186392 3300026035 Bacteria 1834
283 Ga0207703_10193084 3300026035 Unclassified 1805
284 Ga0207639_10028287 3300026041 Bacteria 4091
285 Ga0207639_10600754 3300026041 Bacteria 1015
286 Ga0207639_11159795 3300026041 Bacteria 725
287 Ga0207639_11515266 3300026041 Bacteria 629
288 Ga0207678_10506371 3300026067 Bacteria 1053
289 Ga0207702_10000915 3300026078 Bacteria 30520
290 Ga0207702_10030153 3300026078 Unclassified 4519
291 Ga0207702_10127990 3300026078 Bacteria 2282
292 Ga0207702_10283873 3300026078 Bacteria 1566
293 Ga0207702_10305131 3300026078 Bacteria 1512
294 Ga0207702_10734283 3300026078 Unclassified 974
295 Ga0207641_10468782 3300026088 Unclassified 1219
296 Ga0207641_10648435 3300026088 Unclassified 1037
297 Ga0207641_10702034 3300026088 Unclassified 996
298 Ga0207648_10030012 3300026089 Bacteria 4821
299 Ga0207648_10527567 3300026089 Bacteria 1082
300 Ga0207676_10001232 3300026095 Bacteria 19062
301 Ga0207676_10665569 3300026095 Bacteria 1006
302 Ga0207674_10000125 3300026116 Bacteria 89047
303 Ga0207674_10223179 3300026116 Bacteria 1833
304 Ga0207683_10000078 3300026121 Bacteria 77219
305 Ga0207683_10176225 3300026121 Bacteria 1938
306 Ga0207698_10000020 3300026142 Bacteria 139630
307 Ga0207698_10023264 3300026142 Bacteria 4325
308 Ga0207698_10086157 3300026142 Bacteria 2553
309 Ga0268266_10072003 3300028379 Bacteria 2996
310 Ga0268266_10899312 3300028379 Bacteria 856
311 Ga0268264_10006216 3300028381 Bacteria 10080
312 Ga0265318_10008783 3300028577 Bacteria 4476
313 Ga0265338_10006656 3300028800 Bacteria 14624
314 Ga0265338_10138903 3300028800 Bacteria 1906
315 Ga0265338_10596555 3300028800 Bacteria 770
316 Ga0265338_11102631 3300028800 Unclassified 534
317 Ga0265760_10023636 3300031090 Bacteria 1786
318 Ga0265760_10110401 3300031090 Bacteria 876
319 Ga0265330_10001337 3300031235 Bacteria 14397
320 Ga0265332_10023777 3300031238 Bacteria 2701
321 Ga0265332_10215537 3300031238 Bacteria 797
322 Ga0265332_10218533 3300031238 Unclassified 791
323 Ga0265328_10001245 3300031239 Bacteria 11812
324 Ga0265328_10176433 3300031239 Bacteria 807
325 Ga0265328_10363057 3300031239 Bacteria 565
326 Ga0265325_10000925 3300031241 Bacteria 21196
327 Ga0265325_10100594 3300031241 Bacteria 1415
328 Ga0265325_10157612 3300031241 Bacteria 1070
329 Ga0265329_10043958 3300031242 Bacteria 1428
330 Ga0265340_10001298 3300031247 Bacteria 14317
331 Ga0265340_10028573 3300031247 Bacteria 2804
332 Ga0265340_10042145 3300031247 Bacteria 2242
333 Ga0265340_10079946 3300031247 Bacteria 1540
334 Ga0265339_10000003 3300031249 Bacteria 305994
335 Ga0265339_10003140 3300031249 Bacteria 11632
336 Ga0265339_10014214 3300031249 Bacteria 4803
337 Ga0265339_10312036 3300031249 Bacteria 748
338 Ga0265316_10009816 3300031344 Bacteria 8786
339 Ga0265316_10019740 3300031344 Bacteria 5755
340 Ga0265316_10023472 3300031344 Bacteria 5181
341 Ga0265316_10272964 3300031344 Bacteria 1237
342 Ga0265316_10393891 3300031344 Bacteria 998
343 Ga0265316_10536173 3300031344 Bacteria 834
344 Ga0265313_10001307 3300031595 Bacteria 23503
345 Ga0265313_10213394 3300031595 Bacteria 799
346 Ga0265314_10037641 3300031711 Bacteria 3504
347 Ga0265314_10114874 3300031711 Bacteria 1705
348 Ga0265314_10291976 3300031711 Bacteria 918
349 Ga0265342_10013919 3300031712 Bacteria 5365
350 Ga0265342_10021660 3300031712 Bacteria 4099
351 Ga0265342_10071586 3300031712 Bacteria 2020
352 Ga0316214_1039606 3300033545 Unclassified 676
353 Ga0373934_0212370 3300035086 Bacteria 798
354 Ga0373932_0347270 3300035112 Unclassified 563
355 Ga0373939_0171470 3300035114 Bacteria 803
356 Ga0373953_0113592 3300035117 Unclassified 1147
357 Ga0373953_0345143 3300035117 Bacteria 652
358 Ga0373943_0440305 3300035170 Unclassified 756
359 Ga0373955_0074077 3300035172 Bacteria 1910
360 Ga0373924_0465620 3300035410 Bacteria 567
361 Ga0373931_0390504 3300035691 Unclassified 879
362 Ga0373931_0640128 3300035691 Bacteria 698
363 Ga0373935_0270208 3300035692 Unclassified 1195
364 Ga0373933_0582910 3300035724 Unclassified 734
365 Ga0373933_0714231 3300035724 Bacteria 659
366 Ga0373937_0038373 3300036401 Bacteria 4364
367 Ga0373937_0039697 3300036401 Bacteria 4290
368 Ga0373937_0163071 3300036401 Bacteria 2090
369 Ga0373937_0622494 3300036401 Unclassified 1024
370 Ga0373925_0914916 3300037068 Unclassified 723
371 Ga0395900_0787235 3300037418 Unclassified 880
372 Ga0436364_1419765 3300037853 Bacteria 1487
373 Ga0436360_0880983 3300039438 Bacteria 2663
374 Ga0436363_0556994 3300039450 Bacteria 2177
375 Ga0436362_0986411 3300039453 Unclassified 671
376 Ga0453683_0364577 3300044673 Archaea 929
377 Ga0495592_0683321 3300046454 Unclassified 619
378 Ga0495629_0042298 3300046459 Bacteria 3203
379 Ga0495580_0898248 3300046472 Bacteria 569
380 Ga0495639_0233891 3300046475 Bacteria 906
381 Ga0495586_0349749 3300046535 Bacteria 849
382 Ga0495645_0091172 3300046543 Bacteria 2177
383 Ga0495645_0375487 3300046543 Bacteria 911
384 Ga0495667_0188339 3300046559 Bacteria 1323
385 Ga0495657_0800711 3300046675 Bacteria 539
386 Ga0495623_0079519 3300046679 Bacteria 2031
387 Ga0495669_0332181 3300046684 Unclassified 734
388 Ga0495604_0262617 3300047317 Unclassified 1173
389 Ga0495674_0075587 3300047319 Bacteria 2899
390 Ga0495684_0399589 3300047471 Unclassified 965
391 Ga0495686_0000035 3300047472 Bacteria 314930
392 Ga0495686_0004378 3300047472 Bacteria 11646
393 Ga0495686_0046392 3300047472 Bacteria 2747
394 Ga0495602_0166808 3300048088 Bacteria 1713
395 Ga0495602_0257102 3300048088 Bacteria 1298
396 Ga0496101_0620766 3300048904 Bacteria 855
397 Ga0496104_0000076 3300048907 Bacteria 102010
398 Ga0496105_0058989 3300048908 Bacteria 3167
399 Ga0496106_0973247 3300048909 Bacteria 668
400 Ga0496107_0714670 3300048910 Bacteria 736
401 Ga0496108_0313170 3300048911 Bacteria 1368
402 Ga0496108_0888845 3300048911 Bacteria 765
403 Ga0496110_0577450 3300048913 Bacteria 1021
404 Ga0496112_0006343 3300048915 Bacteria 10380
405 Ga0496112_0624163 3300048915 Bacteria 1009
406 Ga0496114_0465700 3300048917 Bacteria 1119
407 Ga0496115_0156782 3300048918 Bacteria 1881
408 Ga0496126_0000110 3300048929 Bacteria 196225
409 Ga0496126_0001061 3300048929 Bacteria 46386
410 nmdc:mga08x19_540203_c1 3300050514 Bacteria 824
411 nmdc:mga08x19_56110_c1 3300050514 Bacteria 1320
412 Ga0500595_031316 3300053119 Bacteria 1785

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039438 Ga0436360_0880983 Ga0436360_0880983_986_1432 123
2 3300048929 Ga0496126_0001061 Ga0496126_0001061_26080_26484 134
3 3300005548 Ga0070665_100181188 Ga0070665_1001811883 138
4 3300013296 Ga0157374_10455667 Ga0157374_104556672 138
5 3300013306 Ga0163162_10784970 Ga0163162_107849702 138
6 3300028379 Ga0268266_10072003 Ga0268266_100720033 138
7 3300028379 Ga0268266_10899312 Ga0268266_108993122 138
8 3300048911 Ga0496108_0313170 Ga0496108_0313170_106_522 138
9 3300005435 Ga0070714_100082996 Ga0070714_1000829963 139
10 3300005436 Ga0070713_100529258 Ga0070713_1005292583 139
11 3300005614 Ga0068856_101620318 Ga0068856_1016203182 139
12 3300006175 Ga0070712_100483134 Ga0070712_1004831341 139
13 3300006175 Ga0070712_100510045 Ga0070712_1005100453 139
14 3300009093 Ga0105240_10154475 Ga0105240_101544752 139
15 3300013105 Ga0157369_10175025 Ga0157369_101750252 139
16 3300013307 Ga0157372_10066228 Ga0157372_100662284 139
17 3300013307 Ga0157372_10996386 Ga0157372_109963862 139
18 3300025913 Ga0207695_10008132 Ga0207695_100081324 139
19 3300025913 Ga0207695_10182210 Ga0207695_101822101 139
20 3300025916 Ga0207663_11294148 Ga0207663_112941482 139
21 3300025928 Ga0207700_10047618 Ga0207700_100476181 139
22 3300025929 Ga0207664_10046993 Ga0207664_100469933 139
23 3300035117 Ga0373953_0113592 Ga0373953_0113592_525_944 139
24 3300035170 Ga0373943_0440305 Ga0373943_0440305_168_587 139
25 3300035692 Ga0373935_0270208 Ga0373935_0270208_97_516 139
26 3300035724 Ga0373933_0582910 Ga0373933_0582910_16_435 139
27 3300036401 Ga0373937_0622494 Ga0373937_0622494_266_685 139
28 3300037068 Ga0373925_0914916 Ga0373925_0914916_267_686 139
29 3300048088 Ga0495602_0257102 Ga0495602_0257102_500_919 139
30 3300005290 Ga0065712_10212787 Ga0065712_102127871 140
31 3300005329 Ga0070683_100074194 Ga0070683_1000741943 140
32 3300005330 Ga0070690_100101837 Ga0070690_1001018372 140
33 3300005331 Ga0070670_100007161 Ga0070670_10000716110 140
34 3300005334 Ga0068869_100009801 Ga0068869_1000098014 140
35 3300005338 Ga0068868_100000977 Ga0068868_1000009772 140
36 3300005340 Ga0070689_100956057 Ga0070689_1009560571 140
37 3300005343 Ga0070687_100173242 Ga0070687_1001732422 140
38 3300005344 Ga0070661_100032414 Ga0070661_1000324142 140
39 3300005344 Ga0070661_100063804 Ga0070661_1000638042 140
40 3300005355 Ga0070671_100483294 Ga0070671_1004832942 140
41 3300005356 Ga0070674_101204360 Ga0070674_1012043601 140
42 3300005364 Ga0070673_100068475 Ga0070673_1000684752 140
43 3300005435 Ga0070714_100031531 Ga0070714_1000315316 140
44 3300005435 Ga0070714_100168191 Ga0070714_1001681913 140
45 3300005435 Ga0070714_100238992 Ga0070714_1002389921 140
46 3300005436 Ga0070713_100012512 Ga0070713_1000125124 140
47 3300005439 Ga0070711_100066264 Ga0070711_1000662643 140
48 3300005445 Ga0070708_100040260 Ga0070708_1000402601 140
49 3300005457 Ga0070662_100187820 Ga0070662_1001878202 140
50 3300005458 Ga0070681_10055499 Ga0070681_100554992 140
51 3300005458 Ga0070681_11194819 Ga0070681_111948191 140
52 3300005459 Ga0068867_100002729 Ga0068867_10000272911 140
53 3300005468 Ga0070707_100452153 Ga0070707_1004521531 140
54 3300005530 Ga0070679_100118202 Ga0070679_1001182023 140
55 3300005530 Ga0070679_100206606 Ga0070679_1002066062 140
56 3300005536 Ga0070697_100590136 Ga0070697_1005901361 140
57 3300005539 Ga0068853_100461875 Ga0068853_1004618752 140
58 3300005539 Ga0068853_100637875 Ga0068853_1006378752 140
59 3300005547 Ga0070693_100224261 Ga0070693_1002242612 140
60 3300005563 Ga0068855_100015585 Ga0068855_1000155852 140
61 3300005563 Ga0068855_100076983 Ga0068855_1000769835 140
62 3300005564 Ga0070664_100004851 Ga0070664_1000048513 140
63 3300005577 Ga0068857_100004083 Ga0068857_1000040832 140
64 3300005578 Ga0068854_100033521 Ga0068854_1000335212 140
65 3300005578 Ga0068854_100414299 Ga0068854_1004142992 140
66 3300005614 Ga0068856_100000916 Ga0068856_1000009169 140
67 3300005614 Ga0068856_100002146 Ga0068856_10000214620 140
68 3300005614 Ga0068856_100142795 Ga0068856_1001427951 140
69 3300005616 Ga0068852_100063446 Ga0068852_1000634464 140
70 3300005617 Ga0068859_100000418 Ga0068859_10000041837 140
71 3300005618 Ga0068864_100001207 Ga0068864_10000120719 140
72 3300005718 Ga0068866_10079592 Ga0068866_100795922 140
73 3300005840 Ga0068870_10051365 Ga0068870_100513652 140
74 3300005841 Ga0068863_100066586 Ga0068863_1000665863 140
75 3300005841 Ga0068863_100758561 Ga0068863_1007585612 140
76 3300005842 Ga0068858_100010741 Ga0068858_1000107416 140
77 3300005842 Ga0068858_100184206 Ga0068858_1001842063 140
78 3300005843 Ga0068860_100005689 Ga0068860_1000056894 140
79 3300006028 Ga0070717_10944813 Ga0070717_109448131 140
80 3300006175 Ga0070712_100115100 Ga0070712_1001151002 140
81 3300006237 Ga0097621_100085364 Ga0097621_1000853642 140
82 3300006358 Ga0068871_100092657 Ga0068871_1000926572 140
83 3300006881 Ga0068865_100034242 Ga0068865_1000342424 140
84 3300006914 Ga0075436_100231106 Ga0075436_1002311062 140
85 3300006931 Ga0097620_100000418 Ga0097620_10000041837 140
86 3300009093 Ga0105240_10067694 Ga0105240_100676943 140
87 3300009093 Ga0105240_11903464 Ga0105240_119034642 140
88 3300009174 Ga0105241_10039831 Ga0105241_100398312 140
89 3300009174 Ga0105241_10211294 Ga0105241_102112943 140
90 3300009174 Ga0105241_11648709 Ga0105241_116487091 140
91 3300009176 Ga0105242_10052652 Ga0105242_100526523 140
92 3300009177 Ga0105248_10001829 Ga0105248_1000182920 140
93 3300009545 Ga0105237_10010661 Ga0105237_1001066110 140
94 3300009545 Ga0105237_10164025 Ga0105237_101640252 140
95 3300009551 Ga0105238_10077665 Ga0105238_100776652 140
96 3300010375 Ga0105239_10615574 Ga0105239_106155742 140
97 3300011119 Ga0105246_10020248 Ga0105246_100202483 140
98 3300013100 Ga0157373_10027038 Ga0157373_100270382 140
99 3300013100 Ga0157373_10275584 Ga0157373_102755842 140
100 3300013104 Ga0157370_10013011 Ga0157370_100130119 140
101 3300013105 Ga0157369_10036867 Ga0157369_100368672 140
102 3300013105 Ga0157369_10259485 Ga0157369_102594852 140
103 3300013296 Ga0157374_10001749 Ga0157374_100017498 140
104 3300013296 Ga0157374_10743811 Ga0157374_107438111 140
105 3300013297 Ga0157378_10000388 Ga0157378_100003886 140
106 3300013297 Ga0157378_10000672 Ga0157378_1000067217 140
107 3300013307 Ga0157372_10001589 Ga0157372_1000158919 140
108 3300013307 Ga0157372_10005916 Ga0157372_100059168 140
109 3300013307 Ga0157372_10276110 Ga0157372_102761102 140
110 3300014325 Ga0163163_10855780 Ga0163163_108557802 140
111 3300025898 Ga0207692_10023508 Ga0207692_100235082 140
112 3300025899 Ga0207642_10084132 Ga0207642_100841322 140
113 3300025908 Ga0207643_10072745 Ga0207643_100727452 140
114 3300025911 Ga0207654_10030722 Ga0207654_100307222 140
115 3300025912 Ga0207707_10080845 Ga0207707_100808452 140
116 3300025913 Ga0207695_10153523 Ga0207695_101535232 140
117 3300025913 Ga0207695_10177870 Ga0207695_101778701 140
118 3300025915 Ga0207693_10066174 Ga0207693_100661744 140
119 3300025916 Ga0207663_10424468 Ga0207663_104244681 140
120 3300025920 Ga0207649_10058173 Ga0207649_100581732 140
121 3300025921 Ga0207652_10119419 Ga0207652_101194192 140
122 3300025921 Ga0207652_10187860 Ga0207652_101878602 140
123 3300025925 Ga0207650_10015022 Ga0207650_100150223 140
124 3300025928 Ga0207700_10323770 Ga0207700_103237702 140
125 3300025928 Ga0207700_11630092 Ga0207700_116300921 140
126 3300025929 Ga0207664_10090509 Ga0207664_100905093 140
127 3300025929 Ga0207664_10111222 Ga0207664_101112222 140
128 3300025929 Ga0207664_11052364 Ga0207664_110523641 140
129 3300025933 Ga0207706_11397196 Ga0207706_113971962 140
130 3300025941 Ga0207711_10091885 Ga0207711_100918854 140
131 3300025942 Ga0207689_10070918 Ga0207689_100709182 140
132 3300025944 Ga0207661_10016724 Ga0207661_100167244 140
133 3300025945 Ga0207679_10032028 Ga0207679_100320282 140
134 3300025949 Ga0207667_10032407 Ga0207667_100324074 140
135 3300025949 Ga0207667_10033068 Ga0207667_100330682 140
136 3300025960 Ga0207651_10055915 Ga0207651_100559152 140
137 3300026023 Ga0207677_10009772 Ga0207677_100097722 140
138 3300026035 Ga0207703_10098541 Ga0207703_100985412 140
139 3300026035 Ga0207703_10193084 Ga0207703_101930842 140
140 3300026041 Ga0207639_10600754 Ga0207639_106007542 140
141 3300026078 Ga0207702_10000915 Ga0207702_1000091510 140
142 3300026078 Ga0207702_10030153 Ga0207702_100301533 140
143 3300026088 Ga0207641_10702034 Ga0207641_107020342 140
144 3300026089 Ga0207648_10030012 Ga0207648_100300122 140
145 3300026095 Ga0207676_10001232 Ga0207676_1000123220 140
146 3300026116 Ga0207674_10000125 Ga0207674_100001252 140
147 3300026121 Ga0207683_10176225 Ga0207683_101762252 140
148 3300026142 Ga0207698_10023264 Ga0207698_100232642 140
149 3300028381 Ga0268264_10006216 Ga0268264_100062165 140
150 3300035086 Ga0373934_0212370 Ga0373934_0212370_275_697 140
151 3300035112 Ga0373932_0347270 Ga0373932_0347270_66_488 140
152 3300035114 Ga0373939_0171470 Ga0373939_0171470_136_558 140
153 3300035410 Ga0373924_0465620 Ga0373924_0465620_50_472 140
154 3300035691 Ga0373931_0390504 Ga0373931_0390504_407_829 140
155 3300035724 Ga0373933_0714231 Ga0373933_0714231_42_464 140
156 3300036401 Ga0373937_0039697 Ga0373937_0039697_291_713 140
157 3300037853 Ga0436364_1419765 Ga0436364_1419765_186_608 140
158 3300039450 Ga0436363_0556994 Ga0436363_0556994_703_1125 140
159 3300039453 Ga0436362_0986411 Ga0436362_0986411_86_523 140
160 3300046543 Ga0495645_0375487 Ga0495645_0375487_295_717 140
161 3300046559 Ga0495667_0188339 Ga0495667_0188339_89_511 140
162 3300046675 Ga0495657_0800711 Ga0495657_0800711_106_528 140
163 3300046679 Ga0495623_0079519 Ga0495623_0079519_1566_1988 140
164 3300047317 Ga0495604_0262617 Ga0495604_0262617_279_701 140
165 3300047319 Ga0495674_0075587 Ga0495674_0075587_2453_2875 140
166 3300048088 Ga0495602_0166808 Ga0495602_0166808_851_1273 140
167 3300048910 Ga0496107_0714670 Ga0496107_0714670_304_726 140
168 3300048911 Ga0496108_0888845 Ga0496108_0888845_184_606 140
169 3300048913 Ga0496110_0577450 Ga0496110_0577450_408_830 140
170 3300048915 Ga0496112_0006343 Ga0496112_0006343_3251_3673 140
171 3300050514 nmdc:mga08x19_540203_c1 nmdc:mga08x19_540203_c1_340_762 140
172 3300050514 nmdc:mga08x19_56110_c1 nmdc:mga08x19_56110_c1_392_814 140
173 3300005331 Ga0070670_100138839 Ga0070670_1001388392 141
174 3300005335 Ga0070666_10038326 Ga0070666_100383263 141
175 3300005338 Ga0068868_100097960 Ga0068868_1000979602 141
176 3300005339 Ga0070660_100967368 Ga0070660_1009673681 141
177 3300005344 Ga0070661_100215697 Ga0070661_1002156972 141
178 3300005347 Ga0070668_100410470 Ga0070668_1004104701 141
179 3300005354 Ga0070675_100372530 Ga0070675_1003725302 141
180 3300005364 Ga0070673_100043548 Ga0070673_1000435483 141
181 3300005367 Ga0070667_100567948 Ga0070667_1005679482 141
182 3300005436 Ga0070713_101734166 Ga0070713_1017341661 141
183 3300005457 Ga0070662_100156621 Ga0070662_1001566212 141
184 3300005459 Ga0068867_100366057 Ga0068867_1003660572 141
185 3300005535 Ga0070684_100565183 Ga0070684_1005651831 141
186 3300005543 Ga0070672_100001063 Ga0070672_1000010633 141
187 3300005548 Ga0070665_100014033 Ga0070665_1000140333 141
188 3300005577 Ga0068857_100876267 Ga0068857_1008762672 141
189 3300005616 Ga0068852_100342508 Ga0068852_1003425082 141
190 3300005617 Ga0068859_100711242 Ga0068859_1007112422 141
191 3300005618 Ga0068864_100543222 Ga0068864_1005432222 141
192 3300005834 Ga0068851_10089914 Ga0068851_100899142 141
193 3300005841 Ga0068863_100199683 Ga0068863_1001996832 141
194 3300005842 Ga0068858_100044802 Ga0068858_1000448023 141
195 3300005843 Ga0068860_100624841 Ga0068860_1006248412 141
196 3300006237 Ga0097621_100112546 Ga0097621_1001125462 141
197 3300006358 Ga0068871_100058109 Ga0068871_1000581092 141
198 3300006931 Ga0097620_100711377 Ga0097620_1007113772 141
199 3300009093 Ga0105240_10017072 Ga0105240_100170728 141
200 3300009093 Ga0105240_10282630 Ga0105240_102826302 141
201 3300009098 Ga0105245_10860272 Ga0105245_108602721 141
202 3300009101 Ga0105247_10051351 Ga0105247_100513513 141
203 3300009148 Ga0105243_10250202 Ga0105243_102502023 141
204 3300009176 Ga0105242_10663758 Ga0105242_106637582 141
205 3300009177 Ga0105248_10000004 Ga0105248_10000004537 141
206 3300009177 Ga0105248_13140357 Ga0105248_131403571 141
207 3300009545 Ga0105237_10007053 Ga0105237_1000705312 141
208 3300011119 Ga0105246_10093191 Ga0105246_100931912 141
209 3300013102 Ga0157371_10655651 Ga0157371_106556512 141
210 3300013105 Ga0157369_10035416 Ga0157369_100354167 141
211 3300013297 Ga0157378_10016166 Ga0157378_100161664 141
212 3300013306 Ga0163162_10542137 Ga0163162_105421372 141
213 3300013308 Ga0157375_10130216 Ga0157375_101302162 141
214 3300014745 Ga0157377_10589582 Ga0157377_105895821 141
215 3300014968 Ga0157379_10246399 Ga0157379_102463991 141
216 3300014969 Ga0157376_10831839 Ga0157376_108318392 141
217 3300017792 Ga0163161_10007132 Ga0163161_100071323 141
218 3300020070 Ga0206356_11053223 Ga0206356_110532232 141
219 3300025315 Ga0207697_10022000 Ga0207697_100220003 141
220 3300025321 Ga0207656_10106532 Ga0207656_101065321 141
221 3300025904 Ga0207647_10055991 Ga0207647_100559912 141
222 3300025913 Ga0207695_10017583 Ga0207695_100175836 141
223 3300025920 Ga0207649_10298055 Ga0207649_102980552 141
224 3300025923 Ga0207681_10707742 Ga0207681_107077422 141
225 3300025927 Ga0207687_10519376 Ga0207687_105193762 141
226 3300025933 Ga0207706_10042902 Ga0207706_100429023 141
227 3300025938 Ga0207704_10114432 Ga0207704_101144322 141
228 3300025940 Ga0207691_10012573 Ga0207691_100125738 141
229 3300025941 Ga0207711_10000032 Ga0207711_1000003241 141
230 3300025949 Ga0207667_10168748 Ga0207667_101687482 141
231 3300025972 Ga0207668_10374472 Ga0207668_103744722 141
232 3300025986 Ga0207658_10026422 Ga0207658_100264225 141
233 3300026023 Ga0207677_10173551 Ga0207677_101735512 141
234 3300026035 Ga0207703_10186392 Ga0207703_101863922 141
235 3300026067 Ga0207678_10506371 Ga0207678_105063712 141
236 3300026078 Ga0207702_10127990 Ga0207702_101279902 141
237 3300026088 Ga0207641_10468782 Ga0207641_104687822 141
238 3300026089 Ga0207648_10527567 Ga0207648_105275672 141
239 3300026095 Ga0207676_10665569 Ga0207676_106655692 141
240 3300026121 Ga0207683_10000078 Ga0207683_1000007850 141
241 3300026142 Ga0207698_10086157 Ga0207698_100861573 141
242 3300035691 Ga0373931_0640128 Ga0373931_0640128_235_660 141
243 3300036401 Ga0373937_0163071 Ga0373937_0163071_1542_1967 141
244 3300046454 Ga0495592_0683321 Ga0495592_0683321_76_501 141
245 3300046459 Ga0495629_0042298 Ga0495629_0042298_1923_2348 141
246 3300046475 Ga0495639_0233891 Ga0495639_0233891_210_635 141
247 3300046535 Ga0495586_0349749 Ga0495586_0349749_246_671 141
248 3300046543 Ga0495645_0091172 Ga0495645_0091172_554_979 141
249 3300046684 Ga0495669_0332181 Ga0495669_0332181_146_571 141
250 3300047471 Ga0495684_0399589 Ga0495684_0399589_52_477 141
251 3300048904 Ga0496101_0620766 Ga0496101_0620766_95_520 141
252 3300048909 Ga0496106_0973247 Ga0496106_0973247_233_658 141
253 3300048915 Ga0496112_0624163 Ga0496112_0624163_322_747 141
254 3300048917 Ga0496114_0465700 Ga0496114_0465700_248_673 141
255 3300048918 Ga0496115_0156782 Ga0496115_0156782_119_544 141
256 3300053119 Ga0500595_031316 Ga0500595_031316_1007_1432 141
257 3300005327 Ga0070658_10079868 Ga0070658_100798683 142
258 3300005329 Ga0070683_100004411 Ga0070683_1000044113 142
259 3300005329 Ga0070683_100279477 Ga0070683_1002794772 142
260 3300005336 Ga0070680_100013637 Ga0070680_1000136373 142
261 3300005336 Ga0070680_100210381 Ga0070680_1002103812 142
262 3300005338 Ga0068868_100065225 Ga0068868_1000652251 142
263 3300005339 Ga0070660_100015353 Ga0070660_1000153535 142
264 3300005439 Ga0070711_100041031 Ga0070711_1000410313 142
265 3300005458 Ga0070681_10003258 Ga0070681_100032589 142
266 3300005530 Ga0070679_100005928 Ga0070679_1000059287 142
267 3300005530 Ga0070679_100191837 Ga0070679_1001918373 142
268 3300005535 Ga0070684_100113398 Ga0070684_1001133982 142
269 3300005539 Ga0068853_100567793 Ga0068853_1005677932 142
270 3300005539 Ga0068853_101209828 Ga0068853_1012098281 142
271 3300005539 Ga0068853_101326621 Ga0068853_1013266211 142
272 3300005563 Ga0068855_100009663 Ga0068855_1000096638 142
273 3300005563 Ga0068855_100019740 Ga0068855_1000197404 142
274 3300005577 Ga0068857_100185241 Ga0068857_1001852412 142
275 3300005578 Ga0068854_101548406 Ga0068854_1015484061 142
276 3300005614 Ga0068856_100038548 Ga0068856_1000385484 142
277 3300005614 Ga0068856_100116925 Ga0068856_1001169252 142
278 3300005614 Ga0068856_100257797 Ga0068856_1002577971 142
279 3300005614 Ga0068856_101008846 Ga0068856_1010088461 142
280 3300005616 Ga0068852_100000009 Ga0068852_10000000915 142
281 3300005616 Ga0068852_100385007 Ga0068852_1003850072 142
282 3300005841 Ga0068863_100757916 Ga0068863_1007579162 142
283 3300006028 Ga0070717_11355492 Ga0070717_113554922 142
284 3300006175 Ga0070712_101403492 Ga0070712_1014034921 142
285 3300009093 Ga0105240_10000148 Ga0105240_1000014815 142
286 3300009093 Ga0105240_10001474 Ga0105240_1000147428 142
287 3300009093 Ga0105240_10026818 Ga0105240_100268187 142
288 3300009101 Ga0105247_10411538 Ga0105247_104115382 142
289 3300009174 Ga0105241_10174250 Ga0105241_101742502 142
290 3300009174 Ga0105241_10995299 Ga0105241_109952992 142
291 3300009545 Ga0105237_10057258 Ga0105237_100572584 142
292 3300009545 Ga0105237_11071337 Ga0105237_110713371 142
293 3300009551 Ga0105238_10006069 Ga0105238_1000606910 142
294 3300009551 Ga0105238_10050591 Ga0105238_100505912 142
295 3300009551 Ga0105238_10062798 Ga0105238_100627982 142
296 3300010375 Ga0105239_10084545 Ga0105239_100845451 142
297 3300010375 Ga0105239_13655150 Ga0105239_136551501 142
298 3300013100 Ga0157373_11181932 Ga0157373_111819322 142
299 3300013104 Ga0157370_10001908 Ga0157370_1000190814 142
300 3300013104 Ga0157370_10114251 Ga0157370_101142512 142
301 3300013105 Ga0157369_10000035 Ga0157369_1000003514 142
302 3300013105 Ga0157369_10061361 Ga0157369_100613614 142
303 3300013105 Ga0157369_10064089 Ga0157369_100640892 142
304 3300013105 Ga0157369_10088346 Ga0157369_100883465 142
305 3300013105 Ga0157369_10531781 Ga0157369_105317812 142
306 3300013296 Ga0157374_10072350 Ga0157374_100723503 142
307 3300013296 Ga0157374_10544677 Ga0157374_105446771 142
308 3300013297 Ga0157378_10437047 Ga0157378_104370472 142
309 3300013307 Ga0157372_10000049 Ga0157372_1000004914 142
310 3300013307 Ga0157372_10002152 Ga0157372_1000215211 142
311 3300013307 Ga0157372_10008238 Ga0157372_100082384 142
312 3300013307 Ga0157372_10069876 Ga0157372_100698762 142
313 3300013307 Ga0157372_12383707 Ga0157372_123837071 142
314 3300013308 Ga0157375_10072281 Ga0157375_100722813 142
315 3300020070 Ga0206356_11480910 Ga0206356_114809102 142
316 3300020077 Ga0206351_10648075 Ga0206351_106480752 142
317 3300020078 Ga0206352_10260040 Ga0206352_102600402 142
318 3300020610 Ga0154015_1325885 Ga0154015_13258851 142
319 3300022467 Ga0224712_10177344 Ga0224712_101773442 142
320 3300025909 Ga0207705_10167350 Ga0207705_101673502 142
321 3300025911 Ga0207654_10214520 Ga0207654_102145202 142
322 3300025912 Ga0207707_10011242 Ga0207707_100112423 142
323 3300025912 Ga0207707_10118077 Ga0207707_101180772 142
324 3300025913 Ga0207695_10000105 Ga0207695_1000010546 142
325 3300025913 Ga0207695_10025983 Ga0207695_100259832 142
326 3300025913 Ga0207695_10027299 Ga0207695_100272994 142
327 3300025913 Ga0207695_10112325 Ga0207695_101123253 142
328 3300025915 Ga0207693_10646324 Ga0207693_106463241 142
329 3300025916 Ga0207663_10050923 Ga0207663_100509232 142
330 3300025917 Ga0207660_10020026 Ga0207660_100200263 142
331 3300025917 Ga0207660_10044584 Ga0207660_100445842 142
332 3300025919 Ga0207657_10004170 Ga0207657_100041703 142
333 3300025921 Ga0207652_10013107 Ga0207652_100131072 142
334 3300025924 Ga0207694_10153253 Ga0207694_101532532 142
335 3300025924 Ga0207694_10368423 Ga0207694_103684231 142
336 3300025924 Ga0207694_10387689 Ga0207694_103876892 142
337 3300025928 Ga0207700_10012704 Ga0207700_100127043 142
338 3300025928 Ga0207700_10478794 Ga0207700_104787942 142
339 3300025929 Ga0207664_10233543 Ga0207664_102335431 142
340 3300025944 Ga0207661_10021122 Ga0207661_100211224 142
341 3300025944 Ga0207661_10237994 Ga0207661_102379942 142
342 3300025949 Ga0207667_10000079 Ga0207667_1000007965 142
343 3300025949 Ga0207667_10009046 Ga0207667_100090468 142
344 3300025949 Ga0207667_12129290 Ga0207667_121292901 142
345 3300026023 Ga0207677_10039899 Ga0207677_100398991 142
346 3300026041 Ga0207639_10028287 Ga0207639_100282871 142
347 3300026041 Ga0207639_11159795 Ga0207639_111597951 142
348 3300026041 Ga0207639_11515266 Ga0207639_115152661 142
349 3300026078 Ga0207702_10283873 Ga0207702_102838732 142
350 3300026078 Ga0207702_10305131 Ga0207702_103051312 142
351 3300026078 Ga0207702_10734283 Ga0207702_107342832 142
352 3300026088 Ga0207641_10648435 Ga0207641_106484352 142
353 3300026116 Ga0207674_10223179 Ga0207674_102231792 142
354 3300026142 Ga0207698_10000020 Ga0207698_1000002012 142
355 3300028577 Ga0265318_10008783 Ga0265318_100087835 142
356 3300028800 Ga0265338_10006656 Ga0265338_1000665610 142
357 3300028800 Ga0265338_10138903 Ga0265338_101389034 142
358 3300028800 Ga0265338_10596555 Ga0265338_105965552 142
359 3300028800 Ga0265338_11102631 Ga0265338_111026311 142
360 3300031090 Ga0265760_10023636 Ga0265760_100236362 142
361 3300031090 Ga0265760_10110401 Ga0265760_101104011 142
362 3300031235 Ga0265330_10001337 Ga0265330_100013376 142
363 3300031238 Ga0265332_10023777 Ga0265332_100237772 142
364 3300031238 Ga0265332_10215537 Ga0265332_102155371 142
365 3300031238 Ga0265332_10218533 Ga0265332_102185332 142
366 3300031239 Ga0265328_10001245 Ga0265328_100012458 142
367 3300031239 Ga0265328_10176433 Ga0265328_101764332 142
368 3300031239 Ga0265328_10363057 Ga0265328_103630571 142
369 3300031241 Ga0265325_10000925 Ga0265325_1000092513 142
370 3300031241 Ga0265325_10100594 Ga0265325_101005942 142
371 3300031241 Ga0265325_10157612 Ga0265325_101576122 142
372 3300031242 Ga0265329_10043958 Ga0265329_100439581 142
373 3300031247 Ga0265340_10001298 Ga0265340_100012988 142
374 3300031247 Ga0265340_10028573 Ga0265340_100285733 142
375 3300031247 Ga0265340_10042145 Ga0265340_100421453 142
376 3300031247 Ga0265340_10079946 Ga0265340_100799462 142
377 3300031249 Ga0265339_10000003 Ga0265339_10000003128 142
378 3300031249 Ga0265339_10003140 Ga0265339_100031408 142
379 3300031249 Ga0265339_10014214 Ga0265339_100142144 142
380 3300031249 Ga0265339_10312036 Ga0265339_103120362 142
381 3300031344 Ga0265316_10009816 Ga0265316_100098166 142
382 3300031344 Ga0265316_10019740 Ga0265316_100197404 142
383 3300031344 Ga0265316_10023472 Ga0265316_100234723 142
384 3300031344 Ga0265316_10272964 Ga0265316_102729641 142
385 3300031344 Ga0265316_10393891 Ga0265316_103938912 142
386 3300031344 Ga0265316_10536173 Ga0265316_105361731 142
387 3300031595 Ga0265313_10001307 Ga0265313_1000130712 142
388 3300031595 Ga0265313_10213394 Ga0265313_102133942 142
389 3300031711 Ga0265314_10037641 Ga0265314_100376413 142
390 3300031711 Ga0265314_10114874 Ga0265314_101148742 142
391 3300031711 Ga0265314_10291976 Ga0265314_102919761 142
392 3300031712 Ga0265342_10013919 Ga0265342_100139196 142
393 3300031712 Ga0265342_10021660 Ga0265342_100216603 142
394 3300031712 Ga0265342_10071586 Ga0265342_100715863 142
395 3300033545 Ga0316214_1039606 Ga0316214_10396061 142
396 3300035117 Ga0373953_0345143 Ga0373953_0345143_113_541 142
397 3300035172 Ga0373955_0074077 Ga0373955_0074077_600_1028 142
398 3300036401 Ga0373937_0038373 Ga0373937_0038373_2965_3393 142
399 3300037418 Ga0395900_0787235 Ga0395900_0787235_275_703 142
400 3300046472 Ga0495580_0898248 Ga0495580_0898248_35_463 142
401 3300048908 Ga0496105_0058989 Ga0496105_0058989_1367_1795 142
402 3300003320 rootH2_10052997 rootH2_100529972 147
403 3300003320 rootH2_10112230 rootH2_101122302 147
404 3300009545 Ga0105237_10649121 Ga0105237_106491213 147
405 3300024225 Ga0224572_1008204 Ga0224572_10082043 147
406 3300025261 Ga0209233_1000980 Ga0209233_10009805 147
407 3300044673 Ga0453683_0364577 Ga0453683_0364577_118_576 147
408 3300047472 Ga0495686_0000035 Ga0495686_0000035_215275_215727 147
409 3300047472 Ga0495686_0004378 Ga0495686_0004378_3203_3655 147
410 3300047472 Ga0495686_0046392 Ga0495686_0046392_1334_1783 147
411 3300048907 Ga0496104_0000076 Ga0496104_0000076_74376_74828 147
412 3300048929 Ga0496126_0000110 Ga0496126_0000110_135384_135836 147

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ahu-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8606 54 112
4a53-assembly1.cif.gz_A structural basis of the dcp1:dcp2 mrna decapping complex activation by edc3 and scd6 0.8173 52 113
5dy9-assembly1.cif.gz_F y68t hfq from methanococcus jannaschii in complex with amp 0.7808 52 110
4x9c-assembly1.cif.gz_C 1.4a crystal structure of hfq from methanococcus jannaschii 0.7804 52 110
7uwy-assembly1.cif.gz_A nmr solution structure of the de novo designed small beta-barrel protein 29_bp_sh3 0.7622 44 111
ID Description Score Start End Superfamily
2ej9A02 Mainly Beta;Roll;SH3 type barrels.; 0.8599 56 108 2.30.30.100
4a53A01 Mainly Beta;Roll;SH3 type barrels.; 0.8191 52 111 2.30.30.100
af_P45757_87_154_2.30.30.830 Mainly Beta;Roll;SH3 type barrels.; 0.8107 73 101 2.30.30.830
af_Q2FYW7_1_63_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.8048 53 111 2.30.30.100
af_P52133_127_211_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7907 49 113 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A2T4LLS1-F1-model_v4 LSM domain protein 0.8083 52 112
AF-Q2FYW7-F1-model_v4 LSM domain protein 0.8043 53 111
AF-A0A1L8MKA6-F1-model_v4 LSM domain protein 0.8002 51 111
AF-A0A7U8SSA8-F1-model_v4 deleted 0.7967 52 113
AF-A0A0M5N8T8-F1-model_v4 deleted 0.7904 53 112

Feature Viewer

pLDDT pTM Quality
64.71 0.53 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map