F437788

General Info

Members Datasets Scaffolds Average Seq Length
412 173 412 129

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_12846979|Ga0111539_128469792
Length 145
Sequence MVFRRASASSNSSSVLPTGAELDILAVLWRLGPSTVRDVHDALGKASTYTTTLKQMQLMTEKGLLVRSERFRSHVYEAGVPKEQTQQQIAGDLLTRAFDGSAKSLVMGALAAQPASSEELDEIRRLIDNYEKSSGKASGRKRGTR

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
107 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
108 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
115 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
116 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
118 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
119 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
135 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
136 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
137 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
138 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
139 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
143 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
156 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.97
Rhizosphere 98.3
Stem 0
Stem Tuber 0
Unclassified 0.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10027379 3300003316 Bacteria 4570
2 rootH2_10215238 3300003320 Bacteria 1146
3 rootL2_10095410 3300003322 Bacteria 4759
4 Ga0070658_10003225 3300005327 Bacteria 13472
5 Ga0070658_10163596 3300005327 Bacteria 1867
6 Ga0070683_100017304 3300005329 Bacteria 6370
7 Ga0070683_100840275 3300005329 Bacteria 881
8 Ga0070670_100346421 3300005331 Bacteria 1305
9 Ga0068869_100943474 3300005334 Unclassified 749
10 Ga0070666_10595074 3300005335 Bacteria 807
11 Ga0070666_11029414 3300005335 Unclassified 611
12 Ga0070660_100551923 3300005339 Bacteria 961
13 Ga0070689_100599703 3300005340 Unclassified 954
14 Ga0070691_10919093 3300005341 Unclassified 541
15 Ga0070687_100859246 3300005343 Unclassified 647
16 Ga0070687_101066860 3300005343 Unclassified 589
17 Ga0070669_100191167 3300005353 Bacteria 1606
18 Ga0070673_102334524 3300005364 Unclassified 508
19 Ga0070688_100790368 3300005365 Bacteria 741
20 Ga0070667_100268589 3300005367 Unclassified 1529
21 Ga0070667_100463390 3300005367 Bacteria 1159
22 Ga0070709_10157261 3300005434 Bacteria 1577
23 Ga0070709_10362780 3300005434 Unclassified 1073
24 Ga0070714_100404508 3300005435 Unclassified 1291
25 Ga0070714_102457348 3300005435 Bacteria 506
26 Ga0070713_100182629 3300005436 Bacteria 1886
27 Ga0070713_100260988 3300005436 Bacteria 1583
28 Ga0070713_101580066 3300005436 Unclassified 636
29 Ga0070711_101334922 3300005439 Unclassified 623
30 Ga0070705_100352285 3300005440 Unclassified 1074
31 Ga0070694_100951401 3300005444 Unclassified 711
32 Ga0070678_100631605 3300005456 Bacteria 959
33 Ga0070681_10252570 3300005458 Archaea 1676
34 Ga0068867_101559803 3300005459 Unclassified 616
35 Ga0070707_101945159 3300005468 Unclassified 555
36 Ga0070698_100242860 3300005471 Bacteria 1734
37 Ga0070679_100131739 3300005530 Unclassified 2481
38 Ga0070679_101594682 3300005530 Unclassified 600
39 Ga0070684_100034336 3300005535 Bacteria 4337
40 Ga0070684_100141638 3300005535 Bacteria 2174
41 Ga0070684_100426798 3300005535 Bacteria 1224
42 Ga0070697_101239873 3300005536 Bacteria 665
43 Ga0070672_101296590 3300005543 Unclassified 650
44 Ga0070695_101336308 3300005545 Unclassified 593
45 Ga0070665_100538199 3300005548 Bacteria 1180
46 Ga0070704_101098413 3300005549 Bacteria 722
47 Ga0068855_100036006 3300005563 Bacteria 5893
48 Ga0068855_100101201 3300005563 Archaea 3317
49 Ga0068855_100201111 3300005563 Bacteria 2242
50 Ga0068855_100454161 3300005563 Bacteria 1398
51 Ga0068855_101766056 3300005563 Unclassified 629
52 Ga0070664_101391435 3300005564 Unclassified 663
53 Ga0068856_100660318 3300005614 Bacteria 1066
54 Ga0068852_101059518 3300005616 Bacteria 830
55 Ga0068859_100232175 3300005617 Unclassified 1933
56 Ga0068859_100427248 3300005617 Unclassified 1421
57 Ga0068859_100493234 3300005617 Bacteria 1320
58 Ga0068859_101226272 3300005617 Bacteria 826
59 Ga0068859_102114950 3300005617 Bacteria 621
60 Ga0068864_100276649 3300005618 Unclassified 1566
61 Ga0068864_100361387 3300005618 Unclassified 1372
62 Ga0068863_100541131 3300005841 Bacteria 1149
63 Ga0068863_100755312 3300005841 Bacteria 969
64 Ga0068858_100341923 3300005842 Unclassified 1432
65 Ga0068858_100417713 3300005842 Bacteria 1290
66 Ga0068860_101973890 3300005843 Unclassified 605
67 Ga0068860_102363229 3300005843 Unclassified 552
68 Ga0068860_102383996 3300005843 Unclassified 549
69 Ga0070717_10183670 3300006028 Bacteria 1824
70 Ga0070715_10480176 3300006163 Unclassified 707
71 Ga0070712_101743969 3300006175 Unclassified 545
72 Ga0097621_100070118 3300006237 Unclassified 2894
73 Ga0068871_100303797 3300006358 Bacteria 1401
74 Ga0068871_100333916 3300006358 Unclassified 1337
75 Ga0068871_100637312 3300006358 Unclassified 972
76 Ga0068871_100895653 3300006358 Unclassified 822
77 Ga0068871_101463446 3300006358 Unclassified 645
78 Ga0075428_100016693 3300006844 Bacteria 8107
79 Ga0075428_101554433 3300006844 Bacteria 692
80 Ga0075430_100345341 3300006846 Unclassified 1229
81 Ga0075430_100443218 3300006846 Bacteria 1072
82 Ga0075430_101163132 3300006846 Bacteria 635
83 Ga0075434_100914472 3300006871 Unclassified 892
84 Ga0097620_100232178 3300006931 Unclassified 1933
85 Ga0097620_100427276 3300006931 Unclassified 1421
86 Ga0097620_100493182 3300006931 Bacteria 1320
87 Ga0097620_101226678 3300006931 Bacteria 826
88 Ga0097620_102114415 3300006931 Bacteria 621
89 Ga0105250_10316392 3300009092 Bacteria 677
90 Ga0105240_10002544 3300009093 Bacteria 29242
91 Ga0105240_10123316 3300009093 Unclassified 3118
92 Ga0105240_10132976 3300009093 Bacteria 2981
93 Ga0105240_10780689 3300009093 Unclassified 1036
94 Ga0105240_10982165 3300009093 Unclassified 904
95 Ga0105240_11086301 3300009093 Unclassified 852
96 Ga0105240_12669664 3300009093 Unclassified 516
97 Ga0111539_10291745 3300009094 Unclassified 1898
98 Ga0111539_10533758 3300009094 Bacteria 1367
99 Ga0111539_10903407 3300009094 Bacteria 1027
100 Ga0111539_12846979 3300009094 Unclassified 560
101 Ga0105245_10127113 3300009098 Bacteria 2387
102 Ga0105245_10652293 3300009098 Bacteria 1083
103 Ga0105245_10916783 3300009098 Unclassified 918
104 Ga0105245_12869844 3300009098 Unclassified 534
105 Ga0114129_10426634 3300009147 Bacteria 1743
106 Ga0105243_10439317 3300009148 Bacteria 1221
107 Ga0105242_10026066 3300009176 Bacteria 4630
108 Ga0105242_10181387 3300009176 Unclassified 1858
109 Ga0105242_10803176 3300009176 Bacteria 931
110 Ga0105242_11151630 3300009176 Bacteria 792
111 Ga0105248_10030734 3300009177 Bacteria 5999
112 Ga0105248_10075775 3300009177 Bacteria 3781
113 Ga0105248_10154112 3300009177 Bacteria 2592
114 Ga0105248_10175156 3300009177 Unclassified 2418
115 Ga0105248_10215361 3300009177 Bacteria 2163
116 Ga0105248_10332871 3300009177 Bacteria 1710
117 Ga0105248_10518136 3300009177 Bacteria 1345
118 Ga0105248_10580282 3300009177 Unclassified 1265
119 Ga0105248_10586285 3300009177 Bacteria 1258
120 Ga0105248_11241268 3300009177 Unclassified 843
121 Ga0105248_11404810 3300009177 Unclassified 790
122 Ga0105237_12012060 3300009545 Bacteria 586
123 Ga0105238_10284253 3300009551 Bacteria 1636
124 Ga0105238_10689274 3300009551 Bacteria 1033
125 Ga0105238_11185354 3300009551 Unclassified 788
126 Ga0105238_12174479 3300009551 Bacteria 589
127 Ga0105238_12803482 3300009551 Bacteria 524
128 Ga0157373_10519780 3300013100 Unclassified 861
129 Ga0157371_10566803 3300013102 Bacteria 843
130 Ga0157370_10285656 3300013104 Unclassified 1524
131 Ga0157370_10449780 3300013104 Bacteria 1184
132 Ga0157370_11483976 3300013104 Unclassified 610
133 Ga0157369_10131814 3300013105 Bacteria 2648
134 Ga0157369_10287178 3300013105 Bacteria 1713
135 Ga0157374_10933212 3300013296 Unclassified 886
136 Ga0157374_11680339 3300013296 Unclassified 659
137 Ga0157378_11264606 3300013297 Bacteria 778
138 Ga0157378_11373150 3300013297 Unclassified 749
139 Ga0163162_11289425 3300013306 Bacteria 830
140 Ga0163162_12499525 3300013306 Unclassified 594
141 Ga0157372_10306095 3300013307 Unclassified 1849
142 Ga0157372_10580324 3300013307 Bacteria 1307
143 Ga0157372_11000035 3300013307 Bacteria 969
144 Ga0157372_11529365 3300013307 Unclassified 769
145 Ga0157372_11758229 3300013307 Bacteria 713
146 Ga0157375_10413857 3300013308 Bacteria 1514
147 Ga0157375_10613149 3300013308 Bacteria 1247
148 Ga0157375_10922537 3300013308 Unclassified 1016
149 Ga0157375_10974304 3300013308 Bacteria 989
150 Ga0157375_11412607 3300013308 Unclassified 820
151 Ga0163163_10004559 3300014325 Bacteria 11835
152 Ga0163163_10052304 3300014325 Unclassified 4030
153 Ga0163163_10258636 3300014325 Bacteria 1792
154 Ga0163163_12491402 3300014325 Bacteria 575
155 Ga0157377_10843285 3300014745 Bacteria 680
156 Ga0157379_10040740 3300014968 Bacteria 4146
157 Ga0157379_10874037 3300014968 Bacteria 852
158 Ga0157376_10010251 3300014969 Bacteria 6845
159 Ga0157376_10129883 3300014969 Unclassified 2246
160 Ga0157376_10252235 3300014969 Unclassified 1649
161 Ga0157376_10262552 3300014969 Bacteria 1619
162 Ga0163161_10901648 3300017792 Unclassified 749
163 Ga0207680_10562349 3300025903 Bacteria 814
164 Ga0207699_10189675 3300025906 Unclassified 1386
165 Ga0207705_10027778 3300025909 Bacteria 4035
166 Ga0207705_10433141 3300025909 Bacteria 1019
167 Ga0207705_10628611 3300025909 Unclassified 835
168 Ga0207707_10353846 3300025912 Archaea 1265
169 Ga0207695_10000956 3300025913 Bacteria 51440
170 Ga0207695_10018387 3300025913 Bacteria 8083
171 Ga0207695_10099383 3300025913 Bacteria 2907
172 Ga0207695_10546011 3300025913 Unclassified 1040
173 Ga0207695_10767667 3300025913 Unclassified 844
174 Ga0207695_11448840 3300025913 Unclassified 567
175 Ga0207660_10487828 3300025917 Bacteria 999
176 Ga0207652_10098629 3300025921 Archaea 2577
177 Ga0207652_10849455 3300025921 Unclassified 808
178 Ga0207694_10822634 3300025924 Unclassified 785
179 Ga0207650_10906296 3300025925 Bacteria 749
180 Ga0207700_10253605 3300025928 Bacteria 1504
181 Ga0207700_10397476 3300025928 Bacteria 1207
182 Ga0207644_10595194 3300025931 Bacteria 918
183 Ga0207686_10060443 3300025934 Bacteria 2399
184 Ga0207686_10152270 3300025934 Unclassified 1611
185 Ga0207686_10262440 3300025934 Unclassified 1267
186 Ga0207691_10767885 3300025940 Unclassified 811
187 Ga0207711_10070937 3300025941 Unclassified 3022
188 Ga0207711_10086275 3300025941 Bacteria 2752
189 Ga0207711_10241148 3300025941 Bacteria 1657
190 Ga0207711_10309704 3300025941 Bacteria 1458
191 Ga0207711_10346670 3300025941 Unclassified 1375
192 Ga0207711_10736857 3300025941 Bacteria 919
193 Ga0207661_10180232 3300025944 Bacteria 1845
194 Ga0207661_10339707 3300025944 Unclassified 1353
195 Ga0207667_10108372 3300025949 Bacteria 2866
196 Ga0207667_10179020 3300025949 Archaea 2178
197 Ga0207651_10466266 3300025960 Bacteria 1086
198 Ga0207651_11943040 3300025960 Unclassified 529
199 Ga0207658_11133084 3300025986 Unclassified 715
200 Ga0207658_11225501 3300025986 Bacteria 686
201 Ga0207677_11154818 3300026023 Unclassified 708
202 Ga0207703_10755544 3300026035 Unclassified 927
203 Ga0207703_10880990 3300026035 Unclassified 857
204 Ga0207702_10946719 3300026078 Bacteria 854
205 Ga0207641_10097455 3300026088 Unclassified 2585
206 Ga0207648_10825898 3300026089 Bacteria 863
207 Ga0207676_10422270 3300026095 Unclassified 1251
208 Ga0207676_10444911 3300026095 Unclassified 1220
209 Ga0207676_10516164 3300026095 Unclassified 1137
210 Ga0207675_101324544 3300026118 Unclassified 741
211 Ga0207683_10787345 3300026121 Unclassified 882
212 Ga0207683_10995844 3300026121 Unclassified 778
213 Ga0207428_10919858 3300027907 Bacteria 617
214 Ga0265338_10314137 3300028800 Bacteria 1136
215 Ga0265338_10617477 3300028800 Unclassified 754
216 Ga0265760_10181205 3300031090 Unclassified 704
217 Ga0265340_10107416 3300031247 Unclassified 1293
218 Ga0265340_10299140 3300031247 Unclassified 714
219 Ga0265339_10426458 3300031249 Unclassified 618
220 Ga0265331_10006296 3300031250 Bacteria 7033
221 Ga0265316_10001962 3300031344 Bacteria 21630
222 Ga0265316_10002739 3300031344 Bacteria 18062
223 Ga0265316_10341609 3300031344 Unclassified 1085
224 Ga0265316_10383873 3300031344 Unclassified 1013
225 Ga0265314_10043608 3300031711 Bacteria 3187
226 Ga0265314_10194016 3300031711 Bacteria 1206
227 Ga0265342_10168644 3300031712 Bacteria 1206
228 Ga0265342_10387290 3300031712 Unclassified 723
229 Ga0307409_100227637 3300031995 Bacteria 1688
230 Ga0307414_11388335 3300032004 Unclassified 653
231 Ga0373926_0071127 3300035083 Bacteria 1278
232 Ga0373934_0002010 3300035086 Bacteria 7472
233 Ga0373934_0187275 3300035086 Unclassified 851
234 Ga0373934_0484659 3300035086 Unclassified 519
235 Ga0373923_0003680 3300035111 Unclassified 4960
236 Ga0373954_0013240 3300035118 Unclassified 3674
237 Ga0373954_0036930 3300035118 Bacteria 2269
238 Ga0373954_0394566 3300035118 Bacteria 684
239 Ga0373956_0149622 3300035119 Bacteria 1098
240 Ga0373956_0603175 3300035119 Unclassified 524
241 Ga0373943_0345968 3300035170 Bacteria 851
242 Ga0373955_0066854 3300035172 Unclassified 1999
243 Ga0373935_0095444 3300035692 Bacteria 1953
244 Ga0373935_0135252 3300035692 Unclassified 1660
245 Ga0373927_0003257 3300035695 Bacteria 11681
246 Ga0373947_1018343 3300035725 Bacteria 565
247 Ga0373947_1051458 3300035725 Bacteria 555
248 Ga0373937_0011234 3300036401 Bacteria 7848
249 Ga0373937_0148035 3300036401 Unclassified 2199
250 Ga0373937_0532487 3300036401 Bacteria 1116
251 Ga0373937_1283825 3300036401 Unclassified 680
252 Ga0373937_1747355 3300036401 Unclassified 569
253 Ga0373925_0098924 3300037068 Unclassified 2240
254 Ga0373925_0328232 3300037068 Bacteria 1239
255 Ga0436360_1210798 3300039438 Unclassified 668
256 Ga0466958_0324853 3300045836 Bacteria 989
257 Ga0495592_0003732 3300046454 Bacteria 10977
258 Ga0495592_0012697 3300046454 Bacteria 6402
259 Ga0495592_0270389 3300046454 Bacteria 1115
260 Ga0495629_0344591 3300046459 Bacteria 1017
261 Ga0495629_0348173 3300046459 Bacteria 1011
262 Ga0495629_0940522 3300046459 Unclassified 565
263 Ga0495651_0004343 3300046462 Bacteria 10851
264 Ga0495651_0009982 3300046462 Bacteria 7299
265 Ga0495651_0013171 3300046462 Bacteria 6392
266 Ga0495651_0019400 3300046462 Bacteria 5270
267 Ga0495651_0379709 3300046462 Unclassified 927
268 Ga0495653_0050184 3300046463 Bacteria 3210
269 Ga0495653_0070925 3300046463 Bacteria 2606
270 Ga0495653_0559094 3300046463 Unclassified 707
271 Ga0495580_0288476 3300046472 Bacteria 1119
272 Ga0495580_0788745 3300046472 Unclassified 617
273 Ga0495582_0338612 3300046473 Unclassified 866
274 Ga0495639_0276280 3300046475 Bacteria 834
275 Ga0495662_0010169 3300046476 Bacteria 4610
276 Ga0495662_0030133 3300046476 Bacteria 2619
277 Ga0495662_0286794 3300046476 Unclassified 810
278 Ga0495662_0317657 3300046476 Unclassified 766
279 Ga0495662_0540793 3300046476 Unclassified 571
280 Ga0495664_0001745 3300046477 Bacteria 11552
281 Ga0495664_0007620 3300046477 Bacteria 6016
282 Ga0495664_0009481 3300046477 Bacteria 5448
283 Ga0495664_0180057 3300046477 Unclassified 1282
284 Ga0495594_0030471 3300046499 Bacteria 2920
285 Ga0495608_0404613 3300046511 Unclassified 834
286 Ga0495618_0119334 3300046514 Bacteria 1689
287 Ga0495618_0185761 3300046514 Unclassified 1320
288 Ga0495618_0500475 3300046514 Unclassified 732
289 Ga0495618_0631538 3300046514 Unclassified 635
290 Ga0495628_0004676 3300046516 Bacteria 12076
291 Ga0495628_0031632 3300046516 Bacteria 4279
292 Ga0495628_0087039 3300046516 Bacteria 2422
293 Ga0495628_0211787 3300046516 Unclassified 1457
294 Ga0495628_0251635 3300046516 Bacteria 1319
295 Ga0495628_0375289 3300046516 Bacteria 1042
296 Ga0495628_0460237 3300046516 Unclassified 923
297 Ga0495628_0560355 3300046516 Bacteria 819
298 Ga0495628_0707015 3300046516 Unclassified 711
299 Ga0495628_0824289 3300046516 Unclassified 648
300 Ga0495630_0025111 3300046517 Bacteria 4405
301 Ga0495630_0039466 3300046517 Bacteria 3529
302 Ga0495630_0085988 3300046517 Bacteria 2374
303 Ga0495630_0271884 3300046517 Bacteria 1295
304 Ga0495630_0557640 3300046517 Unclassified 878
305 Ga0495630_0569910 3300046517 Unclassified 868
306 Ga0495630_0926643 3300046517 Unclassified 663
307 Ga0495630_1009921 3300046517 Unclassified 632
308 Ga0495666_0091070 3300046526 Unclassified 1439
309 Ga0495642_0205576 3300046528 Unclassified 859
310 Ga0495652_0009070 3300046529 Bacteria 9052
311 Ga0495652_0071016 3300046529 Bacteria 2908
312 Ga0495652_0603515 3300046529 Bacteria 748
313 Ga0495665_0233111 3300046531 Bacteria 950
314 Ga0495665_0287291 3300046531 Unclassified 843
315 Ga0495640_0089770 3300046533 Bacteria 2029
316 Ga0495640_0125087 3300046533 Bacteria 1668
317 Ga0495640_0229946 3300046533 Bacteria 1167
318 Ga0495640_0383584 3300046533 Unclassified 864
319 Ga0495586_0728435 3300046535 Bacteria 572
320 Ga0495587_0084531 3300046536 Bacteria 1838
321 Ga0495587_0170440 3300046536 Bacteria 1237
322 Ga0495587_0183530 3300046536 Unclassified 1186
323 Ga0495587_0265625 3300046536 Unclassified 963
324 Ga0495645_0001751 3300046543 Bacteria 14751
325 Ga0495645_0035009 3300046543 Bacteria 3661
326 Ga0495645_0107013 3300046543 Unclassified 1982
327 Ga0495645_0168386 3300046543 Bacteria 1509
328 Ga0495645_0237800 3300046543 Bacteria 1217
329 Ga0495645_0677347 3300046543 Unclassified 628
330 Ga0495667_0011483 3300046559 Bacteria 5995
331 Ga0495667_0029751 3300046559 Bacteria 3675
332 Ga0495667_0055943 3300046559 Bacteria 2594
333 Ga0495667_0058794 3300046559 Bacteria 2524
334 Ga0495667_0252869 3300046559 Bacteria 1121
335 Ga0495667_0572550 3300046559 Bacteria 705
336 Ga0495667_0591184 3300046559 Unclassified 692
337 Ga0495634_0024668 3300046642 Bacteria 4216
338 Ga0495634_0055560 3300046642 Bacteria 2647
339 Ga0495634_0131409 3300046642 Bacteria 1596
340 Ga0495634_0364084 3300046642 Bacteria 864
341 Ga0495635_0033855 3300046663 Bacteria 3544
342 Ga0495635_0087758 3300046663 Bacteria 2128
343 Ga0495635_0760503 3300046663 Unclassified 626
344 Ga0495635_0892566 3300046663 Unclassified 569
345 Ga0495657_0618490 3300046675 Bacteria 626
346 Ga0495599_0004212 3300046678 Bacteria 8496
347 Ga0495599_0101087 3300046678 Bacteria 1797
348 Ga0495599_0115260 3300046678 Bacteria 1672
349 Ga0495599_0235212 3300046678 Unclassified 1118
350 Ga0495623_0006893 3300046679 Bacteria 7390
351 Ga0495623_0082566 3300046679 Bacteria 1986
352 Ga0495623_0127854 3300046679 Bacteria 1524
353 Ga0495623_0230713 3300046679 Bacteria 1050
354 Ga0495623_0314887 3300046679 Unclassified 861
355 Ga0495646_0086956 3300046680 Bacteria 1812
356 Ga0495646_0118701 3300046680 Unclassified 1498
357 Ga0495646_0222546 3300046680 Bacteria 1020
358 Ga0495613_0007124 3300046689 Bacteria 8327
359 Ga0495613_0106511 3300046689 Bacteria 2023
360 Ga0495613_0264952 3300046689 Bacteria 1196
361 Ga0495613_0325957 3300046689 Bacteria 1059
362 Ga0495613_0588745 3300046689 Bacteria 741
363 Ga0495600_0031446 3300046809 Bacteria 3439
364 Ga0495600_0091763 3300046809 Bacteria 1981
365 Ga0495600_0344387 3300046809 Unclassified 934
366 Ga0495600_0650658 3300046809 Unclassified 637
367 Ga0495604_0056949 3300047317 Bacteria 3006
368 Ga0495604_0069420 3300047317 Bacteria 2671
369 Ga0495604_0121908 3300047317 Bacteria 1886
370 Ga0495604_0126169 3300047317 Bacteria 1845
371 Ga0495604_0474809 3300047317 Unclassified 814
372 Ga0495604_0947326 3300047317 Unclassified 535
373 Ga0495674_0008607 3300047319 Bacteria 9710
374 Ga0495674_0016480 3300047319 Bacteria 6892
375 Ga0495674_0060670 3300047319 Bacteria 3299
376 Ga0495674_0063641 3300047319 Bacteria 3208
377 Ga0495674_0183677 3300047319 Bacteria 1740
378 Ga0495674_0255209 3300047319 Unclassified 1442
379 Ga0495674_0264289 3300047319 Unclassified 1413
380 Ga0495674_1181305 3300047319 Unclassified 579
381 Ga0495680_0015447 3300047322 Bacteria 6588
382 Ga0495680_0073004 3300047322 Bacteria 2609
383 Ga0495680_0160077 3300047322 Bacteria 1635
384 Ga0495680_0426749 3300047322 Unclassified 911
385 Ga0495675_0022613 3300047444 Bacteria 4009
386 Ga0495675_0042713 3300047444 Bacteria 2888
387 Ga0495675_0101581 3300047444 Bacteria 1799
388 Ga0495675_0221605 3300047444 Unclassified 1144
389 Ga0495675_0274825 3300047444 Unclassified 1006
390 Ga0495675_0538726 3300047444 Unclassified 667
391 Ga0495684_0009951 3300047471 Bacteria 7343
392 Ga0495684_0011079 3300047471 Bacteria 6971
393 Ga0495684_0098271 3300047471 Bacteria 2213
394 Ga0495684_0108776 3300047471 Bacteria 2093
395 Ga0495684_0155573 3300047471 Bacteria 1708
396 Ga0495684_0238202 3300047471 Bacteria 1328
397 Ga0495684_0292487 3300047471 Unclassified 1172
398 Ga0495684_0566063 3300047471 Unclassified 771
399 Ga0495684_0857825 3300047471 Unclassified 588
400 Ga0495602_0021584 3300048088 Bacteria 6331
401 Ga0495602_0069324 3300048088 Bacteria 3023
402 Ga0495602_0219061 3300048088 Bacteria 1438
403 Ga0496104_0586556 3300048907 Unclassified 1025
404 Ga0496105_0423411 3300048908 Unclassified 1054
405 Ga0496114_0001038 3300048917 Bacteria 20893
406 Ga0496115_0152694 3300048918 Bacteria 1907
407 nmdc:mga08y16_1064241_c1 3300050511 Bacteria 786
408 nmdc:mga0n895_1183013_c1 3300050512 Unclassified 739
409 nmdc:mga0n895_1874061_c1 3300050512 Unclassified 559
410 nmdc:mga0rr50_1507574_c1 3300050513 Unclassified 568
411 Ga0495595_0189046 3300053084 Unclassified 1023
412 Ga0495619_0151886 3300053085 Bacteria 1598

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10132976 Ga0105240_101329764 114
2 3300005444 Ga0070694_100951401 Ga0070694_1009514011 119
3 3300005329 Ga0070683_100017304 Ga0070683_1000173042 120
4 3300005364 Ga0070673_102334524 Ga0070673_1023345241 120
5 3300005535 Ga0070684_100426798 Ga0070684_1004267982 120
6 3300005536 Ga0070697_101239873 Ga0070697_1012398731 120
7 3300005843 Ga0068860_101973890 Ga0068860_1019738902 120
8 3300006846 Ga0075430_100345341 Ga0075430_1003453412 120
9 3300009092 Ga0105250_10316392 Ga0105250_103163921 120
10 3300009093 Ga0105240_10780689 Ga0105240_107806892 120
11 3300009094 Ga0111539_10903407 Ga0111539_109034072 120
12 3300009098 Ga0105245_10916783 Ga0105245_109167832 120
13 3300009148 Ga0105243_10439317 Ga0105243_104393171 120
14 3300009176 Ga0105242_10181387 Ga0105242_101813872 120
15 3300009176 Ga0105242_10803176 Ga0105242_108031762 120
16 3300009177 Ga0105248_10030734 Ga0105248_100307342 120
17 3300009551 Ga0105238_10284253 Ga0105238_102842531 120
18 3300013104 Ga0157370_11483976 Ga0157370_114839761 120
19 3300013297 Ga0157378_11264606 Ga0157378_112646062 120
20 3300014325 Ga0163163_10004559 Ga0163163_100045599 120
21 3300014968 Ga0157379_10040740 Ga0157379_100407403 120
22 3300025913 Ga0207695_10000956 Ga0207695_100009565 120
23 3300025913 Ga0207695_10546011 Ga0207695_105460111 120
24 3300025944 Ga0207661_10339707 Ga0207661_103397072 120
25 3300025960 Ga0207651_11943040 Ga0207651_119430401 120
26 3300031344 Ga0265316_10341609 Ga0265316_103416092 120
27 3300035086 Ga0373934_0002010 Ga0373934_0002010_5664_6035 120
28 3300035086 Ga0373934_0484659 Ga0373934_0484659_94_465 120
29 3300035111 Ga0373923_0003680 Ga0373923_0003680_1558_1929 120
30 3300035118 Ga0373954_0013240 Ga0373954_0013240_281_652 120
31 3300035119 Ga0373956_0149622 Ga0373956_0149622_612_983 120
32 3300035172 Ga0373955_0066854 Ga0373955_0066854_907_1278 120
33 3300035692 Ga0373935_0095444 Ga0373935_0095444_1215_1586 120
34 3300035692 Ga0373935_0135252 Ga0373935_0135252_591_962 120
35 3300035725 Ga0373947_1051458 Ga0373947_1051458_156_527 120
36 3300036401 Ga0373937_0011234 Ga0373937_0011234_2151_2522 120
37 3300036401 Ga0373937_0532487 Ga0373937_0532487_625_996 120
38 3300036401 Ga0373937_1747355 Ga0373937_1747355_149_559 120
39 3300045836 Ga0466958_0324853 Ga0466958_0324853_553_963 120
40 3300046454 Ga0495592_0270389 Ga0495592_0270389_309_680 120
41 3300046459 Ga0495629_0348173 Ga0495629_0348173_318_689 120
42 3300046459 Ga0495629_0940522 Ga0495629_0940522_177_548 120
43 3300046462 Ga0495651_0013171 Ga0495651_0013171_5147_5518 120
44 3300046462 Ga0495651_0379709 Ga0495651_0379709_26_397 120
45 3300046463 Ga0495653_0050184 Ga0495653_0050184_2223_2594 120
46 3300046463 Ga0495653_0070925 Ga0495653_0070925_1238_1609 120
47 3300046472 Ga0495580_0788745 Ga0495580_0788745_21_392 120
48 3300046476 Ga0495662_0030133 Ga0495662_0030133_1601_1972 120
49 3300046476 Ga0495662_0286794 Ga0495662_0286794_324_701 120
50 3300046476 Ga0495662_0317657 Ga0495662_0317657_185_553 120
51 3300046477 Ga0495664_0007620 Ga0495664_0007620_3871_4242 120
52 3300046511 Ga0495608_0404613 Ga0495608_0404613_266_637 120
53 3300046514 Ga0495618_0119334 Ga0495618_0119334_56_433 120
54 3300046514 Ga0495618_0185761 Ga0495618_0185761_73_444 120
55 3300046516 Ga0495628_0087039 Ga0495628_0087039_1026_1397 120
56 3300046516 Ga0495628_0211787 Ga0495628_0211787_348_719 120
57 3300046516 Ga0495628_0560355 Ga0495628_0560355_170_541 120
58 3300046517 Ga0495630_0085988 Ga0495630_0085988_147_518 120
59 3300046517 Ga0495630_0557640 Ga0495630_0557640_412_783 120
60 3300046517 Ga0495630_0569910 Ga0495630_0569910_168_536 120
61 3300046529 Ga0495652_0603515 Ga0495652_0603515_332_703 120
62 3300046533 Ga0495640_0089770 Ga0495640_0089770_836_1207 120
63 3300046533 Ga0495640_0125087 Ga0495640_0125087_1199_1570 120
64 3300046536 Ga0495587_0183530 Ga0495587_0183530_344_715 120
65 3300046543 Ga0495645_0001751 Ga0495645_0001751_693_1064 120
66 3300046543 Ga0495645_0035009 Ga0495645_0035009_3232_3603 120
67 3300046559 Ga0495667_0058794 Ga0495667_0058794_884_1255 120
68 3300046559 Ga0495667_0572550 Ga0495667_0572550_157_528 120
69 3300046642 Ga0495634_0024668 Ga0495634_0024668_1026_1397 120
70 3300046642 Ga0495634_0131409 Ga0495634_0131409_1136_1504 120
71 3300046642 Ga0495634_0364084 Ga0495634_0364084_404_775 120
72 3300046663 Ga0495635_0033855 Ga0495635_0033855_1882_2253 120
73 3300046663 Ga0495635_0087758 Ga0495635_0087758_29_400 120
74 3300046675 Ga0495657_0618490 Ga0495657_0618490_31_402 120
75 3300046678 Ga0495599_0115260 Ga0495599_0115260_499_870 120
76 3300046678 Ga0495599_0235212 Ga0495599_0235212_117_488 120
77 3300046679 Ga0495623_0127854 Ga0495623_0127854_643_1014 120
78 3300046680 Ga0495646_0086956 Ga0495646_0086956_894_1265 120
79 3300046689 Ga0495613_0106511 Ga0495613_0106511_423_794 120
80 3300046689 Ga0495613_0264952 Ga0495613_0264952_491_862 120
81 3300046809 Ga0495600_0091763 Ga0495600_0091763_586_957 120
82 3300047317 Ga0495604_0069420 Ga0495604_0069420_1448_1819 120
83 3300047319 Ga0495674_0008607 Ga0495674_0008607_9145_9522 120
84 3300047319 Ga0495674_0183677 Ga0495674_0183677_622_993 120
85 3300047319 Ga0495674_0264289 Ga0495674_0264289_544_915 120
86 3300047322 Ga0495680_0073004 Ga0495680_0073004_2164_2535 120
87 3300047322 Ga0495680_0160077 Ga0495680_0160077_658_1029 120
88 3300047322 Ga0495680_0426749 Ga0495680_0426749_14_385 120
89 3300047444 Ga0495675_0101581 Ga0495675_0101581_609_980 120
90 3300047444 Ga0495675_0274825 Ga0495675_0274825_521_892 120
91 3300047471 Ga0495684_0011079 Ga0495684_0011079_24_395 120
92 3300047471 Ga0495684_0098271 Ga0495684_0098271_1401_1772 120
93 3300047471 Ga0495684_0238202 Ga0495684_0238202_243_614 120
94 3300048088 Ga0495602_0069324 Ga0495602_0069324_808_1179 120
95 3300048088 Ga0495602_0219061 Ga0495602_0219061_69_440 120
96 3300053085 Ga0495619_0151886 Ga0495619_0151886_784_1155 120
97 3300005614 Ga0068856_100660318 Ga0068856_1006603182 121
98 3300009176 Ga0105242_10026066 Ga0105242_100260662 121
99 3300013105 Ga0157369_10287178 Ga0157369_102871782 121
100 3300025934 Ga0207686_10060443 Ga0207686_100604432 121
101 3300048917 Ga0496114_0001038 Ga0496114_0001038_5061_5462 121
102 3300048918 Ga0496115_0152694 Ga0496115_0152694_1482_1883 121
103 3300005563 Ga0068855_100201111 Ga0068855_1002011112 122
104 3300006175 Ga0070712_101743969 Ga0070712_1017439691 122
105 3300009093 Ga0105240_10123316 Ga0105240_101233162 122
106 3300009093 Ga0105240_11086301 Ga0105240_110863011 122
107 3300013102 Ga0157371_10566803 Ga0157371_105668032 122
108 3300013104 Ga0157370_10449780 Ga0157370_104497801 122
109 3300013307 Ga0157372_11000035 Ga0157372_110000351 122
110 3300014325 Ga0163163_12491402 Ga0163163_124914021 122
111 3300025909 Ga0207705_10433141 Ga0207705_104331411 122
112 3300031247 Ga0265340_10107416 Ga0265340_101074162 122
113 3300031344 Ga0265316_10002739 Ga0265316_100027392 122
114 3300005353 Ga0070669_100191167 Ga0070669_1001911672 123
115 3300005367 Ga0070667_100268589 Ga0070667_1002685892 123
116 3300005459 Ga0068867_101559803 Ga0068867_1015598032 123
117 3300005617 Ga0068859_102114950 Ga0068859_1021149501 123
118 3300005618 Ga0068864_100276649 Ga0068864_1002766492 123
119 3300006931 Ga0097620_102114415 Ga0097620_1021144151 123
120 3300009177 Ga0105248_11404810 Ga0105248_114048102 123
121 3300013307 Ga0157372_11758229 Ga0157372_117582292 123
122 3300014745 Ga0157377_10843285 Ga0157377_108432852 123
123 3300025986 Ga0207658_11133084 Ga0207658_111330842 123
124 3300031344 Ga0265316_10001962 Ga0265316_1000196215 123
125 3300039438 Ga0436360_1210798 Ga0436360_1210798_61_444 123
126 3300047319 Ga0495674_1181305 Ga0495674_1181305_56_463 123
127 3300005434 Ga0070709_10157261 Ga0070709_101572612 124
128 3300005436 Ga0070713_101580066 Ga0070713_1015800662 124
129 3300005535 Ga0070684_100034336 Ga0070684_1000343366 124
130 3300005563 Ga0068855_101766056 Ga0068855_1017660561 124
131 3300009093 Ga0105240_10002544 Ga0105240_1000254424 124
132 3300009551 Ga0105238_11185354 Ga0105238_111853542 124
133 3300025913 Ga0207695_10018387 Ga0207695_100183879 124
134 3300025913 Ga0207695_10099383 Ga0207695_100993834 124
135 3300025924 Ga0207694_10822634 Ga0207694_108226342 124
136 3300035086 Ga0373934_0187275 Ga0373934_0187275_354_734 124
137 3300035118 Ga0373954_0036930 Ga0373954_0036930_1679_2059 124
138 3300035119 Ga0373956_0603175 Ga0373956_0603175_23_403 124
139 3300036401 Ga0373937_0148035 Ga0373937_0148035_1622_2002 124
140 3300046454 Ga0495592_0003732 Ga0495592_0003732_9476_9856 124
141 3300046462 Ga0495651_0004343 Ga0495651_0004343_1608_1988 124
142 3300046463 Ga0495653_0559094 Ga0495653_0559094_130_510 124
143 3300046476 Ga0495662_0010169 Ga0495662_0010169_3628_4008 124
144 3300046477 Ga0495664_0001745 Ga0495664_0001745_7293_7673 124
145 3300046514 Ga0495618_0500475 Ga0495618_0500475_216_596 124
146 3300046516 Ga0495628_0004676 Ga0495628_0004676_1449_1829 124
147 3300046517 Ga0495630_0025111 Ga0495630_0025111_3401_3781 124
148 3300046529 Ga0495652_0009070 Ga0495652_0009070_7680_8060 124
149 3300046531 Ga0495665_0233111 Ga0495665_0233111_42_422 124
150 3300046533 Ga0495640_0383584 Ga0495640_0383584_350_730 124
151 3300046536 Ga0495587_0265625 Ga0495587_0265625_493_873 124
152 3300046543 Ga0495645_0107013 Ga0495645_0107013_198_578 124
153 3300046559 Ga0495667_0029751 Ga0495667_0029751_589_969 124
154 3300046642 Ga0495634_0055560 Ga0495634_0055560_2118_2498 124
155 3300046678 Ga0495599_0004212 Ga0495599_0004212_6872_7252 124
156 3300046680 Ga0495646_0222546 Ga0495646_0222546_62_442 124
157 3300046689 Ga0495613_0588745 Ga0495613_0588745_10_387 124
158 3300046809 Ga0495600_0031446 Ga0495600_0031446_2563_2943 124
159 3300047319 Ga0495674_0016480 Ga0495674_0016480_3660_4040 124
160 3300047322 Ga0495680_0015447 Ga0495680_0015447_4063_4443 124
161 3300047444 Ga0495675_0022613 Ga0495675_0022613_37_417 124
162 3300047471 Ga0495684_0108776 Ga0495684_0108776_1110_1490 124
163 3300005434 Ga0070709_10362780 Ga0070709_103627802 125
164 3300005436 Ga0070713_100182629 Ga0070713_1001826292 125
165 3300005618 Ga0068864_100361387 Ga0068864_1003613872 125
166 3300006358 Ga0068871_101463446 Ga0068871_1014634462 125
167 3300006846 Ga0075430_100443218 Ga0075430_1004432182 125
168 3300009147 Ga0114129_10426634 Ga0114129_104266341 125
169 3300009177 Ga0105248_10175156 Ga0105248_101751563 125
170 3300009177 Ga0105248_10332871 Ga0105248_103328712 125
171 3300013306 Ga0163162_12499525 Ga0163162_124995251 125
172 3300013308 Ga0157375_11412607 Ga0157375_114126072 125
173 3300025906 Ga0207699_10189675 Ga0207699_101896751 125
174 3300025928 Ga0207700_10397476 Ga0207700_103974762 125
175 3300025941 Ga0207711_10241148 Ga0207711_102411482 125
176 3300026095 Ga0207676_10444911 Ga0207676_104449112 125
177 3300035118 Ga0373954_0394566 Ga0373954_0394566_234_617 125
178 3300046475 Ga0495639_0276280 Ga0495639_0276280_380_763 125
179 3300046477 Ga0495664_0180057 Ga0495664_0180057_126_512 125
180 3300046516 Ga0495628_0375289 Ga0495628_0375289_556_939 125
181 3300046516 Ga0495628_0460237 Ga0495628_0460237_47_433 125
182 3300046517 Ga0495630_1009921 Ga0495630_1009921_23_409 125
183 3300046543 Ga0495645_0237800 Ga0495645_0237800_431_814 125
184 3300046678 Ga0495599_0101087 Ga0495599_0101087_90_473 125
185 3300046679 Ga0495623_0314887 Ga0495623_0314887_429_812 125
186 3300047317 Ga0495604_0126169 Ga0495604_0126169_32_415 125
187 3300047317 Ga0495604_0474809 Ga0495604_0474809_51_434 125
188 3300047319 Ga0495674_0255209 Ga0495674_0255209_527_910 125
189 3300047444 Ga0495675_0538726 Ga0495675_0538726_255_638 125
190 3300048908 Ga0496105_0423411 Ga0496105_0423411_136_522 125
191 3300005843 Ga0068860_102383996 Ga0068860_1023839961 127
192 3300006163 Ga0070715_10480176 Ga0070715_104801761 127
193 3300006237 Ga0097621_100070118 Ga0097621_1000701183 127
194 3300006358 Ga0068871_100333916 Ga0068871_1003339162 127
195 3300006871 Ga0075434_100914472 Ga0075434_1009144722 127
196 3300009177 Ga0105248_10215361 Ga0105248_102153614 127
197 3300014969 Ga0157376_10129883 Ga0157376_101298832 127
198 3300050512 nmdc:mga0n895_1183013_c1 nmdc:mga0n895_1183013_c1_159_551 127
199 3300050512 nmdc:mga0n895_1874061_c1 nmdc:mga0n895_1874061_c1_40_423 127
200 3300003320 rootH2_10215238 rootH2_102152381 128
201 3300005335 Ga0070666_10595074 Ga0070666_105950741 128
202 3300005343 Ga0070687_100859246 Ga0070687_1008592462 128
203 3300005617 Ga0068859_100493234 Ga0068859_1004932342 128
204 3300005841 Ga0068863_100541131 Ga0068863_1005411312 128
205 3300005842 Ga0068858_100417713 Ga0068858_1004177132 128
206 3300006931 Ga0097620_100493182 Ga0097620_1004931822 128
207 3300009094 Ga0111539_10291745 Ga0111539_102917452 128
208 3300009177 Ga0105248_10154112 Ga0105248_101541123 128
209 3300009545 Ga0105237_12012060 Ga0105237_120120602 128
210 3300013306 Ga0163162_11289425 Ga0163162_112894251 128
211 3300013308 Ga0157375_10974304 Ga0157375_109743042 128
212 3300014968 Ga0157379_10874037 Ga0157379_108740371 128
213 3300025941 Ga0207711_10346670 Ga0207711_103466701 128
214 3300031249 Ga0265339_10426458 Ga0265339_104264581 128
215 3300031250 Ga0265331_10006296 Ga0265331_100062962 128
216 3300031344 Ga0265316_10383873 Ga0265316_103838732 128
217 3300046473 Ga0495582_0338612 Ga0495582_0338612_199_609 128
218 3300046514 Ga0495618_0631538 Ga0495618_0631538_40_432 128
219 3300046517 Ga0495630_0926643 Ga0495630_0926643_204_614 128
220 3300046531 Ga0495665_0287291 Ga0495665_0287291_205_615 128
221 3300046535 Ga0495586_0728435 Ga0495586_0728435_36_428 128
222 3300046663 Ga0495635_0892566 Ga0495635_0892566_108_518 128
223 3300047471 Ga0495684_0292487 Ga0495684_0292487_293_703 128
224 3300005341 Ga0070691_10919093 Ga0070691_109190931 129
225 3300005458 Ga0070681_10252570 Ga0070681_102525702 129
226 3300005530 Ga0070679_100131739 Ga0070679_1001317392 129
227 3300005563 Ga0068855_100101201 Ga0068855_1001012012 129
228 3300009093 Ga0105240_10982165 Ga0105240_109821651 129
229 3300013307 Ga0157372_10306095 Ga0157372_103060952 129
230 3300025909 Ga0207705_10628611 Ga0207705_106286111 129
231 3300025912 Ga0207707_10353846 Ga0207707_103538462 129
232 3300025921 Ga0207652_10098629 Ga0207652_100986292 129
233 3300025949 Ga0207667_10179020 Ga0207667_101790202 129
234 3300031247 Ga0265340_10299140 Ga0265340_102991401 129
235 3300031711 Ga0265314_10194016 Ga0265314_101940162 129
236 3300031712 Ga0265342_10387290 Ga0265342_103872901 129
237 3300048907 Ga0496104_0586556 Ga0496104_0586556_535_933 129
238 3300005327 Ga0070658_10003225 Ga0070658_100032252 130
239 3300005331 Ga0070670_100346421 Ga0070670_1003464212 130
240 3300005335 Ga0070666_11029414 Ga0070666_110294141 130
241 3300005339 Ga0070660_100551923 Ga0070660_1005519232 130
242 3300005340 Ga0070689_100599703 Ga0070689_1005997032 130
243 3300005343 Ga0070687_101066860 Ga0070687_1010668601 130
244 3300005365 Ga0070688_100790368 Ga0070688_1007903681 130
245 3300005440 Ga0070705_100352285 Ga0070705_1003522852 130
246 3300005456 Ga0070678_100631605 Ga0070678_1006316051 130
247 3300005471 Ga0070698_100242860 Ga0070698_1002428602 130
248 3300005543 Ga0070672_101296590 Ga0070672_1012965901 130
249 3300005545 Ga0070695_101336308 Ga0070695_1013363081 130
250 3300005549 Ga0070704_101098413 Ga0070704_1010984132 130
251 3300005563 Ga0068855_100036006 Ga0068855_1000360062 130
252 3300005564 Ga0070664_101391435 Ga0070664_1013914351 130
253 3300005617 Ga0068859_101226272 Ga0068859_1012262722 130
254 3300005841 Ga0068863_100755312 Ga0068863_1007553122 130
255 3300005843 Ga0068860_102363229 Ga0068860_1023632291 130
256 3300006844 Ga0075428_100016693 Ga0075428_1000166932 130
257 3300006844 Ga0075428_101554433 Ga0075428_1015544332 130
258 3300006846 Ga0075430_101163132 Ga0075430_1011631321 130
259 3300006931 Ga0097620_101226678 Ga0097620_1012266782 130
260 3300009094 Ga0111539_10533758 Ga0111539_105337582 130
261 3300009098 Ga0105245_12869844 Ga0105245_128698442 130
262 3300009177 Ga0105248_10580282 Ga0105248_105802822 130
263 3300013105 Ga0157369_10131814 Ga0157369_101318142 130
264 3300013296 Ga0157374_10933212 Ga0157374_109332121 130
265 3300013308 Ga0157375_10922537 Ga0157375_109225372 130
266 3300014325 Ga0163163_10258636 Ga0163163_102586362 130
267 3300014969 Ga0157376_10252235 Ga0157376_102522352 130
268 3300017792 Ga0163161_10901648 Ga0163161_109016481 130
269 3300025909 Ga0207705_10027778 Ga0207705_100277782 130
270 3300025917 Ga0207660_10487828 Ga0207660_104878282 130
271 3300025921 Ga0207652_10849455 Ga0207652_108494551 130
272 3300025925 Ga0207650_10906296 Ga0207650_109062962 130
273 3300025931 Ga0207644_10595194 Ga0207644_105951942 130
274 3300025940 Ga0207691_10767885 Ga0207691_107678851 130
275 3300025949 Ga0207667_10108372 Ga0207667_101083721 130
276 3300025960 Ga0207651_10466266 Ga0207651_104662662 130
277 3300026023 Ga0207677_11154818 Ga0207677_111548182 130
278 3300026035 Ga0207703_10880990 Ga0207703_108809902 130
279 3300026089 Ga0207648_10825898 Ga0207648_108258982 130
280 3300026095 Ga0207676_10516164 Ga0207676_105161642 130
281 3300026121 Ga0207683_10995844 Ga0207683_109958442 130
282 3300027907 Ga0207428_10919858 Ga0207428_109198582 130
283 3300028800 Ga0265338_10617477 Ga0265338_106174772 130
284 3300035170 Ga0373943_0345968 Ga0373943_0345968_304_696 130
285 3300037068 Ga0373925_0328232 Ga0373925_0328232_84_476 130
286 3300046459 Ga0495629_0344591 Ga0495629_0344591_46_438 130
287 3300046689 Ga0495613_0325957 Ga0495613_0325957_249_641 130
288 3300050511 nmdc:mga08y16_1064241_c1 nmdc:mga08y16_1064241_c1_255_653 130
289 3300005334 Ga0068869_100943474 Ga0068869_1009434742 131
290 3300005367 Ga0070667_100463390 Ga0070667_1004633902 131
291 3300005435 Ga0070714_102457348 Ga0070714_1024573481 131
292 3300005436 Ga0070713_100260988 Ga0070713_1002609882 131
293 3300005617 Ga0068859_100232175 Ga0068859_1002321752 131
294 3300006028 Ga0070717_10183670 Ga0070717_101836701 131
295 3300006931 Ga0097620_100232178 Ga0097620_1002321781 131
296 3300009177 Ga0105248_10075775 Ga0105248_100757754 131
297 3300009551 Ga0105238_10689274 Ga0105238_106892741 131
298 3300025928 Ga0207700_10253605 Ga0207700_102536052 131
299 3300025941 Ga0207711_10086275 Ga0207711_100862752 131
300 3300025986 Ga0207658_11225501 Ga0207658_112255012 131
301 3300031995 Ga0307409_100227637 Ga0307409_1002276372 131
302 3300032004 Ga0307414_11388335 Ga0307414_113883352 131
303 3300046462 Ga0495651_0009982 Ga0495651_0009982_6375_6779 131
304 3300046559 Ga0495667_0011483 Ga0495667_0011483_838_1242 131
305 3300046663 Ga0495635_0760503 Ga0495635_0760503_185_589 131
306 3300046679 Ga0495623_0006893 Ga0495623_0006893_4995_5399 131
307 3300047317 Ga0495604_0947326 Ga0495604_0947326_99_503 131
308 3300047444 Ga0495675_0221605 Ga0495675_0221605_11_415 131
309 3300047471 Ga0495684_0009951 Ga0495684_0009951_3955_4359 131
310 3300048088 Ga0495602_0021584 Ga0495602_0021584_5212_5616 131
311 3300005327 Ga0070658_10163596 Ga0070658_101635961 132
312 3300005530 Ga0070679_101594682 Ga0070679_1015946821 132
313 3300005548 Ga0070665_100538199 Ga0070665_1005381992 132
314 3300005616 Ga0068852_101059518 Ga0068852_1010595182 132
315 3300009551 Ga0105238_12803482 Ga0105238_128034821 132
316 3300013104 Ga0157370_10285656 Ga0157370_102856562 132
317 3300013296 Ga0157374_11680339 Ga0157374_116803391 132
318 3300013297 Ga0157378_11373150 Ga0157378_113731502 132
319 3300025913 Ga0207695_10767667 Ga0207695_107676671 132
320 3300028800 Ga0265338_10314137 Ga0265338_103141372 132
321 3300046533 Ga0495640_0229946 Ga0495640_0229946_655_1062 132
322 3300046536 Ga0495587_0170440 Ga0495587_0170440_453_869 132
323 3300046559 Ga0495667_0591184 Ga0495667_0591184_106_522 132
324 3300046679 Ga0495623_0230713 Ga0495623_0230713_268_675 132
325 3300047444 Ga0495675_0042713 Ga0495675_0042713_1500_1907 132
326 3300005435 Ga0070714_100404508 Ga0070714_1004045082 133
327 3300005439 Ga0070711_101334922 Ga0070711_1013349222 133
328 3300005563 Ga0068855_100454161 Ga0068855_1004541612 133
329 3300005617 Ga0068859_100427248 Ga0068859_1004272481 133
330 3300005842 Ga0068858_100341923 Ga0068858_1003419233 133
331 3300006358 Ga0068871_100303797 Ga0068871_1003037972 133
332 3300006358 Ga0068871_100637312 Ga0068871_1006373122 133
333 3300006358 Ga0068871_100895653 Ga0068871_1008956532 133
334 3300006931 Ga0097620_100427276 Ga0097620_1004272761 133
335 3300009098 Ga0105245_10127113 Ga0105245_101271132 133
336 3300009098 Ga0105245_10652293 Ga0105245_106522932 133
337 3300009176 Ga0105242_11151630 Ga0105242_111516302 133
338 3300009177 Ga0105248_10586285 Ga0105248_105862852 133
339 3300009177 Ga0105248_11241268 Ga0105248_112412681 133
340 3300009551 Ga0105238_12174479 Ga0105238_121744791 133
341 3300013307 Ga0157372_10580324 Ga0157372_105803242 133
342 3300013308 Ga0157375_10413857 Ga0157375_104138572 133
343 3300014969 Ga0157376_10262552 Ga0157376_102625522 133
344 3300025903 Ga0207680_10562349 Ga0207680_105623491 133
345 3300025934 Ga0207686_10152270 Ga0207686_101522702 133
346 3300025934 Ga0207686_10262440 Ga0207686_102624402 133
347 3300025941 Ga0207711_10070937 Ga0207711_100709372 133
348 3300025941 Ga0207711_10736857 Ga0207711_107368572 133
349 3300026035 Ga0207703_10755544 Ga0207703_107555441 133
350 3300026118 Ga0207675_101324544 Ga0207675_1013245442 133
351 3300031711 Ga0265314_10043608 Ga0265314_100436082 133
352 3300031712 Ga0265342_10168644 Ga0265342_101686442 133
353 3300035083 Ga0373926_0071127 Ga0373926_0071127_817_1227 133
354 3300035695 Ga0373927_0003257 Ga0373927_0003257_474_884 133
355 3300036401 Ga0373937_1283825 Ga0373937_1283825_246_656 133
356 3300046454 Ga0495592_0012697 Ga0495592_0012697_3083_3493 133
357 3300046462 Ga0495651_0019400 Ga0495651_0019400_3695_4105 133
358 3300046477 Ga0495664_0009481 Ga0495664_0009481_2155_2565 133
359 3300046516 Ga0495628_0031632 Ga0495628_0031632_3694_4104 133
360 3300046516 Ga0495628_0707015 Ga0495628_0707015_121_528 133
361 3300046517 Ga0495630_0039466 Ga0495630_0039466_781_1191 133
362 3300046529 Ga0495652_0071016 Ga0495652_0071016_2303_2713 133
363 3300046543 Ga0495645_0168386 Ga0495645_0168386_447_857 133
364 3300046559 Ga0495667_0055943 Ga0495667_0055943_160_570 133
365 3300046680 Ga0495646_0118701 Ga0495646_0118701_202_612 133
366 3300046689 Ga0495613_0007124 Ga0495613_0007124_1817_2224 133
367 3300046809 Ga0495600_0344387 Ga0495600_0344387_358_768 133
368 3300047317 Ga0495604_0056949 Ga0495604_0056949_501_911 133
369 3300047319 Ga0495674_0060670 Ga0495674_0060670_2655_3065 133
370 3300047319 Ga0495674_0063641 Ga0495674_0063641_2421_2828 133
371 3300047471 Ga0495684_0566063 Ga0495684_0566063_281_691 133
372 3300047471 Ga0495684_0857825 Ga0495684_0857825_31_438 133
373 3300050513 nmdc:mga0rr50_1507574_c1 nmdc:mga0rr50_1507574_c1_57_467 133
374 3300053084 Ga0495595_0189046 Ga0495595_0189046_197_607 133
375 3300005329 Ga0070683_100840275 Ga0070683_1008402752 134
376 3300005468 Ga0070707_101945159 Ga0070707_1019451591 134
377 3300005535 Ga0070684_100141638 Ga0070684_1001416382 134
378 3300009093 Ga0105240_12669664 Ga0105240_126696641 134
379 3300009177 Ga0105248_10518136 Ga0105248_105181362 134
380 3300013100 Ga0157373_10519780 Ga0157373_105197801 134
381 3300013307 Ga0157372_11529365 Ga0157372_115293651 134
382 3300013308 Ga0157375_10613149 Ga0157375_106131492 134
383 3300014325 Ga0163163_10052304 Ga0163163_100523045 134
384 3300014969 Ga0157376_10010251 Ga0157376_100102516 134
385 3300025913 Ga0207695_11448840 Ga0207695_114488402 134
386 3300025941 Ga0207711_10309704 Ga0207711_103097041 134
387 3300025944 Ga0207661_10180232 Ga0207661_101802322 134
388 3300026078 Ga0207702_10946719 Ga0207702_109467192 134
389 3300026088 Ga0207641_10097455 Ga0207641_100974552 134
390 3300026095 Ga0207676_10422270 Ga0207676_104222701 134
391 3300026121 Ga0207683_10787345 Ga0207683_107873452 134
392 3300031090 Ga0265760_10181205 Ga0265760_101812052 134
393 3300035725 Ga0373947_1018343 Ga0373947_1018343_107_517 134
394 3300037068 Ga0373925_0098924 Ga0373925_0098924_50_463 134
395 3300046472 Ga0495580_0288476 Ga0495580_0288476_208_621 134
396 3300046476 Ga0495662_0540793 Ga0495662_0540793_115_525 134
397 3300046499 Ga0495594_0030471 Ga0495594_0030471_1431_1844 134
398 3300046516 Ga0495628_0251635 Ga0495628_0251635_522_932 134
399 3300046516 Ga0495628_0824289 Ga0495628_0824289_16_429 134
400 3300046517 Ga0495630_0271884 Ga0495630_0271884_61_474 134
401 3300046526 Ga0495666_0091070 Ga0495666_0091070_561_974 134
402 3300046528 Ga0495642_0205576 Ga0495642_0205576_414_827 134
403 3300046536 Ga0495587_0084531 Ga0495587_0084531_597_1007 134
404 3300046543 Ga0495645_0677347 Ga0495645_0677347_204_614 134
405 3300046559 Ga0495667_0252869 Ga0495667_0252869_40_450 134
406 3300046679 Ga0495623_0082566 Ga0495623_0082566_783_1193 134
407 3300046809 Ga0495600_0650658 Ga0495600_0650658_150_560 134
408 3300047317 Ga0495604_0121908 Ga0495604_0121908_1377_1787 134
409 3300047471 Ga0495684_0155573 Ga0495684_0155573_664_1074 134
410 3300009094 Ga0111539_12846979 Ga0111539_128469792 135
411 3300003316 rootH1_10027379 rootH1_100273793 142
412 3300003322 rootL2_10095410 rootL2_100954102 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

17

129

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.8991 26 85
2l02-assembly1.cif.gz_A solution nmr structure of protein bt2368 from bacteroides thetaiotaomicron, northeast structural genomics consortium target btr375 0.8836 30 86
2mh2-assembly1.cif.gz_A structural insights into the dna recognition and protein interaction domains reveal fundamental homologous dna pairing properties of hop2 0.8523 31 85
2l02-assembly1.cif.gz_B solution nmr structure of protein bt2368 from bacteroides thetaiotaomicron, northeast structural genomics consortium target btr375 0.8495 30 85
2acj-assembly1.cif.gz_D crystal structure of the b/z junction containing dna bound to z-dna binding proteins 0.8471 25 87
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.941 24 84 1.10.10.10
af_P76066_81_136_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.914 28 84 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.912 24 84 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9052 26 85 1.10.10.10
2d45B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9049 25 85 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A517RB95-F1-model_v4 Penicillinase repressor 0.9576 21 141 GO:0003677
GO:0045892
AF-A0A7Y5WTG9-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9529 18 141 GO:0003677
GO:0045892
AF-A0A142YCB5-F1-model_v4 Transcriptional regulator BlaI 0.9523 24 138 GO:0003677
GO:0045892
AF-A0A800BG55-F1-model_v4 deleted 0.9521 24 141
AF-A0A2V8GI59-F1-model_v4 Transcriptional regulator 0.9502 19 142 GO:0003677
GO:0045892

Feature Viewer

pLDDT pTM Quality
85.99 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map