F437744

General Info

Members Datasets Scaffolds Average Seq Length
412 190 407 181

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100141884|Ga0068853_1001418842
Length 183
Sequence MAHIQVPEGVPGIRSLVMFRPETGKPLYELAQVLLRGESPLTKAERELIAAYVSNRNNTKFCMMSHAAASRVLYGEDNKNIVDEVLADMQQAPISNKLKALVNIAGKVQVLGKEVTEEDIAAARAEGADDREIHDTVLIAASFSMYNRYVDGLASWTPENPEDYVEMGKRMAEKGYVTPKASQ

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
3 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
4 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
5 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
142 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
150 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
151 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
152 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
153 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
154 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
155 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
156 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
159 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
166 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
167 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
168 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
169 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
170 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
171 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
182 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
183 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
190 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.54
Metatranscriptomes 0.24
Isolates 1.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.46
Nodule 0
Rhizoplane 1.21
Rhizosphere 94.42
Stem 0
Stem Tuber 0
Unclassified 2.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10000008 3300002067 Bacteria 319819
2 rootH1_10003385 3300003316 Bacteria 23346
3 rootH1_10045491 3300003316 Bacteria 4170
4 rootH2_10060626 3300003320 Bacteria 6361
5 rootH2_10348052 3300003320 Bacteria 1337
6 rootL2_10243664 3300003322 Bacteria 1515
7 rootL2_10324976 3300003322 Bacteria 1723
8 Ga0065714_10015013 3300005288 Bacteria 3336
9 Ga0065714_10066219 3300005288 Bacteria 7312
10 Ga0065712_10016376 3300005290 Bacteria 1617
11 Ga0065712_10021521 3300005290 Bacteria 1363
12 Ga0070676_10161614 3300005328 Bacteria 1442
13 Ga0070676_10180403 3300005328 Bacteria 1372
14 Ga0070683_100003637 3300005329 Bacteria 12561
15 Ga0070683_100011761 3300005329 Bacteria 7578
16 Ga0070683_100098047 3300005329 Bacteria 2758
17 Ga0070690_100116438 3300005330 Unclassified 1789
18 Ga0070670_100103443 3300005331 Bacteria 2453
19 Ga0070670_100644921 3300005331 Bacteria 950
20 Ga0070670_100792026 3300005331 Bacteria 856
21 Ga0070670_100866349 3300005331 Unclassified 818
22 Ga0070670_101313421 3300005331 Bacteria 662
23 Ga0068869_100055979 3300005334 Bacteria 2875
24 Ga0070666_10011946 3300005335 Bacteria 5465
25 Ga0070666_10082386 3300005335 Unclassified 2200
26 Ga0070666_10200815 3300005335 Bacteria 1403
27 Ga0070666_10387862 3300005335 Bacteria 1003
28 Ga0070680_100146467 3300005336 Unclassified 1982
29 Ga0070682_100012589 3300005337 Bacteria 4853
30 Ga0068868_100006082 3300005338 Bacteria 8522
31 Ga0068868_100027791 3300005338 Bacteria 4318
32 Ga0068868_100082773 3300005338 Unclassified 2575
33 Ga0068868_101253915 3300005338 Unclassified 687
34 Ga0070660_100008421 3300005339 Bacteria 7209
35 Ga0070689_100011496 3300005340 Bacteria 6345
36 Ga0070689_100021087 3300005340 Bacteria 4845
37 Ga0070689_100056331 3300005340 Bacteria 3048
38 Ga0070687_100046021 3300005343 Bacteria 2232
39 Ga0070661_100017287 3300005344 Bacteria 5114
40 Ga0070661_100137233 3300005344 Bacteria 1841
41 Ga0070669_100060250 3300005353 Bacteria 2788
42 Ga0070675_100029705 3300005354 Bacteria 4410
43 Ga0070671_100099078 3300005355 Bacteria 2444
44 Ga0070671_100123012 3300005355 Unclassified 2184
45 Ga0070673_100067169 3300005364 Unclassified 2866
46 Ga0070673_100224408 3300005364 Unclassified 1627
47 Ga0070673_100697554 3300005364 Bacteria 932
48 Ga0070688_100049502 3300005365 Bacteria 2615
49 Ga0070688_100077129 3300005365 Unclassified 2146
50 Ga0070688_100132133 3300005365 Bacteria 1685
51 Ga0070659_100020174 3300005366 Bacteria 5060
52 Ga0070667_100062584 3300005367 Bacteria 3152
53 Ga0070667_100136526 3300005367 Bacteria 2145
54 Ga0070667_100879242 3300005367 Bacteria 834
55 Ga0070667_101202788 3300005367 Bacteria 709
56 Ga0070663_100254328 3300005455 Unclassified 1391
57 Ga0070663_100314325 3300005455 Bacteria 1258
58 Ga0070663_100375571 3300005455 Bacteria 1156
59 Ga0070678_100092093 3300005456 Unclassified 2328
60 Ga0070678_100370743 3300005456 Bacteria 1236
61 Ga0070678_100453793 3300005456 Bacteria 1123
62 Ga0070662_100031159 3300005457 Unclassified 3740
63 Ga0070662_100188231 3300005457 Unclassified 1630
64 Ga0070681_10052532 3300005458 Unclassified 4065
65 Ga0068867_100015280 3300005459 Bacteria 5442
66 Ga0068867_100123939 3300005459 Bacteria 2000
67 Ga0068867_100319274 3300005459 Bacteria 1286
68 Ga0068867_100746679 3300005459 Bacteria 868
69 Ga0068867_101369056 3300005459 Unclassified 655
70 Ga0070685_10006766 3300005466 Bacteria 5848
71 Ga0070685_10025654 3300005466 Unclassified 3245
72 Ga0070679_100082378 3300005530 Unclassified 3207
73 Ga0070684_100005417 3300005535 Bacteria 9776
74 Ga0070684_100014199 3300005535 Bacteria 6443
75 Ga0070684_100170688 3300005535 Bacteria 1976
76 Ga0070684_100594491 3300005535 Bacteria 1029
77 Ga0068853_100036632 3300005539 Unclassified 4173
78 Ga0068853_100141884 3300005539 Unclassified 2157
79 Ga0068853_100780384 3300005539 Bacteria 914
80 Ga0068853_101064911 3300005539 Bacteria 779
81 Ga0070672_100153390 3300005543 Unclassified 1907
82 Ga0070672_100506110 3300005543 Unclassified 1045
83 Ga0070686_100114597 3300005544 Unclassified 1842
84 Ga0070686_100302642 3300005544 Bacteria 1186
85 Ga0070696_101167528 3300005546 Bacteria 649
86 Ga0070665_100059440 3300005548 Bacteria 3832
87 Ga0068855_100013689 3300005563 Bacteria 9783
88 Ga0068855_100191491 3300005563 Bacteria 2306
89 Ga0070664_100017508 3300005564 Bacteria 5886
90 Ga0070664_100026264 3300005564 Bacteria 4829
91 Ga0070664_100209895 3300005564 Bacteria 1740
92 Ga0070664_100471688 3300005564 Bacteria 1154
93 Ga0068857_100021942 3300005577 Bacteria 5620
94 Ga0068857_100719639 3300005577 Bacteria 949
95 Ga0068854_100034688 3300005578 Unclassified 3526
96 Ga0068856_100218132 3300005614 Bacteria 1923
97 Ga0068852_100032375 3300005616 Bacteria 4329
98 Ga0068852_100157255 3300005616 Bacteria 2119
99 Ga0068852_100258785 3300005616 Unclassified 1670
100 Ga0068852_100265695 3300005616 Bacteria 1649
101 Ga0068852_100470066 3300005616 Bacteria 1248
102 Ga0068852_100483240 3300005616 Bacteria 1231
103 Ga0068852_101147532 3300005616 Bacteria 798
104 Ga0068859_100000006 3300005617 Bacteria 421509
105 Ga0068859_100003526 3300005617 Bacteria 15932
106 Ga0068859_100019096 3300005617 Bacteria 6884
107 Ga0068859_100116743 3300005617 Bacteria 2733
108 Ga0068859_100151559 3300005617 Unclassified 2394
109 Ga0068859_100204131 3300005617 Bacteria 2061
110 Ga0068859_100265211 3300005617 Bacteria 1809
111 Ga0068859_100275004 3300005617 Bacteria 1776
112 Ga0068864_100002292 3300005618 Bacteria 15821
113 Ga0068864_100644699 3300005618 Bacteria 1031
114 Ga0068866_10737191 3300005718 Bacteria 679
115 Ga0068861_100123432 3300005719 Bacteria 2092
116 Ga0068861_100230996 3300005719 Bacteria 1569
117 Ga0068861_100565841 3300005719 Bacteria 1038
118 Ga0068851_10269926 3300005834 Bacteria 970
119 Ga0068863_100011610 3300005841 Bacteria 8523
120 Ga0068863_100044515 3300005841 Bacteria 4213
121 Ga0068863_100170005 3300005841 Bacteria 2090
122 Ga0068863_100529385 3300005841 Bacteria 1162
123 Ga0068863_100749667 3300005841 Bacteria 972
124 Ga0068858_100000396 3300005842 Bacteria 45694
125 Ga0068858_100139531 3300005842 Bacteria 2275
126 Ga0068858_100342736 3300005842 Bacteria 1430
127 Ga0068858_101572921 3300005842 Bacteria 649
128 Ga0068860_100000208 3300005843 Bacteria 92818
129 Ga0068860_100003067 3300005843 Bacteria 17262
130 Ga0068860_100019654 3300005843 Bacteria 6550
131 Ga0068860_100048583 3300005843 Bacteria 4044
132 Ga0068862_100022098 3300005844 Bacteria 5322
133 Ga0068862_100502933 3300005844 Bacteria 1150
134 Ga0097621_100016225 3300006237 Bacteria 5625
135 Ga0097621_100131770 3300006237 Unclassified 2129
136 Ga0097621_100167882 3300006237 Bacteria 1890
137 Ga0097621_100210597 3300006237 Bacteria 1691
138 Ga0097621_100732585 3300006237 Bacteria 912
139 Ga0075370_10297120 3300006353 Bacteria 960
140 Ga0075370_10496590 3300006353 Bacteria 736
141 Ga0068871_100004064 3300006358 Bacteria 10122
142 Ga0068871_100110843 3300006358 Bacteria 2308
143 Ga0068871_100218955 3300006358 Bacteria 1649
144 Ga0068871_100439451 3300006358 Bacteria 1168
145 Ga0068871_100449597 3300006358 Unclassified 1155
146 Ga0068871_100460992 3300006358 Bacteria 1141
147 Ga0068871_100888919 3300006358 Unclassified 825
148 Ga0068865_100370755 3300006881 Bacteria 1165
149 Ga0097620_100000006 3300006931 Bacteria 421509
150 Ga0097620_100003526 3300006931 Bacteria 15932
151 Ga0097620_100019096 3300006931 Bacteria 6884
152 Ga0097620_100116744 3300006931 Bacteria 2733
153 Ga0097620_100151561 3300006931 Unclassified 2394
154 Ga0097620_100204133 3300006931 Bacteria 2061
155 Ga0097620_100265205 3300006931 Bacteria 1809
156 Ga0097620_100274995 3300006931 Bacteria 1776
157 Ga0105251_10148090 3300009011 Bacteria 1061
158 Ga0105245_10069442 3300009098 Unclassified 3195
159 Ga0105247_10004067 3300009101 Bacteria 9402
160 Ga0105247_10643700 3300009101 Bacteria 791
161 Ga0105241_10003858 3300009174 Bacteria 11111
162 Ga0105242_10322272 3300009176 Bacteria 1418
163 Ga0105242_10577425 3300009176 Bacteria 1082
164 Ga0105242_11509223 3300009176 Bacteria 703
165 Ga0105248_10211936 3300009177 Unclassified 2183
166 Ga0105237_10004722 3300009545 Bacteria 15671
167 Ga0105237_10468756 3300009545 Bacteria 1265
168 Ga0105249_10014190 3300009553 Bacteria 7043
169 Ga0105249_10017394 3300009553 Bacteria 6382
170 Ga0105249_10023217 3300009553 Bacteria 5564
171 Ga0105249_10037611 3300009553 Bacteria 4392
172 Ga0105249_10158358 3300009553 Bacteria 2186
173 Ga0105249_10285415 3300009553 Bacteria 1650
174 Ga0105239_10056134 3300010375 Bacteria 4319
175 Ga0105246_10037353 3300011119 Unclassified 3260
176 Ga0157373_10016772 3300013100 Bacteria 5338
177 Ga0157371_10000959 3300013102 Bacteria 31997
178 Ga0157371_10004973 3300013102 Bacteria 11416
179 Ga0157371_10127373 3300013102 Bacteria 1811
180 Ga0157371_10244668 3300013102 Bacteria 1291
181 Ga0157370_10003210 3300013104 Bacteria 19329
182 Ga0157370_10190487 3300013104 Unclassified 1904
183 Ga0157370_10580256 3300013104 Bacteria 1027
184 Ga0157369_10071162 3300013105 Bacteria 3735
185 Ga0157369_10335449 3300013105 Bacteria 1571
186 Ga0157369_10620331 3300013105 Bacteria 1116
187 Ga0157374_10001515 3300013296 Bacteria 19575
188 Ga0157374_10013240 3300013296 Bacteria 7196
189 Ga0157374_10104082 3300013296 Unclassified 2725
190 Ga0157374_10360129 3300013296 Bacteria 1446
191 Ga0157374_10835647 3300013296 Bacteria 937
192 Ga0157378_10075067 3300013297 Unclassified 3043
193 Ga0157378_10167454 3300013297 Bacteria 2059
194 Ga0157378_10333952 3300013297 Unclassified 1476
195 Ga0157378_10525406 3300013297 Bacteria 1185
196 Ga0157378_10730910 3300013297 Bacteria 1011
197 Ga0163162_10000519 3300013306 Bacteria 35771
198 Ga0163162_10001839 3300013306 Bacteria 19962
199 Ga0163162_10004331 3300013306 Bacteria 13665
200 Ga0163162_10017466 3300013306 Bacteria 7019
201 Ga0163162_10020220 3300013306 Bacteria 6538
202 Ga0163162_10037822 3300013306 Bacteria 4816
203 Ga0163162_10179881 3300013306 Bacteria 2241
204 Ga0163162_10243174 3300013306 Bacteria 1931
205 Ga0163162_10260268 3300013306 Bacteria 1867
206 Ga0163162_10719973 3300013306 Unclassified 1119
207 Ga0157372_10003302 3300013307 Bacteria 17425
208 Ga0157372_10526745 3300013307 Bacteria 1377
209 Ga0157372_10552884 3300013307 Bacteria 1342
210 Ga0157372_10779950 3300013307 Unclassified 1111
211 Ga0157372_11137315 3300013307 Bacteria 903
212 Ga0157372_11662958 3300013307 Bacteria 735
213 Ga0157375_10007898 3300013308 Bacteria 9314
214 Ga0157375_10024030 3300013308 Bacteria 5634
215 Ga0157375_10079088 3300013308 Bacteria 3323
216 Ga0157375_10180943 3300013308 Bacteria 2259
217 Ga0157375_10678609 3300013308 Unclassified 1185
218 Ga0157375_11142443 3300013308 Bacteria 912
219 Ga0163163_10000385 3300014325 Bacteria 41966
220 Ga0163163_10142191 3300014325 Bacteria 2442
221 Ga0163163_11539040 3300014325 Bacteria 726
222 Ga0157380_11525297 3300014326 Bacteria 722
223 Ga0157377_10013004 3300014745 Bacteria 4202
224 Ga0157377_10097140 3300014745 Bacteria 1749
225 Ga0157379_10022898 3300014968 Bacteria 5538
226 Ga0157379_10225513 3300014968 Bacteria 1698
227 Ga0157379_10261363 3300014968 Bacteria 1573
228 Ga0157379_10266233 3300014968 Bacteria 1558
229 Ga0157379_10269853 3300014968 Bacteria 1547
230 Ga0157376_10027204 3300014969 Bacteria 4530
231 Ga0163161_10043353 3300017792 Unclassified 3239
232 Ga0163161_10181874 3300017792 Bacteria 1612
233 Ga0207697_10045209 3300025315 Unclassified 1812
234 Ga0207656_10027362 3300025321 Bacteria 2332
235 Ga0207642_10353541 3300025899 Bacteria 867
236 Ga0207710_10010821 3300025900 Bacteria 3841
237 Ga0207688_10575087 3300025901 Unclassified 709
238 Ga0207680_10019858 3300025903 Unclassified 3603
239 Ga0207680_10037101 3300025903 Bacteria 2812
240 Ga0207645_10008717 3300025907 Bacteria 7062
241 Ga0207705_10742829 3300025909 Unclassified 762
242 Ga0207654_10002506 3300025911 Bacteria 9327
243 Ga0207707_10791050 3300025912 Unclassified 791
244 Ga0207671_10003558 3300025914 Bacteria 15439
245 Ga0207660_10525573 3300025917 Bacteria 961
246 Ga0207662_10076078 3300025918 Bacteria 2040
247 Ga0207657_10011327 3300025919 Bacteria 8855
248 Ga0207657_10352784 3300025919 Bacteria 1160
249 Ga0207649_10004576 3300025920 Bacteria 7502
250 Ga0207649_10041348 3300025920 Unclassified 2806
251 Ga0207652_10032836 3300025921 Bacteria 4367
252 Ga0207652_11242397 3300025921 Bacteria 647
253 Ga0207646_10457067 3300025922 Bacteria 1152
254 Ga0207681_10021255 3300025923 Bacteria 4123
255 Ga0207681_10149662 3300025923 Bacteria 1748
256 Ga0207650_10081362 3300025925 Bacteria 2457
257 Ga0207650_10704565 3300025925 Bacteria 853
258 Ga0207650_11042472 3300025925 Bacteria 696
259 Ga0207650_11139270 3300025925 Bacteria 664
260 Ga0207659_10072474 3300025926 Unclassified 2518
261 Ga0207687_10037836 3300025927 Bacteria 3294
262 Ga0207644_10086491 3300025931 Bacteria 2328
263 Ga0207644_10129525 3300025931 Unclassified 1930
264 Ga0207644_10764317 3300025931 Bacteria 808
265 Ga0207706_10006551 3300025933 Bacteria 10787
266 Ga0207706_10019620 3300025933 Bacteria 6082
267 Ga0207706_10196354 3300025933 Unclassified 1770
268 Ga0207706_10725191 3300025933 Bacteria 848
269 Ga0207686_11002729 3300025934 Bacteria 678
270 Ga0207670_10296311 3300025936 Bacteria 1265
271 Ga0207704_10008312 3300025938 Bacteria 4954
272 Ga0207704_10209560 3300025938 Bacteria 1433
273 Ga0207704_10919104 3300025938 Bacteria 737
274 Ga0207691_10115291 3300025940 Bacteria 2386
275 Ga0207691_10449405 3300025940 Bacteria 1097
276 Ga0207711_10179427 3300025941 Unclassified 1925
277 Ga0207689_10000383 3300025942 Bacteria 41569
278 Ga0207689_10011340 3300025942 Bacteria 7645
279 Ga0207689_10065753 3300025942 Bacteria 2982
280 Ga0207689_10077764 3300025942 Bacteria 2727
281 Ga0207661_10331049 3300025944 Bacteria 1371
282 Ga0207667_10051993 3300025949 Unclassified 4317
283 Ga0207667_10202581 3300025949 Bacteria 2035
284 Ga0207651_10071095 3300025960 Unclassified 2465
285 Ga0207651_10132277 3300025960 Unclassified 1912
286 Ga0207712_10000728 3300025961 Bacteria 25095
287 Ga0207712_10010308 3300025961 Bacteria 5932
288 Ga0207712_10027927 3300025961 Bacteria 3771
289 Ga0207712_10084017 3300025961 Bacteria 2325
290 Ga0207712_10099969 3300025961 Unclassified 2154
291 Ga0207712_10575506 3300025961 Bacteria 971
292 Ga0207640_10033923 3300025981 Unclassified 3181
293 Ga0207640_10407672 3300025981 Unclassified 1109
294 Ga0207658_10035617 3300025986 Bacteria 3566
295 Ga0207658_10078929 3300025986 Unclassified 2517
296 Ga0207658_10111058 3300025986 Bacteria 2167
297 Ga0207658_10453965 3300025986 Bacteria 1135
298 Ga0207677_10035380 3300026023 Unclassified 3244
299 Ga0207677_10100858 3300026023 Unclassified 2124
300 Ga0207677_10210522 3300026023 Bacteria 1552
301 Ga0207677_10232809 3300026023 Unclassified 1485
302 Ga0207703_10014761 3300026035 Bacteria 6097
303 Ga0207703_10032157 3300026035 Bacteria 4152
304 Ga0207703_11362115 3300026035 Bacteria 682
305 Ga0207639_10302027 3300026041 Bacteria 1415
306 Ga0207678_10019272 3300026067 Bacteria 5992
307 Ga0207641_10000280 3300026088 Bacteria 64281
308 Ga0207641_10067785 3300026088 Bacteria 3058
309 Ga0207641_10343635 3300026088 Bacteria 1421
310 Ga0207641_10480437 3300026088 Bacteria 1204
311 Ga0207648_10013414 3300026089 Bacteria 7626
312 Ga0207648_10698709 3300026089 Bacteria 940
313 Ga0207676_10006644 3300026095 Bacteria 8175
314 Ga0207676_10009951 3300026095 Bacteria 6763
315 Ga0207676_10089610 3300026095 Bacteria 2522
316 Ga0207676_10118904 3300026095 Bacteria 2225
317 Ga0207676_10122856 3300026095 Bacteria 2193
318 Ga0207676_10736394 3300026095 Bacteria 958
319 Ga0207676_11867473 3300026095 Bacteria 599
320 Ga0207674_10013460 3300026116 Bacteria 9074
321 Ga0207674_10073626 3300026116 Bacteria 3429
322 Ga0207675_100138766 3300026118 Bacteria 2308
323 Ga0207675_100218832 3300026118 Bacteria 1834
324 Ga0207675_100354071 3300026118 Bacteria 1439
325 Ga0207675_100443436 3300026118 Bacteria 1285
326 Ga0207683_10396340 3300026121 Bacteria 1270
327 Ga0207683_10626713 3300026121 Bacteria 996
328 Ga0207683_11424942 3300026121 Unclassified 640
329 Ga0207698_10076417 3300026142 Unclassified 2680
330 Ga0207698_10230788 3300026142 Unclassified 1680
331 Ga0207698_10366065 3300026142 Bacteria 1367
332 Ga0207698_10394619 3300026142 Bacteria 1320
333 Ga0207698_10421506 3300026142 Unclassified 1281
334 Ga0207698_10425660 3300026142 Bacteria 1275
335 Ga0268266_10037333 3300028379 Unclassified 4140
336 Ga0268266_10539180 3300028379 Bacteria 1117
337 Ga0268265_10440120 3300028380 Bacteria 1215
338 Ga0268264_10000041 3300028381 Bacteria 372501
339 Ga0268264_10004703 3300028381 Bacteria 11599
340 Ga0268264_10118785 3300028381 Bacteria 2327
341 Ga0268264_10447521 3300028381 Bacteria 1251
342 Ga0307515_10002325 3300028794 Bacteria 41513
343 Ga0307515_10003790 3300028794 Bacteria 31653
344 Ga0265760_10141467 3300031090 Bacteria 784
345 Ga0307509_10447731 3300031507 Unclassified 986
346 Ga0265313_10081022 3300031595 Bacteria 1474
347 Ga0395901_0925764 3300038443 Bacteria 852
348 Ga0436365_0224801 3300039437 Bacteria 875
349 Ga0466967_0270465 3300045976 Bacteria 1628
350 Ga0495638_0090868 3300046460 Bacteria 1840
351 Ga0495650_0000025 3300046471 Bacteria 486001
352 Ga0495580_0406942 3300046472 Bacteria 917
353 Ga0495585_0000017 3300046492 Bacteria 164054
354 Ga0495585_0002164 3300046492 Bacteria 14290
355 Ga0495606_0000026 3300046507 Bacteria 259118
356 Ga0495610_0001154 3300046512 Bacteria 24024
357 Ga0495610_0033241 3300046512 Bacteria 2669
358 Ga0495616_0009063 3300046513 Bacteria 5839
359 Ga0495631_0232070 3300046518 Bacteria 787
360 Ga0495648_0013497 3300046524 Bacteria 6032
361 Ga0495654_0035847 3300046530 Bacteria 2495
362 Ga0495609_0002911 3300046538 Bacteria 10191
363 Ga0495609_0043107 3300046538 Bacteria 2026
364 Ga0495645_0206780 3300046543 Bacteria 1328
365 Ga0495622_0085574 3300046557 Bacteria 1450
366 Ga0495633_0000015 3300046558 Bacteria 254484
367 Ga0495633_0018083 3300046558 Bacteria 3585
368 Ga0495668_0000041 3300046616 Bacteria 229462
369 Ga0495625_0000008 3300046660 Bacteria 536165
370 Ga0495625_0000941 3300046660 Bacteria 39077
371 Ga0495625_0033135 3300046660 Bacteria 3823
372 Ga0495625_0312825 3300046660 Bacteria 1002
373 Ga0495661_0024429 3300046665 Bacteria 3912
374 Ga0495661_0043767 3300046665 Bacteria 2750
375 Ga0495646_0397170 3300046680 Bacteria 717
376 Ga0495658_0055720 3300046683 Bacteria 2253
377 Ga0495671_0106921 3300046692 Bacteria 1366
378 Ga0495649_0000006 3300046694 Bacteria 542188
379 Ga0495589_0062300 3300046794 Bacteria 1830
380 Ga0495672_0047931 3300047320 Bacteria 2538
381 Ga0495672_0097490 3300047320 Bacteria 1601
382 Ga0495672_0325044 3300047320 Bacteria 721
383 Ga0495683_0142854 3300047323 Bacteria 1120
384 Ga0495687_008000 3300047443 Bacteria 6124
385 Ga0495687_037035 3300047443 Bacteria 2176
386 Ga0495673_0016052 3300047469 Bacteria 3841
387 Ga0495686_0180094 3300047472 Bacteria 1225
388 Ga0495614_0200142 3300048089 Bacteria 903
389 Ga0496104_1452421 3300048907 Bacteria 589
390 Ga0496110_0205323 3300048913 Bacteria 1791
391 Ga0496110_1053988 3300048913 Bacteria 721
392 Ga0496111_0537080 3300048914 Bacteria 859
393 Ga0501037_0352709 3300049573 Bacteria 1015
394 Ga0501039_1112601 3300049575 Unclassified 612
395 Ga0501070_0842256 3300049586 Bacteria 718
396 Ga0501073_0471268 3300049589 Bacteria 868
397 Ga0501202_039686 3300049652 Unclassified 1012
398 Ga0501236_000114 3300049670 Bacteria 7682
399 Ga0501257_002015 3300049686 Bacteria 4231
400 Ga0501080_0633741 3300049742 Bacteria 947
401 Ga0501264_000216 3300049761 Bacteria 9346
402 Ga0501035_1036099 3300049822 Bacteria 644
403 nmdc:mga07m45_238508_c1 3300050496 Bacteria 1058
404 nmdc:mga08y16_1316761_c1 3300050511 Bacteria 688
405 Ga0500608_006589 3300053122 Bacteria 4738
406 Ga0500622_0089934 3300053156 Bacteria 1525
407 Ga0500622_0202439 3300053156 Bacteria 902

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046472 Ga0495580_0406942 Ga0495580_0406942_36_515 158
2 3300039437 Ga0436365_0224801 Ga0436365_0224801_35_523 161
3 3300005834 Ga0068851_10269926 Ga0068851_102699262 164
4 3300025981 Ga0207640_10407672 Ga0207640_104076722 164
5 3300026116 Ga0207674_10073626 Ga0207674_100736263 164
6 3300046538 Ga0495609_0043107 Ga0495609_0043107_37_531 164
7 3300046680 Ga0495646_0397170 Ga0495646_0397170_11_514 164
8 3300047472 Ga0495686_0180094 Ga0495686_0180094_176_670 164
9 3300049652 Ga0501202_039686 Ga0501202_039686_37_537 164
10 3300053156 Ga0500622_0202439 Ga0500622_0202439_42_551 164
11 3300038443 Ga0395901_0925764 Ga0395901_0925764_183_773 169
12 3300045976 Ga0466967_0270465 Ga0466967_0270465_963_1559 170
13 iso_pu_bacteria 2919437846 2919441921 176
14 3300013307 Ga0157372_11662958 Ga0157372_116629582 177
15 3300049575 Ga0501039_1112601 Ga0501039_1112601_25_561 177
16 iso_pu_bacteria 2599185184 2599476659 177
17 iso_pu_bacteria 2928078545 2928078609 177
18 iso_pu_bacteria 2928147474 2928151714 177
19 iso_pu_bacteria 2932082852 2932084331 177
20 3300005329 Ga0070683_100003637 Ga0070683_1000036379 178
21 3300005330 Ga0070690_100116438 Ga0070690_1001164383 178
22 3300005335 Ga0070666_10082386 Ga0070666_100823862 178
23 3300005336 Ga0070680_100146467 Ga0070680_1001464672 178
24 3300005337 Ga0070682_100012589 Ga0070682_1000125893 178
25 3300005339 Ga0070660_100008421 Ga0070660_1000084213 178
26 3300005344 Ga0070661_100137233 Ga0070661_1001372333 178
27 3300005354 Ga0070675_100029705 Ga0070675_1000297054 178
28 3300005355 Ga0070671_100123012 Ga0070671_1001230122 178
29 3300005364 Ga0070673_100067169 Ga0070673_1000671692 178
30 3300005366 Ga0070659_100020174 Ga0070659_1000201744 178
31 3300005455 Ga0070663_100254328 Ga0070663_1002543282 178
32 3300005456 Ga0070678_100092093 Ga0070678_1000920932 178
33 3300005457 Ga0070662_100031159 Ga0070662_1000311594 178
34 3300005458 Ga0070681_10052532 Ga0070681_100525325 178
35 3300005530 Ga0070679_100082378 Ga0070679_1000823783 178
36 3300005535 Ga0070684_100005417 Ga0070684_1000054175 178
37 3300005539 Ga0068853_100036632 Ga0068853_1000366322 178
38 3300005544 Ga0070686_100114597 Ga0070686_1001145972 178
39 3300005563 Ga0068855_100013689 Ga0068855_1000136896 178
40 3300005564 Ga0070664_100026264 Ga0070664_1000262643 178
41 3300005577 Ga0068857_100021942 Ga0068857_1000219423 178
42 3300005578 Ga0068854_100034688 Ga0068854_1000346882 178
43 3300005614 Ga0068856_100218132 Ga0068856_1002181323 178
44 3300005616 Ga0068852_100032375 Ga0068852_1000323752 178
45 3300005616 Ga0068852_101147532 Ga0068852_1011475321 178
46 3300006237 Ga0097621_100016225 Ga0097621_1000162255 178
47 3300006358 Ga0068871_100110843 Ga0068871_1001108432 178
48 3300013100 Ga0157373_10016772 Ga0157373_100167723 178
49 3300013102 Ga0157371_10127373 Ga0157371_101273732 178
50 3300013102 Ga0157371_10244668 Ga0157371_102446682 178
51 3300013104 Ga0157370_10190487 Ga0157370_101904872 178
52 3300013105 Ga0157369_10335449 Ga0157369_103354491 178
53 3300013296 Ga0157374_10013240 Ga0157374_100132405 178
54 3300013296 Ga0157374_10104082 Ga0157374_101040824 178
55 3300013297 Ga0157378_10167454 Ga0157378_101674543 178
56 3300013297 Ga0157378_10525406 Ga0157378_105254062 178
57 3300013306 Ga0163162_10179881 Ga0163162_101798812 178
58 3300013307 Ga0157372_10779950 Ga0157372_107799502 178
59 3300013308 Ga0157375_10678609 Ga0157375_106786092 178
60 3300014745 Ga0157377_10097140 Ga0157377_100971402 178
61 3300025901 Ga0207688_10575087 Ga0207688_105750871 178
62 3300025903 Ga0207680_10019858 Ga0207680_100198585 178
63 3300025909 Ga0207705_10742829 Ga0207705_107428291 178
64 3300025912 Ga0207707_10791050 Ga0207707_107910502 178
65 3300025917 Ga0207660_10525573 Ga0207660_105255732 178
66 3300025919 Ga0207657_10011327 Ga0207657_100113276 178
67 3300025920 Ga0207649_10041348 Ga0207649_100413481 178
68 3300025921 Ga0207652_10032836 Ga0207652_100328363 178
69 3300025921 Ga0207652_11242397 Ga0207652_112423971 178
70 3300025926 Ga0207659_10072474 Ga0207659_100724742 178
71 3300025931 Ga0207644_10129525 Ga0207644_101295252 178
72 3300025933 Ga0207706_10006551 Ga0207706_100065515 178
73 3300025949 Ga0207667_10051993 Ga0207667_100519932 178
74 3300025960 Ga0207651_10132277 Ga0207651_101322772 178
75 3300025981 Ga0207640_10033923 Ga0207640_100339232 178
76 3300026023 Ga0207677_10232809 Ga0207677_102328092 178
77 3300026035 Ga0207703_11362115 Ga0207703_113621151 178
78 3300026121 Ga0207683_10396340 Ga0207683_103963402 178
79 3300026142 Ga0207698_10076417 Ga0207698_100764172 178
80 3300048913 Ga0496110_1053988 Ga0496110_1053988_157_693 178
81 3300005331 Ga0070670_100644921 Ga0070670_1006449211 179
82 3300014968 Ga0157379_10266233 Ga0157379_102662332 179
83 3300003316 rootH1_10045491 rootH1_100454912 180
84 3300003322 rootL2_10324976 rootL2_103249762 180
85 3300005288 Ga0065714_10015013 Ga0065714_100150132 180
86 3300005290 Ga0065712_10016376 Ga0065712_100163762 180
87 3300005328 Ga0070676_10161614 Ga0070676_101616142 180
88 3300005328 Ga0070676_10180403 Ga0070676_101804032 180
89 3300005335 Ga0070666_10200815 Ga0070666_102008151 180
90 3300005338 Ga0068868_100027791 Ga0068868_1000277914 180
91 3300005340 Ga0070689_100056331 Ga0070689_1000563312 180
92 3300005365 Ga0070688_100132133 Ga0070688_1001321332 180
93 3300005367 Ga0070667_100136526 Ga0070667_1001365262 180
94 3300005456 Ga0070678_100370743 Ga0070678_1003707432 180
95 3300005459 Ga0068867_100015280 Ga0068867_1000152802 180
96 3300005535 Ga0070684_100594491 Ga0070684_1005944912 180
97 3300005539 Ga0068853_100780384 Ga0068853_1007803842 180
98 3300005544 Ga0070686_100302642 Ga0070686_1003026422 180
99 3300005548 Ga0070665_100059440 Ga0070665_1000594402 180
100 3300005564 Ga0070664_100209895 Ga0070664_1002098952 180
101 3300005616 Ga0068852_100265695 Ga0068852_1002656952 180
102 3300005617 Ga0068859_100019096 Ga0068859_1000190965 180
103 3300005617 Ga0068859_100265211 Ga0068859_1002652112 180
104 3300005719 Ga0068861_100123432 Ga0068861_1001234322 180
105 3300005841 Ga0068863_100529385 Ga0068863_1005293852 180
106 3300005842 Ga0068858_100139531 Ga0068858_1001395313 180
107 3300006237 Ga0097621_100210597 Ga0097621_1002105972 180
108 3300006358 Ga0068871_100460992 Ga0068871_1004609922 180
109 3300006931 Ga0097620_100019096 Ga0097620_1000190965 180
110 3300006931 Ga0097620_100265205 Ga0097620_1002652052 180
111 3300009011 Ga0105251_10148090 Ga0105251_101480901 180
112 3300009176 Ga0105242_10577425 Ga0105242_105774251 180
113 3300009553 Ga0105249_10023217 Ga0105249_100232175 180
114 3300009553 Ga0105249_10285415 Ga0105249_102854152 180
115 3300013297 Ga0157378_10730910 Ga0157378_107309102 180
116 3300013306 Ga0163162_10004331 Ga0163162_100043317 180
117 3300013306 Ga0163162_10037822 Ga0163162_100378222 180
118 3300013307 Ga0157372_10526745 Ga0157372_105267452 180
119 3300013308 Ga0157375_10079088 Ga0157375_100790884 180
120 3300013308 Ga0157375_10180943 Ga0157375_101809433 180
121 3300014325 Ga0163163_11539040 Ga0163163_115390402 180
122 3300014745 Ga0157377_10013004 Ga0157377_100130044 180
123 3300014968 Ga0157379_10261363 Ga0157379_102613633 180
124 3300014968 Ga0157379_10269853 Ga0157379_102698532 180
125 3300017792 Ga0163161_10043353 Ga0163161_100433532 180
126 3300025907 Ga0207645_10008717 Ga0207645_100087173 180
127 3300025925 Ga0207650_10704565 Ga0207650_107045652 180
128 3300025933 Ga0207706_10019620 Ga0207706_100196204 180
129 3300025936 Ga0207670_10296311 Ga0207670_102963112 180
130 3300025942 Ga0207689_10065753 Ga0207689_100657532 180
131 3300025944 Ga0207661_10331049 Ga0207661_103310491 180
132 3300025961 Ga0207712_10027927 Ga0207712_100279271 180
133 3300025961 Ga0207712_10084017 Ga0207712_100840173 180
134 3300025986 Ga0207658_10078929 Ga0207658_100789292 180
135 3300026023 Ga0207677_10210522 Ga0207677_102105222 180
136 3300026041 Ga0207639_10302027 Ga0207639_103020272 180
137 3300026089 Ga0207648_10013414 Ga0207648_100134146 180
138 3300026095 Ga0207676_10122856 Ga0207676_101228562 180
139 3300026118 Ga0207675_100138766 Ga0207675_1001387662 180
140 3300028379 Ga0268266_10037333 Ga0268266_100373334 180
141 3300031595 Ga0265313_10081022 Ga0265313_100810222 180
142 3300048089 Ga0495614_0200142 Ga0495614_0200142_64_609 180
143 3300048907 Ga0496104_1452421 Ga0496104_1452421_23_568 180
144 3300048913 Ga0496110_0205323 Ga0496110_0205323_152_694 180
145 3300048914 Ga0496111_0537080 Ga0496111_0537080_146_688 180
146 3300002067 JGI24735J21928_10000008 JGI24735J21928_10000008185 181
147 3300003316 rootH1_10003385 rootH1_1000338524 181
148 3300003320 rootH2_10060626 rootH2_100606261 181
149 3300003320 rootH2_10348052 rootH2_103480521 181
150 3300003322 rootL2_10243664 rootL2_102436642 181
151 3300005288 Ga0065714_10066219 Ga0065714_100662193 181
152 3300005290 Ga0065712_10021521 Ga0065712_100215212 181
153 3300005329 Ga0070683_100011761 Ga0070683_1000117614 181
154 3300005329 Ga0070683_100098047 Ga0070683_1000980473 181
155 3300005331 Ga0070670_100103443 Ga0070670_1001034432 181
156 3300005331 Ga0070670_100792026 Ga0070670_1007920262 181
157 3300005331 Ga0070670_100866349 Ga0070670_1008663491 181
158 3300005331 Ga0070670_101313421 Ga0070670_1013134211 181
159 3300005334 Ga0068869_100055979 Ga0068869_1000559792 181
160 3300005335 Ga0070666_10011946 Ga0070666_100119463 181
161 3300005335 Ga0070666_10387862 Ga0070666_103878622 181
162 3300005338 Ga0068868_100006082 Ga0068868_1000060826 181
163 3300005338 Ga0068868_100082773 Ga0068868_1000827732 181
164 3300005338 Ga0068868_101253915 Ga0068868_1012539151 181
165 3300005340 Ga0070689_100011496 Ga0070689_1000114964 181
166 3300005340 Ga0070689_100021087 Ga0070689_1000210872 181
167 3300005343 Ga0070687_100046021 Ga0070687_1000460213 181
168 3300005344 Ga0070661_100017287 Ga0070661_1000172873 181
169 3300005353 Ga0070669_100060250 Ga0070669_1000602504 181
170 3300005355 Ga0070671_100099078 Ga0070671_1000990783 181
171 3300005364 Ga0070673_100224408 Ga0070673_1002244082 181
172 3300005364 Ga0070673_100697554 Ga0070673_1006975541 181
173 3300005365 Ga0070688_100049502 Ga0070688_1000495022 181
174 3300005365 Ga0070688_100077129 Ga0070688_1000771292 181
175 3300005367 Ga0070667_100062584 Ga0070667_1000625842 181
176 3300005367 Ga0070667_100879242 Ga0070667_1008792421 181
177 3300005367 Ga0070667_101202788 Ga0070667_1012027881 181
178 3300005455 Ga0070663_100314325 Ga0070663_1003143252 181
179 3300005455 Ga0070663_100375571 Ga0070663_1003755712 181
180 3300005456 Ga0070678_100453793 Ga0070678_1004537932 181
181 3300005457 Ga0070662_100188231 Ga0070662_1001882312 181
182 3300005459 Ga0068867_100123939 Ga0068867_1001239392 181
183 3300005459 Ga0068867_100319274 Ga0068867_1003192742 181
184 3300005459 Ga0068867_100746679 Ga0068867_1007466791 181
185 3300005459 Ga0068867_101369056 Ga0068867_1013690561 181
186 3300005466 Ga0070685_10006766 Ga0070685_100067666 181
187 3300005466 Ga0070685_10025654 Ga0070685_100256543 181
188 3300005535 Ga0070684_100014199 Ga0070684_1000141997 181
189 3300005535 Ga0070684_100170688 Ga0070684_1001706883 181
190 3300005539 Ga0068853_100141884 Ga0068853_1001418842 181
191 3300005539 Ga0068853_101064911 Ga0068853_1010649111 181
192 3300005543 Ga0070672_100153390 Ga0070672_1001533901 181
193 3300005543 Ga0070672_100506110 Ga0070672_1005061102 181
194 3300005546 Ga0070696_101167528 Ga0070696_1011675281 181
195 3300005563 Ga0068855_100191491 Ga0068855_1001914912 181
196 3300005564 Ga0070664_100017508 Ga0070664_1000175086 181
197 3300005564 Ga0070664_100471688 Ga0070664_1004716881 181
198 3300005577 Ga0068857_100719639 Ga0068857_1007196392 181
199 3300005616 Ga0068852_100157255 Ga0068852_1001572552 181
200 3300005616 Ga0068852_100258785 Ga0068852_1002587852 181
201 3300005616 Ga0068852_100470066 Ga0068852_1004700662 181
202 3300005616 Ga0068852_100483240 Ga0068852_1004832402 181
203 3300005617 Ga0068859_100000006 Ga0068859_100000006212 181
204 3300005617 Ga0068859_100003526 Ga0068859_10000352613 181
205 3300005617 Ga0068859_100116743 Ga0068859_1001167432 181
206 3300005617 Ga0068859_100151559 Ga0068859_1001515593 181
207 3300005617 Ga0068859_100204131 Ga0068859_1002041313 181
208 3300005617 Ga0068859_100275004 Ga0068859_1002750042 181
209 3300005618 Ga0068864_100002292 Ga0068864_10000229213 181
210 3300005618 Ga0068864_100644699 Ga0068864_1006446992 181
211 3300005718 Ga0068866_10737191 Ga0068866_107371911 181
212 3300005719 Ga0068861_100230996 Ga0068861_1002309962 181
213 3300005719 Ga0068861_100565841 Ga0068861_1005658412 181
214 3300005841 Ga0068863_100011610 Ga0068863_1000116104 181
215 3300005841 Ga0068863_100044515 Ga0068863_1000445152 181
216 3300005841 Ga0068863_100170005 Ga0068863_1001700052 181
217 3300005841 Ga0068863_100749667 Ga0068863_1007496672 181
218 3300005842 Ga0068858_100000396 Ga0068858_10000039640 181
219 3300005842 Ga0068858_100342736 Ga0068858_1003427363 181
220 3300005842 Ga0068858_101572921 Ga0068858_1015729212 181
221 3300005843 Ga0068860_100000208 Ga0068860_10000020833 181
222 3300005843 Ga0068860_100003067 Ga0068860_10000306716 181
223 3300005843 Ga0068860_100019654 Ga0068860_1000196545 181
224 3300005843 Ga0068860_100048583 Ga0068860_1000485832 181
225 3300005844 Ga0068862_100022098 Ga0068862_1000220985 181
226 3300005844 Ga0068862_100502933 Ga0068862_1005029332 181
227 3300006237 Ga0097621_100131770 Ga0097621_1001317703 181
228 3300006237 Ga0097621_100167882 Ga0097621_1001678823 181
229 3300006237 Ga0097621_100732585 Ga0097621_1007325852 181
230 3300006353 Ga0075370_10297120 Ga0075370_102971202 181
231 3300006353 Ga0075370_10496590 Ga0075370_104965901 181
232 3300006358 Ga0068871_100004064 Ga0068871_10000406412 181
233 3300006358 Ga0068871_100218955 Ga0068871_1002189552 181
234 3300006358 Ga0068871_100439451 Ga0068871_1004394512 181
235 3300006358 Ga0068871_100449597 Ga0068871_1004495971 181
236 3300006358 Ga0068871_100888919 Ga0068871_1008889192 181
237 3300006881 Ga0068865_100370755 Ga0068865_1003707552 181
238 3300006931 Ga0097620_100000006 Ga0097620_100000006212 181
239 3300006931 Ga0097620_100003526 Ga0097620_10000352613 181
240 3300006931 Ga0097620_100116744 Ga0097620_1001167442 181
241 3300006931 Ga0097620_100151561 Ga0097620_1001515613 181
242 3300006931 Ga0097620_100204133 Ga0097620_1002041333 181
243 3300006931 Ga0097620_100274995 Ga0097620_1002749952 181
244 3300009098 Ga0105245_10069442 Ga0105245_100694423 181
245 3300009101 Ga0105247_10004067 Ga0105247_100040674 181
246 3300009101 Ga0105247_10643700 Ga0105247_106437001 181
247 3300009174 Ga0105241_10003858 Ga0105241_100038587 181
248 3300009176 Ga0105242_10322272 Ga0105242_103222723 181
249 3300009176 Ga0105242_11509223 Ga0105242_115092231 181
250 3300009177 Ga0105248_10211936 Ga0105248_102119362 181
251 3300009545 Ga0105237_10004722 Ga0105237_1000472210 181
252 3300009545 Ga0105237_10468756 Ga0105237_104687562 181
253 3300009553 Ga0105249_10014190 Ga0105249_100141907 181
254 3300009553 Ga0105249_10017394 Ga0105249_100173943 181
255 3300009553 Ga0105249_10037611 Ga0105249_100376113 181
256 3300009553 Ga0105249_10158358 Ga0105249_101583582 181
257 3300010375 Ga0105239_10056134 Ga0105239_100561345 181
258 3300011119 Ga0105246_10037353 Ga0105246_100373533 181
259 3300013102 Ga0157371_10000959 Ga0157371_100009597 181
260 3300013102 Ga0157371_10004973 Ga0157371_100049734 181
261 3300013104 Ga0157370_10003210 Ga0157370_1000321015 181
262 3300013104 Ga0157370_10580256 Ga0157370_105802562 181
263 3300013105 Ga0157369_10071162 Ga0157369_100711623 181
264 3300013105 Ga0157369_10620331 Ga0157369_106203312 181
265 3300013296 Ga0157374_10001515 Ga0157374_1000151515 181
266 3300013296 Ga0157374_10360129 Ga0157374_103601292 181
267 3300013296 Ga0157374_10835647 Ga0157374_108356471 181
268 3300013297 Ga0157378_10075067 Ga0157378_100750674 181
269 3300013297 Ga0157378_10333952 Ga0157378_103339522 181
270 3300013306 Ga0163162_10000519 Ga0163162_100005192 181
271 3300013306 Ga0163162_10001839 Ga0163162_1000183912 181
272 3300013306 Ga0163162_10017466 Ga0163162_100174667 181
273 3300013306 Ga0163162_10020220 Ga0163162_100202202 181
274 3300013306 Ga0163162_10243174 Ga0163162_102431742 181
275 3300013306 Ga0163162_10260268 Ga0163162_102602682 181
276 3300013306 Ga0163162_10719973 Ga0163162_107199732 181
277 3300013307 Ga0157372_10003302 Ga0157372_100033026 181
278 3300013307 Ga0157372_10552884 Ga0157372_105528842 181
279 3300013307 Ga0157372_11137315 Ga0157372_111373152 181
280 3300013308 Ga0157375_10007898 Ga0157375_100078987 181
281 3300013308 Ga0157375_10024030 Ga0157375_100240305 181
282 3300013308 Ga0157375_11142443 Ga0157375_111424432 181
283 3300014325 Ga0163163_10000385 Ga0163163_1000038516 181
284 3300014325 Ga0163163_10142191 Ga0163163_101421913 181
285 3300014326 Ga0157380_11525297 Ga0157380_115252971 181
286 3300014968 Ga0157379_10022898 Ga0157379_100228985 181
287 3300014968 Ga0157379_10225513 Ga0157379_102255131 181
288 3300014969 Ga0157376_10027204 Ga0157376_100272042 181
289 3300017792 Ga0163161_10181874 Ga0163161_101818741 181
290 3300025315 Ga0207697_10045209 Ga0207697_100452092 181
291 3300025321 Ga0207656_10027362 Ga0207656_100273622 181
292 3300025899 Ga0207642_10353541 Ga0207642_103535411 181
293 3300025900 Ga0207710_10010821 Ga0207710_100108213 181
294 3300025903 Ga0207680_10037101 Ga0207680_100371013 181
295 3300025911 Ga0207654_10002506 Ga0207654_1000250610 181
296 3300025914 Ga0207671_10003558 Ga0207671_1000355812 181
297 3300025918 Ga0207662_10076078 Ga0207662_100760782 181
298 3300025919 Ga0207657_10352784 Ga0207657_103527842 181
299 3300025920 Ga0207649_10004576 Ga0207649_100045762 181
300 3300025922 Ga0207646_10457067 Ga0207646_104570672 181
301 3300025923 Ga0207681_10021255 Ga0207681_100212553 181
302 3300025923 Ga0207681_10149662 Ga0207681_101496622 181
303 3300025925 Ga0207650_10081362 Ga0207650_100813622 181
304 3300025925 Ga0207650_11042472 Ga0207650_110424721 181
305 3300025925 Ga0207650_11139270 Ga0207650_111392702 181
306 3300025927 Ga0207687_10037836 Ga0207687_100378362 181
307 3300025931 Ga0207644_10086491 Ga0207644_100864912 181
308 3300025931 Ga0207644_10764317 Ga0207644_107643172 181
309 3300025933 Ga0207706_10196354 Ga0207706_101963542 181
310 3300025933 Ga0207706_10725191 Ga0207706_107251911 181
311 3300025934 Ga0207686_11002729 Ga0207686_110027291 181
312 3300025938 Ga0207704_10008312 Ga0207704_100083122 181
313 3300025938 Ga0207704_10209560 Ga0207704_102095602 181
314 3300025938 Ga0207704_10919104 Ga0207704_109191041 181
315 3300025940 Ga0207691_10115291 Ga0207691_101152913 181
316 3300025940 Ga0207691_10449405 Ga0207691_104494051 181
317 3300025941 Ga0207711_10179427 Ga0207711_101794272 181
318 3300025942 Ga0207689_10000383 Ga0207689_1000038331 181
319 3300025942 Ga0207689_10011340 Ga0207689_100113403 181
320 3300025942 Ga0207689_10077764 Ga0207689_100777643 181
321 3300025949 Ga0207667_10202581 Ga0207667_102025812 181
322 3300025960 Ga0207651_10071095 Ga0207651_100710952 181
323 3300025961 Ga0207712_10000728 Ga0207712_100007283 181
324 3300025961 Ga0207712_10010308 Ga0207712_100103082 181
325 3300025961 Ga0207712_10099969 Ga0207712_100999692 181
326 3300025961 Ga0207712_10575506 Ga0207712_105755062 181
327 3300025986 Ga0207658_10035617 Ga0207658_100356172 181
328 3300025986 Ga0207658_10111058 Ga0207658_101110583 181
329 3300025986 Ga0207658_10453965 Ga0207658_104539652 181
330 3300026023 Ga0207677_10035380 Ga0207677_100353802 181
331 3300026023 Ga0207677_10100858 Ga0207677_101008582 181
332 3300026035 Ga0207703_10014761 Ga0207703_100147613 181
333 3300026035 Ga0207703_10032157 Ga0207703_100321574 181
334 3300026067 Ga0207678_10019272 Ga0207678_100192725 181
335 3300026088 Ga0207641_10000280 Ga0207641_1000028052 181
336 3300026088 Ga0207641_10067785 Ga0207641_100677853 181
337 3300026088 Ga0207641_10343635 Ga0207641_103436352 181
338 3300026088 Ga0207641_10480437 Ga0207641_104804372 181
339 3300026089 Ga0207648_10698709 Ga0207648_106987091 181
340 3300026095 Ga0207676_10006644 Ga0207676_100066441 181
341 3300026095 Ga0207676_10009951 Ga0207676_100099514 181
342 3300026095 Ga0207676_10089610 Ga0207676_100896103 181
343 3300026095 Ga0207676_10118904 Ga0207676_101189041 181
344 3300026095 Ga0207676_10736394 Ga0207676_107363942 181
345 3300026095 Ga0207676_11867473 Ga0207676_118674731 181
346 3300026116 Ga0207674_10013460 Ga0207674_100134607 181
347 3300026118 Ga0207675_100218832 Ga0207675_1002188322 181
348 3300026118 Ga0207675_100354071 Ga0207675_1003540712 181
349 3300026118 Ga0207675_100443436 Ga0207675_1004434362 181
350 3300026121 Ga0207683_10626713 Ga0207683_106267132 181
351 3300026121 Ga0207683_11424942 Ga0207683_114249421 181
352 3300026142 Ga0207698_10230788 Ga0207698_102307882 181
353 3300026142 Ga0207698_10366065 Ga0207698_103660652 181
354 3300026142 Ga0207698_10394619 Ga0207698_103946192 181
355 3300026142 Ga0207698_10421506 Ga0207698_104215062 181
356 3300026142 Ga0207698_10425660 Ga0207698_104256602 181
357 3300028379 Ga0268266_10539180 Ga0268266_105391802 181
358 3300028380 Ga0268265_10440120 Ga0268265_104401202 181
359 3300028381 Ga0268264_10000041 Ga0268264_1000004152 181
360 3300028381 Ga0268264_10004703 Ga0268264_100047032 181
361 3300028381 Ga0268264_10118785 Ga0268264_101187852 181
362 3300028381 Ga0268264_10447521 Ga0268264_104475212 181
363 3300028794 Ga0307515_10002325 Ga0307515_1000232526 181
364 3300028794 Ga0307515_10003790 Ga0307515_1000379017 181
365 3300031090 Ga0265760_10141467 Ga0265760_101414672 181
366 3300031507 Ga0307509_10447731 Ga0307509_104477311 181
367 3300046460 Ga0495638_0090868 Ga0495638_0090868_750_1295 181
368 3300046471 Ga0495650_0000025 Ga0495650_0000025_34076_34621 181
369 3300046492 Ga0495585_0000017 Ga0495585_0000017_41919_42464 181
370 3300046492 Ga0495585_0002164 Ga0495585_0002164_8522_9070 181
371 3300046507 Ga0495606_0000026 Ga0495606_0000026_44776_45321 181
372 3300046512 Ga0495610_0001154 Ga0495610_0001154_12765_13310 181
373 3300046512 Ga0495610_0033241 Ga0495610_0033241_830_1375 181
374 3300046513 Ga0495616_0009063 Ga0495616_0009063_1285_1830 181
375 3300046518 Ga0495631_0232070 Ga0495631_0232070_136_684 181
376 3300046524 Ga0495648_0013497 Ga0495648_0013497_2390_2938 181
377 3300046530 Ga0495654_0035847 Ga0495654_0035847_76_624 181
378 3300046538 Ga0495609_0002911 Ga0495609_0002911_4469_5017 181
379 3300046543 Ga0495645_0206780 Ga0495645_0206780_96_653 181
380 3300046557 Ga0495622_0085574 Ga0495622_0085574_132_680 181
381 3300046558 Ga0495633_0000015 Ga0495633_0000015_144954_145502 181
382 3300046558 Ga0495633_0018083 Ga0495633_0018083_585_1130 181
383 3300046616 Ga0495668_0000041 Ga0495668_0000041_19287_19835 181
384 3300046660 Ga0495625_0000008 Ga0495625_0000008_261714_262259 181
385 3300046660 Ga0495625_0000941 Ga0495625_0000941_34959_35507 181
386 3300046660 Ga0495625_0033135 Ga0495625_0033135_2483_3031 181
387 3300046660 Ga0495625_0312825 Ga0495625_0312825_239_790 181
388 3300046665 Ga0495661_0024429 Ga0495661_0024429_910_1455 181
389 3300046665 Ga0495661_0043767 Ga0495661_0043767_1103_1648 181
390 3300046683 Ga0495658_0055720 Ga0495658_0055720_1167_1715 181
391 3300046692 Ga0495671_0106921 Ga0495671_0106921_363_908 181
392 3300046694 Ga0495649_0000006 Ga0495649_0000006_487215_487760 181
393 3300046794 Ga0495589_0062300 Ga0495589_0062300_68_613 181
394 3300047320 Ga0495672_0047931 Ga0495672_0047931_267_821 181
395 3300047320 Ga0495672_0097490 Ga0495672_0097490_122_673 181
396 3300047320 Ga0495672_0325044 Ga0495672_0325044_118_666 181
397 3300047323 Ga0495683_0142854 Ga0495683_0142854_397_942 181
398 3300047443 Ga0495687_008000 Ga0495687_008000_578_1123 181
399 3300047443 Ga0495687_037035 Ga0495687_037035_524_1069 181
400 3300047469 Ga0495673_0016052 Ga0495673_0016052_2809_3354 181
401 3300049573 Ga0501037_0352709 Ga0501037_0352709_406_966 181
402 3300049586 Ga0501070_0842256 Ga0501070_0842256_84_644 181
403 3300049589 Ga0501073_0471268 Ga0501073_0471268_88_648 181
404 3300049670 Ga0501236_000114 Ga0501236_000114_2134_2685 181
405 3300049686 Ga0501257_002015 Ga0501257_002015_2237_2788 181
406 3300049742 Ga0501080_0633741 Ga0501080_0633741_369_929 181
407 3300049761 Ga0501264_000216 Ga0501264_000216_1861_2412 181
408 3300049822 Ga0501035_1036099 Ga0501035_1036099_10_570 181
409 3300050496 nmdc:mga07m45_238508_c1 nmdc:mga07m45_238508_c1_302_862 181
410 3300050511 nmdc:mga08y16_1316761_c1 nmdc:mga08y16_1316761_c1_54_617 181
411 3300053122 Ga0500608_006589 Ga0500608_006589_4115_4663 181
412 3300053156 Ga0500622_0089934 Ga0500622_0089934_616_1161 181

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pfx-assembly1.cif.gz_A crystal structure of uncharacterized peroxidase-related protein (yp_614459.1) from silicibacter sp. tm1040 at 1.70 a resolution 0.9166 13 164
2prr-assembly1.cif.gz_E crystal structure of alkylhydroperoxidase ahpd core: uncharacterized peroxidase-related protein (yp_296737.1) from ralstonia eutropha jmp134 at 2.15 a resolution 0.8992 16 168
3c1l-assembly2.cif.gz_J crystal structure of an antioxidant defense protein (mlr4105) from mesorhizobium loti maff303099 at 2.00 a resolution 0.8932 13 164
3c1l-assembly1.cif.gz_B crystal structure of an antioxidant defense protein (mlr4105) from mesorhizobium loti maff303099 at 2.00 a resolution 0.8846 10 164
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.8717 16 159
ID Description Score Start End Superfamily
2prrB02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8884 41 148 1.20.1290.10
af_A4HXU1_714_811_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8882 16 76 1.20.1290.10
2oyoB02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8837 41 164 1.20.1290.10
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8747 16 159 1.20.1290.10
3c1lB02 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8633 41 166 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A368JSR1-F1-model_v4 Carboxymuconolactone decarboxylase 0.9714 1 181 GO:0051920
AF-W2ET34-F1-model_v4 Carboxymuconolactone decarboxylase 0.9703 32 174 GO:0051920
AF-A0A3G4W9T4-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9688 18 171 GO:0051920
AF-A0A6P0SH39-F1-model_v4 Carboxymuconolactone decarboxylase 0.9671 36 176 GO:0051920
AF-A0A368JSR1-F1-model_v4 Carboxymuconolactone decarboxylase 0.9662 1 181 GO:0051920

Feature Viewer

pLDDT pTM Quality
90.96 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map