F437543

General Info

Members Datasets Scaffolds Average Seq Length
411 192 822 157

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_10520082|Ga0207648_105200822
Length 184
Sequence MRSARYALRRLTVSRSSRSRSNTVCASAAVLGRLAATCSNCGTKNRLAFDKLGGAVRCGQCKQPLSSVNVPVDLHATADFDRIVAQSSLPVLVDYWAPWCGPCRMVAPELEKVAARQSGKLLVVKVNTDELADLGQRYNIRSIPTLALFANGREAARVAGARQASDIEAWAAQQTAQAAQQPTR

Samples

Sample ID Description Type Environment
1 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
71 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
123 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
124 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
125 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
126 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
127 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
128 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
129 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
130 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
131 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
132 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
135 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
138 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
139 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
142 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
143 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
144 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
158 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
159 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
162 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
191 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.38
Rhizosphere 95.62
Stem 0
Stem Tuber 0
Unclassified 8.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207648_10520082 3300026089 Bacteria 1090
2 Ga0070676_10014700 3300005328 Bacteria 4305
3 Ga0070676_10849013 3300005328 Unclassified 677
4 Ga0068869_100273089 3300005334 Bacteria 1357
5 Ga0068869_100636707 3300005334 Bacteria 904
6 Ga0068869_100940458 3300005334 Bacteria 750
7 Ga0070666_10157806 3300005335 Unclassified 1585
8 Ga0068868_100567297 3300005338 Bacteria 1002
9 Ga0068868_100575680 3300005338 Bacteria 995
10 Ga0068868_100610579 3300005338 Bacteria 967
11 Ga0068868_100646203 3300005338 Bacteria 941
12 Ga0068868_101428591 3300005338 Bacteria 646
13 Ga0070689_100255975 3300005340 Bacteria 1446
14 Ga0070689_100594181 3300005340 Bacteria 958
15 Ga0070691_10028095 3300005341 Bacteria 2626
16 Ga0070687_100002717 3300005343 Bacteria 6701
17 Ga0070687_100110010 3300005343 Bacteria 1558
18 Ga0070668_100014229 3300005347 Bacteria 5944
19 Ga0070669_100043006 3300005353 Bacteria 3288
20 Ga0070669_100121030 3300005353 Bacteria 1997
21 Ga0070669_100607515 3300005353 Bacteria 917
22 Ga0070675_100008302 3300005354 Bacteria 8057
23 Ga0070675_100094992 3300005354 Bacteria 2502
24 Ga0070671_100328363 3300005355 Bacteria 1304
25 Ga0070674_100033205 3300005356 Bacteria 3433
26 Ga0070673_100041195 3300005364 Bacteria 3549
27 Ga0070673_100226496 3300005364 Bacteria 1620
28 Ga0070673_100376763 3300005364 Unclassified 1264
29 Ga0070673_100551706 3300005364 Bacteria 1047
30 Ga0070673_100602827 3300005364 Bacteria 1002
31 Ga0070688_100130137 3300005365 Bacteria 1697
32 Ga0070667_100024324 3300005367 Bacteria 5031
33 Ga0070667_101233086 3300005367 Bacteria 700
34 Ga0070709_10011831 3300005434 Bacteria 4872
35 Ga0070713_100079399 3300005436 Bacteria 2795
36 Ga0070713_100082435 3300005436 Bacteria 2746
37 Ga0070701_10011080 3300005438 Bacteria 4013
38 Ga0070701_10453396 3300005438 Unclassified 824
39 Ga0070711_100126031 3300005439 Bacteria 1901
40 Ga0070705_100000617 3300005440 Bacteria 20539
41 Ga0070705_100154768 3300005440 Bacteria 1525
42 Ga0070700_100350633 3300005441 Unclassified 1094
43 Ga0070694_100005093 3300005444 Bacteria 7928
44 Ga0070694_100019358 3300005444 Bacteria 4328
45 Ga0070694_100044143 3300005444 Bacteria 2983
46 Ga0070708_100839952 3300005445 Bacteria 863
47 Ga0070662_100119136 3300005457 Bacteria 2021
48 Ga0070681_10513734 3300005458 Bacteria 1111
49 Ga0070681_10564354 3300005458 Bacteria 1052
50 Ga0068867_100013235 3300005459 Bacteria 5843
51 Ga0068867_100057997 3300005459 Bacteria 2869
52 Ga0068867_100365168 3300005459 Bacteria 1208
53 Ga0070685_10100430 3300005466 Bacteria 1766
54 Ga0070685_10268274 3300005466 Bacteria 1138
55 Ga0070685_11437060 3300005466 Bacteria 530
56 Ga0070706_100167243 3300005467 Bacteria 2053
57 Ga0070707_100019142 3300005468 Bacteria 6448
58 Ga0070707_100405184 3300005468 Bacteria 1324
59 Ga0070698_100261165 3300005471 Bacteria 1664
60 Ga0070672_100024888 3300005543 Bacteria 4432
61 Ga0070672_100346577 3300005543 Bacteria 1266
62 Ga0070672_101093681 3300005543 Bacteria 708
63 Ga0070686_100000977 3300005544 Bacteria 16467
64 Ga0070686_100256758 3300005544 Bacteria 1279
65 Ga0070695_100007301 3300005545 Bacteria 6551
66 Ga0070695_100012222 3300005545 Bacteria 5149
67 Ga0070693_100438263 3300005547 Bacteria 914
68 Ga0070704_100002280 3300005549 Bacteria 10716
69 Ga0070704_100009693 3300005549 Bacteria 5836
70 Ga0070704_100466644 3300005549 Unclassified 1090
71 Ga0070664_102178790 3300005564 Unclassified 526
72 Ga0068854_100005596 3300005578 Bacteria 7940
73 Ga0068854_100032286 3300005578 Bacteria 3642
74 Ga0068854_100201713 3300005578 Bacteria 1564
75 Ga0068854_100204011 3300005578 Bacteria 1556
76 Ga0068854_100429429 3300005578 Unclassified 1099
77 Ga0070702_100004279 3300005615 Bacteria 6504
78 Ga0070702_100571487 3300005615 Unclassified 843
79 Ga0068852_101075439 3300005616 Bacteria 824
80 Ga0068859_100553655 3300005617 Bacteria 1244
81 Ga0068859_100614406 3300005617 Bacteria 1180
82 Ga0068859_101061221 3300005617 Bacteria 891
83 Ga0068864_100559526 3300005618 Bacteria 1106
84 Ga0068861_100021059 3300005719 Bacteria 4684
85 Ga0068861_100258466 3300005719 Bacteria 1490
86 Ga0068861_100456911 3300005719 Unclassified 1146
87 Ga0068861_101430791 3300005719 Unclassified 676
88 Ga0068861_101690495 3300005719 Bacteria 626
89 Ga0068851_10293911 3300005834 Bacteria 932
90 Ga0068863_100000908 3300005841 Bacteria 29779
91 Ga0068858_100035206 3300005842 Bacteria 4644
92 Ga0068858_100148721 3300005842 Bacteria 2201
93 Ga0068858_100302601 3300005842 Bacteria 1526
94 Ga0068858_100314421 3300005842 Bacteria 1496
95 Ga0068858_100314821 3300005842 Bacteria 1495
96 Ga0068858_101420191 3300005842 Bacteria 684
97 Ga0068860_100233666 3300005843 Bacteria 1787
98 Ga0068860_100302295 3300005843 Bacteria 1567
99 Ga0068860_100399758 3300005843 Bacteria 1359
100 Ga0068860_100433201 3300005843 Bacteria 1305
101 Ga0068860_100514232 3300005843 Bacteria 1197
102 Ga0068862_100032299 3300005844 Bacteria 4422
103 Ga0068862_100054834 3300005844 Unclassified 3413
104 Ga0068862_100063074 3300005844 Bacteria 3189
105 Ga0068862_100085469 3300005844 Bacteria 2742
106 Ga0068862_100752363 3300005844 Unclassified 948
107 Ga0068862_101850909 3300005844 Bacteria 613
108 Ga0081455_10036796 3300005937 Bacteria 4353
109 Ga0075432_10026677 3300006058 Bacteria 1985
110 Ga0097621_100050995 3300006237 Bacteria 3366
111 Ga0097621_100181885 3300006237 Unclassified 1817
112 Ga0075428_100080895 3300006844 Bacteria 3546
113 Ga0075428_100131950 3300006844 Bacteria 2717
114 Ga0075431_100374708 3300006847 Bacteria 1428
115 Ga0075433_10107488 3300006852 Bacteria 2473
116 Ga0075433_10156556 3300006852 Bacteria 2027
117 Ga0075433_10949316 3300006852 Bacteria 750
118 Ga0075434_100000239 3300006871 Bacteria 38163
119 Ga0075434_100205020 3300006871 Bacteria 1992
120 Ga0075434_100629034 3300006871 Bacteria 1092
121 Ga0068865_100043399 3300006881 Bacteria 3072
122 Ga0075436_100004736 3300006914 Bacteria 9333
123 Ga0075436_100123388 3300006914 Bacteria 1814
124 Ga0097620_100553658 3300006931 Bacteria 1244
125 Ga0097620_100614382 3300006931 Bacteria 1180
126 Ga0097620_101061225 3300006931 Bacteria 891
127 Ga0075435_100000013 3300007076 Bacteria 106345
128 Ga0075435_100002637 3300007076 Bacteria 11948
129 Ga0075435_100009083 3300007076 Bacteria 7173
130 Ga0075435_100060457 3300007076 Bacteria 3072
131 Ga0075435_101582976 3300007076 Bacteria 575
132 Ga0111539_10057585 3300009094 Bacteria 4614
133 Ga0111539_10103191 3300009094 Bacteria 3347
134 Ga0111539_10103836 3300009094 Bacteria 3335
135 Ga0111539_10659907 3300009094 Bacteria 1218
136 Ga0111539_10850339 3300009094 Bacteria 1062
137 Ga0111539_11166029 3300009094 Unclassified 895
138 Ga0105245_10017690 3300009098 Bacteria 6222
139 Ga0105247_10048732 3300009101 Bacteria 2602
140 Ga0114129_10000589 3300009147 Bacteria 44910
141 Ga0114129_10015148 3300009147 Bacteria 10976
142 Ga0114129_10119308 3300009147 Bacteria 3633
143 Ga0114129_10512318 3300009147 Bacteria 1565
144 Ga0114129_10861596 3300009147 Bacteria 1151
145 Ga0114129_11271478 3300009147 Bacteria 913
146 Ga0114129_11958615 3300009147 Bacteria 709
147 Ga0105243_10007916 3300009148 Bacteria 8161
148 Ga0105243_10015486 3300009148 Bacteria 5764
149 Ga0105243_10409605 3300009148 Bacteria 1262
150 Ga0105241_10034292 3300009174 Bacteria 3813
151 Ga0105241_10752971 3300009174 Bacteria 893
152 Ga0105242_10023786 3300009176 Bacteria 4832
153 Ga0105242_10192925 3300009176 Unclassified 1805
154 Ga0105242_10514404 3300009176 Unclassified 1141
155 Ga0105248_10006358 3300009177 Bacteria 12957
156 Ga0105248_10045155 3300009177 Bacteria 4941
157 Ga0105248_10060708 3300009177 Bacteria 4245
158 Ga0105248_10079668 3300009177 Bacteria 3681
159 Ga0105248_10260769 3300009177 Bacteria 1951
160 Ga0105248_10396967 3300009177 Bacteria 1553
161 Ga0105248_10405411 3300009177 Bacteria 1535
162 Ga0105248_10626924 3300009177 Bacteria 1213
163 Ga0105248_11509128 3300009177 Unclassified 761
164 Ga0105248_12095769 3300009177 Bacteria 643
165 Ga0105249_10153273 3300009553 Bacteria 2221
166 Ga0105249_10250855 3300009553 Bacteria 1754
167 Ga0105249_10577633 3300009553 Bacteria 1177
168 Ga0105249_10962734 3300009553 Unclassified 922
169 Ga0105249_11438339 3300009553 Bacteria 761
170 Ga0105249_12416158 3300009553 Bacteria 598
171 Ga0105239_11193378 3300010375 Bacteria 877
172 Ga0157328_1009014 3300012478 Bacteria 664
173 Ga0157323_1019039 3300012495 Unclassified 635
174 Ga0157378_11536008 3300013297 Unclassified 711
175 Ga0157378_12824056 3300013297 Bacteria 538
176 Ga0163162_10460352 3300013306 Bacteria 1403
177 Ga0163162_11299946 3300013306 Bacteria 826
178 Ga0157375_10098100 3300013308 Bacteria 3006
179 Ga0157375_10304466 3300013308 Bacteria 1757
180 Ga0157375_10498157 3300013308 Bacteria 1382
181 Ga0157375_10620015 3300013308 Bacteria 1240
182 Ga0157375_10986721 3300013308 Bacteria 983
183 Ga0157375_11878456 3300013308 Bacteria 711
184 Ga0163163_10139398 3300014325 Bacteria 2467
185 Ga0163163_11484717 3300014325 Bacteria 739
186 Ga0157380_10116427 3300014326 Bacteria 2256
187 Ga0157380_11314572 3300014326 Bacteria 771
188 Ga0157379_10006294 3300014968 Bacteria 10222
189 Ga0157379_10949554 3300014968 Bacteria 818
190 Ga0157376_10018737 3300014969 Bacteria 5317
191 Ga0157376_10220041 3300014969 Bacteria 1758
192 Ga0157376_11197394 3300014969 Bacteria 788
193 Ga0163161_10970420 3300017792 Bacteria 724
194 Ga0163161_11497206 3300017792 Bacteria 592
195 Ga0207697_10043139 3300025315 Bacteria 1854
196 Ga0207682_10225155 3300025893 Bacteria 868
197 Ga0207680_10028681 3300025903 Bacteria 3117
198 Ga0207699_10007465 3300025906 Bacteria 5350
199 Ga0207699_10162521 3300025906 Bacteria 1488
200 Ga0207645_10014428 3300025907 Bacteria 5287
201 Ga0207645_10304748 3300025907 Bacteria 1061
202 Ga0207684_10229421 3300025910 Bacteria 1602
203 Ga0207707_10648594 3300025912 Bacteria 890
204 Ga0207663_10076161 3300025916 Bacteria 2179
205 Ga0207662_10023454 3300025918 Bacteria 3545
206 Ga0207662_10042648 3300025918 Bacteria 2675
207 Ga0207662_10127298 3300025918 Bacteria 1603
208 Ga0207646_10020993 3300025922 Bacteria 6041
209 Ga0207646_10738452 3300025922 Bacteria 879
210 Ga0207681_10074132 3300025923 Bacteria 2383
211 Ga0207681_10116046 3300025923 Bacteria 1955
212 Ga0207681_11115051 3300025923 Bacteria 663
213 Ga0207659_10000180 3300025926 Bacteria 37729
214 Ga0207659_10301430 3300025926 Bacteria 1316
215 Ga0207687_10059395 3300025927 Bacteria 2694
216 Ga0207700_10059317 3300025928 Bacteria 2894
217 Ga0207700_10338125 3300025928 Bacteria 1308
218 Ga0207644_10590705 3300025931 Bacteria 921
219 Ga0207644_10679329 3300025931 Bacteria 858
220 Ga0207706_10083211 3300025933 Bacteria 2813
221 Ga0207706_10404163 3300025933 Bacteria 1184
222 Ga0207706_10420060 3300025933 Bacteria 1158
223 Ga0207686_10051949 3300025934 Bacteria 2556
224 Ga0207686_10133968 3300025934 Bacteria 1703
225 Ga0207686_10788424 3300025934 Unclassified 761
226 Ga0207670_10207210 3300025936 Bacteria 1493
227 Ga0207669_10007845 3300025937 Bacteria 4971
228 Ga0207669_10077160 3300025937 Bacteria 2118
229 Ga0207704_10098184 3300025938 Bacteria 1945
230 Ga0207704_10484383 3300025938 Unclassified 994
231 Ga0207704_10941130 3300025938 Bacteria 728
232 Ga0207704_10996462 3300025938 Bacteria 708
233 Ga0207691_10016729 3300025940 Bacteria 6962
234 Ga0207691_10278148 3300025940 Bacteria 1440
235 Ga0207691_10612171 3300025940 Unclassified 922
236 Ga0207711_10062069 3300025941 Bacteria 3223
237 Ga0207711_10138618 3300025941 Bacteria 2187
238 Ga0207711_10163935 3300025941 Bacteria 2014
239 Ga0207711_10275537 3300025941 Bacteria 1548
240 Ga0207711_10310248 3300025941 Bacteria 1456
241 Ga0207711_10894722 3300025941 Bacteria 825
242 Ga0207711_11637417 3300025941 Bacteria 587
243 Ga0207689_10217364 3300025942 Bacteria 1579
244 Ga0207689_10251173 3300025942 Bacteria 1462
245 Ga0207689_10483986 3300025942 Bacteria 1036
246 Ga0207689_10648013 3300025942 Bacteria 890
247 Ga0207651_10022635 3300025960 Bacteria 3847
248 Ga0207651_10316044 3300025960 Unclassified 1304
249 Ga0207712_10172398 3300025961 Bacteria 1692
250 Ga0207668_10036183 3300025972 Bacteria 3294
251 Ga0207668_10688427 3300025972 Bacteria 898
252 Ga0207640_10062962 3300025981 Bacteria 2463
253 Ga0207640_11090067 3300025981 Bacteria 706
254 Ga0207658_10140682 3300025986 Bacteria 1952
255 Ga0207677_10011569 3300026023 Bacteria 5038
256 Ga0207677_10567001 3300026023 Bacteria 992
257 Ga0207677_10596384 3300026023 Bacteria 969
258 Ga0207703_10273298 3300026035 Bacteria 1532
259 Ga0207703_10291030 3300026035 Bacteria 1486
260 Ga0207703_10375545 3300026035 Bacteria 1314
261 Ga0207703_10542236 3300026035 Bacteria 1096
262 Ga0207703_10568791 3300026035 Bacteria 1070
263 Ga0207639_11675844 3300026041 Bacteria 596
264 Ga0207708_10031960 3300026075 Bacteria 3997
265 Ga0207708_10261248 3300026075 Bacteria 1398
266 Ga0207708_10345780 3300026075 Unclassified 1219
267 Ga0207708_10346990 3300026075 Bacteria 1217
268 Ga0207641_10003798 3300026088 Bacteria 13248
269 Ga0207641_10582277 3300026088 Bacteria 1094
270 Ga0207648_10038348 3300026089 Bacteria 4217
271 Ga0207648_10091698 3300026089 Bacteria 2656
272 Ga0207648_10257526 3300026089 Bacteria 1556
273 Ga0207675_100001868 3300026118 Bacteria 21066
274 Ga0207675_100031792 3300026118 Bacteria 4917
275 Ga0207675_100079621 3300026118 Bacteria 3071
276 Ga0207675_100701138 3300026118 Bacteria 1021
277 Ga0207675_100944651 3300026118 Bacteria 879
278 Ga0207675_101919168 3300026118 Unclassified 610
279 Ga0207698_10415693 3300026142 Bacteria 1289
280 Ga0207428_10195652 3300027907 Bacteria 1523
281 Ga0207428_11166881 3300027907 Bacteria 536
282 Ga0268266_10029817 3300028379 Bacteria 4635
283 Ga0268265_10017245 3300028380 Bacteria 4980
284 Ga0268265_10033330 3300028380 Unclassified 3744
285 Ga0268265_10294099 3300028380 Bacteria 1459
286 Ga0268265_10743254 3300028380 Unclassified 951
287 Ga0268265_10885045 3300028380 Bacteria 876
288 Ga0268264_10079274 3300028381 Bacteria 2801
289 Ga0268264_10139327 3300028381 Bacteria 2161
290 Ga0268264_10321437 3300028381 Bacteria 1463
291 Ga0268264_10363718 3300028381 Bacteria 1381
292 Ga0268264_10448368 3300028381 Bacteria 1250
293 Ga0268264_10645061 3300028381 Bacteria 1047
294 Ga0268264_10743299 3300028381 Bacteria 977
295 Ga0268264_11007941 3300028381 Bacteria 839
296 Ga0307410_10074170 3300031852 Bacteria 2369
297 Ga0307416_100373435 3300032002 Bacteria 1453
298 Ga0307411_10144767 3300032005 Bacteria 1757
299 Ga0373950_0004662 3300034818 Bacteria 2015
300 Ga0373958_0007730 3300034819 Bacteria 1723
301 Ga0373958_0096415 3300034819 Bacteria 688
302 Ga0373959_0001179 3300034820 Bacteria 4223
303 Ga0373938_0001853 3300034957 Bacteria 3374
304 Ga0373928_0000193 3300035084 Bacteria 11706
305 Ga0373929_0000350 3300035085 Bacteria 8597
306 Ga0373934_0103407 3300035086 Bacteria 1152
307 Ga0373940_0019432 3300035088 Bacteria 1716
308 Ga0373940_0118112 3300035088 Bacteria 820
309 Ga0373944_0116165 3300035089 Bacteria 918
310 Ga0373949_0002871 3300035090 Bacteria 4254
311 Ga0373952_0004010 3300035092 Bacteria 2660
312 Ga0373936_0159040 3300035113 Bacteria 983
313 Ga0373939_0001936 3300035114 Bacteria 4951
314 Ga0373941_0001215 3300035115 Bacteria 5404
315 Ga0373945_0193614 3300035116 Bacteria 841
316 Ga0373953_0132127 3300035117 Bacteria 1065
317 Ga0373960_0000066 3300035121 Bacteria 14802
318 Ga0373960_0372706 3300035121 Bacteria 545
319 Ga0373946_0159363 3300035171 Bacteria 1058
320 Ga0373955_0005367 3300035172 Bacteria 5755
321 Ga0373955_0302168 3300035172 Bacteria 965
322 Ga0373955_0586675 3300035172 Bacteria 682
323 Ga0373942_0001218 3300035207 Bacteria 6773
324 Ga0373961_0167169 3300035241 Bacteria 759
325 Ga0373962_0002845 3300035242 Bacteria 4141
326 Ga0373924_0001601 3300035410 Bacteria 7421
327 Ga0373931_0000370 3300035691 Bacteria 18463
328 Ga0373931_0491692 3300035691 Bacteria 790
329 Ga0373935_0317674 3300035692 Bacteria 1104
330 Ga0373947_0031770 3300035725 Bacteria 3109
331 Ga0373937_0400168 3300036401 Unclassified 1303
332 Ga0373925_0186100 3300037068 Bacteria 1646
333 Ga0373925_0253426 3300037068 Bacteria 1412
334 Ga0451576_0017531 3300045051 Bacteria 7872
335 Ga0451576_2512507 3300045051 Bacteria 526
336 Ga0466967_0737908 3300045976 Bacteria 976
337 Ga0495603_0267670 3300046455 Bacteria 983
338 Ga0495629_0371443 3300046459 Bacteria 974
339 Ga0495582_0260107 3300046473 Bacteria 996
340 Ga0495584_0517763 3300046491 Bacteria 608
341 Ga0495630_0352014 3300046517 Bacteria 1127
342 Ga0495665_0055353 3300046531 Bacteria 2095
343 Ga0495621_0228180 3300046539 Bacteria 756
344 Ga0495647_0026905 3300046681 Bacteria 2111
345 Ga0495658_0367594 3300046683 Bacteria 915
346 Ga0495613_0245871 3300046689 Bacteria 1250
347 Ga0495613_0377906 3300046689 Bacteria 969
348 Ga0495581_0243055 3300047315 Bacteria 1053
349 Ga0495604_0200194 3300047317 Bacteria 1386
350 Ga0495674_0234487 3300047319 Bacteria 1514
351 Ga0495677_0445078 3300047445 Bacteria 513
352 Ga0496101_1155812 3300048904 Bacteria 607
353 Ga0496102_0178402 3300048905 Bacteria 2001
354 Ga0496104_0517772 3300048907 Bacteria 1104
355 Ga0496106_0190779 3300048909 Bacteria 1629
356 Ga0496106_0246872 3300048909 Unclassified 1427
357 Ga0496106_0848405 3300048909 Bacteria 723
358 Ga0496107_0074621 3300048910 Bacteria 2468
359 Ga0496107_0192216 3300048910 Bacteria 1517
360 Ga0496108_0589134 3300048911 Bacteria 969
361 Ga0496109_0153893 3300048912 Bacteria 2154
362 Ga0496109_0611274 3300048912 Bacteria 1026
363 Ga0496110_0316758 3300048913 Unclassified 1421
364 Ga0496111_1208575 3300048914 Bacteria 535
365 Ga0496112_0296495 3300048915 Bacteria 1563
366 Ga0496113_0654853 3300048916 Bacteria 840
367 Ga0496114_0018159 3300048917 Bacteria 5682
368 Ga0496114_1315782 3300048917 Bacteria 609
369 Ga0496114_1328147 3300048917 Bacteria 606
370 Ga0501225_0195751 3300049705 Bacteria 639
371 Ga0501080_1227715 3300049742 Bacteria 644
372 Ga0501083_0019614 3300049744 Bacteria 4710
373 nmdc:mga05p37_192609_c1 3300050507 Bacteria 2474
374 nmdc:mga05p37_26420_c1 3300050507 Bacteria 7062
375 nmdc:mga05p37_385458_c1 3300050507 Bacteria 1641
376 nmdc:mga05p37_561105_c1 3300050507 Bacteria 1297
377 nmdc:mga05p37_7398_c1 3300050507 Bacteria 12955
378 nmdc:mga09592_150164_c1 3300050508 Bacteria 2010
379 nmdc:mga09592_254221_c1 3300050508 Bacteria 1523
380 nmdc:mga06r32_329312_c1 3300050510 Bacteria 1512
381 nmdc:mga08y16_128240_c1 3300050511 Bacteria 2639
382 nmdc:mga08y16_536242_c1 3300050511 Unclassified 1186
383 nmdc:mga08y16_7169_c1 3300050511 Bacteria 11697
384 nmdc:mga0n895_1082469_c1 3300050512 Bacteria 780
385 nmdc:mga0n895_196420_c1 3300050512 Bacteria 2049
386 nmdc:mga0n895_268243_c1 3300050512 Bacteria 1732
387 nmdc:mga0n895_385921_c1 3300050512 Bacteria 1417
388 nmdc:mga0n895_548361_c1 3300050512 Bacteria 1162
389 nmdc:mga0n895_595362_c1 3300050512 Bacteria 1108
390 nmdc:mga0n895_72_c1 3300050512 Bacteria 58012
391 nmdc:mga0n895_742092_c1 3300050512 Bacteria 975
392 nmdc:mga0rr50_1013212_c1 3300050513 Bacteria 707
393 nmdc:mga0rr50_13184_c1 3300050513 Bacteria 5373
394 nmdc:mga0rr50_27898_c1 3300050513 Bacteria 3961
395 nmdc:mga0rr50_57686_c1 3300050513 Bacteria 2906
396 nmdc:mga0rr50_9_c1 3300050513 Bacteria 224716
397 nmdc:mga08x19_127665_c1 3300050514 Bacteria 1709
398 nmdc:mga08x19_34744_c1 3300050514 Bacteria 3187
399 nmdc:mga08x19_3526_c1 3300050514 Bacteria 9309
400 nmdc:mga08x19_462437_c1 3300050514 Bacteria 894
401 nmdc:mga08x19_70951_c1 3300050514 Bacteria 2271
402 nmdc:mga0a205_1261723_c1 3300050515 Bacteria 587
403 nmdc:mga0a205_188318_c1 3300050515 Bacteria 1956
404 nmdc:mga0a205_19183_c1 3300050515 Bacteria 6444
405 nmdc:mga0a205_499812_c1 3300050515 Bacteria 1073
406 nmdc:mga0a205_820648_c1 3300050515 Bacteria 778
407 Ga0495601_0018758 3300053077 Bacteria 4212
408 Ga0495612_0132156 3300053078 Bacteria 1079
409 Ga0495595_0112918 3300053084 Bacteria 1319
410 Ga0495595_0278179 3300053084 Bacteria 840
411 Ga0495619_0150037 3300053085 Bacteria 1608
412 Ga0207648_10520082
413 Ga0070676_10014700
414 Ga0070676_10849013
415 Ga0068869_100273089
416 Ga0068869_100636707
417 Ga0068869_100940458
418 Ga0070666_10157806
419 Ga0068868_100567297
420 Ga0068868_100575680
421 Ga0068868_100610579
422 Ga0068868_100646203
423 Ga0068868_101428591
424 Ga0070689_100255975
425 Ga0070689_100594181
426 Ga0070691_10028095
427 Ga0070687_100002717
428 Ga0070687_100110010
429 Ga0070668_100014229
430 Ga0070669_100043006
431 Ga0070669_100121030
432 Ga0070669_100607515
433 Ga0070675_100008302
434 Ga0070675_100094992
435 Ga0070671_100328363
436 Ga0070674_100033205
437 Ga0070673_100041195
438 Ga0070673_100226496
439 Ga0070673_100376763
440 Ga0070673_100551706
441 Ga0070673_100602827
442 Ga0070688_100130137
443 Ga0070667_100024324
444 Ga0070667_101233086
445 Ga0070709_10011831
446 Ga0070713_100079399
447 Ga0070713_100082435
448 Ga0070701_10011080
449 Ga0070701_10453396
450 Ga0070711_100126031
451 Ga0070705_100000617
452 Ga0070705_100154768
453 Ga0070700_100350633
454 Ga0070694_100005093
455 Ga0070694_100019358
456 Ga0070694_100044143
457 Ga0070708_100839952
458 Ga0070662_100119136
459 Ga0070681_10513734
460 Ga0070681_10564354
461 Ga0068867_100013235
462 Ga0068867_100057997
463 Ga0068867_100365168
464 Ga0070685_10100430
465 Ga0070685_10268274
466 Ga0070685_11437060
467 Ga0070706_100167243
468 Ga0070707_100019142
469 Ga0070707_100405184
470 Ga0070698_100261165
471 Ga0070672_100024888
472 Ga0070672_100346577
473 Ga0070672_101093681
474 Ga0070686_100000977
475 Ga0070686_100256758
476 Ga0070695_100007301
477 Ga0070695_100012222
478 Ga0070693_100438263
479 Ga0070704_100002280
480 Ga0070704_100009693
481 Ga0070704_100466644
482 Ga0070664_102178790
483 Ga0068854_100005596
484 Ga0068854_100032286
485 Ga0068854_100201713
486 Ga0068854_100204011
487 Ga0068854_100429429
488 Ga0070702_100004279
489 Ga0070702_100571487
490 Ga0068852_101075439
491 Ga0068859_100553655
492 Ga0068859_100614406
493 Ga0068859_101061221
494 Ga0068864_100559526
495 Ga0068861_100021059
496 Ga0068861_100258466
497 Ga0068861_100456911
498 Ga0068861_101430791
499 Ga0068861_101690495
500 Ga0068851_10293911
501 Ga0068863_100000908
502 Ga0068858_100035206
503 Ga0068858_100148721
504 Ga0068858_100302601
505 Ga0068858_100314421
506 Ga0068858_100314821
507 Ga0068858_101420191
508 Ga0068860_100233666
509 Ga0068860_100302295
510 Ga0068860_100399758
511 Ga0068860_100433201
512 Ga0068860_100514232
513 Ga0068862_100032299
514 Ga0068862_100054834
515 Ga0068862_100063074
516 Ga0068862_100085469
517 Ga0068862_100752363
518 Ga0068862_101850909
519 Ga0081455_10036796
520 Ga0075432_10026677
521 Ga0097621_100050995
522 Ga0097621_100181885
523 Ga0075428_100080895
524 Ga0075428_100131950
525 Ga0075431_100374708
526 Ga0075433_10107488
527 Ga0075433_10156556
528 Ga0075433_10949316
529 Ga0075434_100000239
530 Ga0075434_100205020
531 Ga0075434_100629034
532 Ga0068865_100043399
533 Ga0075436_100004736
534 Ga0075436_100123388
535 Ga0097620_100553658
536 Ga0097620_100614382
537 Ga0097620_101061225
538 Ga0075435_100000013
539 Ga0075435_100002637
540 Ga0075435_100009083
541 Ga0075435_100060457
542 Ga0075435_101582976
543 Ga0111539_10057585
544 Ga0111539_10103191
545 Ga0111539_10103836
546 Ga0111539_10659907
547 Ga0111539_10850339
548 Ga0111539_11166029
549 Ga0105245_10017690
550 Ga0105247_10048732
551 Ga0114129_10000589
552 Ga0114129_10015148
553 Ga0114129_10119308
554 Ga0114129_10512318
555 Ga0114129_10861596
556 Ga0114129_11271478
557 Ga0114129_11958615
558 Ga0105243_10007916
559 Ga0105243_10015486
560 Ga0105243_10409605
561 Ga0105241_10034292
562 Ga0105241_10752971
563 Ga0105242_10023786
564 Ga0105242_10192925
565 Ga0105242_10514404
566 Ga0105248_10006358
567 Ga0105248_10045155
568 Ga0105248_10060708
569 Ga0105248_10079668
570 Ga0105248_10260769
571 Ga0105248_10396967
572 Ga0105248_10405411
573 Ga0105248_10626924
574 Ga0105248_11509128
575 Ga0105248_12095769
576 Ga0105249_10153273
577 Ga0105249_10250855
578 Ga0105249_10577633
579 Ga0105249_10962734
580 Ga0105249_11438339
581 Ga0105249_12416158
582 Ga0105239_11193378
583 Ga0157328_1009014
584 Ga0157323_1019039
585 Ga0157378_11536008
586 Ga0157378_12824056
587 Ga0163162_10460352
588 Ga0163162_11299946
589 Ga0157375_10098100
590 Ga0157375_10304466
591 Ga0157375_10498157
592 Ga0157375_10620015
593 Ga0157375_10986721
594 Ga0157375_11878456
595 Ga0163163_10139398
596 Ga0163163_11484717
597 Ga0157380_10116427
598 Ga0157380_11314572
599 Ga0157379_10006294
600 Ga0157379_10949554
601 Ga0157376_10018737
602 Ga0157376_10220041
603 Ga0157376_11197394
604 Ga0163161_10970420
605 Ga0163161_11497206
606 Ga0207697_10043139
607 Ga0207682_10225155
608 Ga0207680_10028681
609 Ga0207699_10007465
610 Ga0207699_10162521
611 Ga0207645_10014428
612 Ga0207645_10304748
613 Ga0207684_10229421
614 Ga0207707_10648594
615 Ga0207663_10076161
616 Ga0207662_10023454
617 Ga0207662_10042648
618 Ga0207662_10127298
619 Ga0207646_10020993
620 Ga0207646_10738452
621 Ga0207681_10074132
622 Ga0207681_10116046
623 Ga0207681_11115051
624 Ga0207659_10000180
625 Ga0207659_10301430
626 Ga0207687_10059395
627 Ga0207700_10059317
628 Ga0207700_10338125
629 Ga0207644_10590705
630 Ga0207644_10679329
631 Ga0207706_10083211
632 Ga0207706_10404163
633 Ga0207706_10420060
634 Ga0207686_10051949
635 Ga0207686_10133968
636 Ga0207686_10788424
637 Ga0207670_10207210
638 Ga0207669_10007845
639 Ga0207669_10077160
640 Ga0207704_10098184
641 Ga0207704_10484383
642 Ga0207704_10941130
643 Ga0207704_10996462
644 Ga0207691_10016729
645 Ga0207691_10278148
646 Ga0207691_10612171
647 Ga0207711_10062069
648 Ga0207711_10138618
649 Ga0207711_10163935
650 Ga0207711_10275537
651 Ga0207711_10310248
652 Ga0207711_10894722
653 Ga0207711_11637417
654 Ga0207689_10217364
655 Ga0207689_10251173
656 Ga0207689_10483986
657 Ga0207689_10648013
658 Ga0207651_10022635
659 Ga0207651_10316044
660 Ga0207712_10172398
661 Ga0207668_10036183
662 Ga0207668_10688427
663 Ga0207640_10062962
664 Ga0207640_11090067
665 Ga0207658_10140682
666 Ga0207677_10011569
667 Ga0207677_10567001
668 Ga0207677_10596384
669 Ga0207703_10273298
670 Ga0207703_10291030
671 Ga0207703_10375545
672 Ga0207703_10542236
673 Ga0207703_10568791
674 Ga0207639_11675844
675 Ga0207708_10031960
676 Ga0207708_10261248
677 Ga0207708_10345780
678 Ga0207708_10346990
679 Ga0207641_10003798
680 Ga0207641_10582277
681 Ga0207648_10038348
682 Ga0207648_10091698
683 Ga0207648_10257526
684 Ga0207675_100001868
685 Ga0207675_100031792
686 Ga0207675_100079621
687 Ga0207675_100701138
688 Ga0207675_100944651
689 Ga0207675_101919168
690 Ga0207698_10415693
691 Ga0207428_10195652
692 Ga0207428_11166881
693 Ga0268266_10029817
694 Ga0268265_10017245
695 Ga0268265_10033330
696 Ga0268265_10294099
697 Ga0268265_10743254
698 Ga0268265_10885045
699 Ga0268264_10079274
700 Ga0268264_10139327
701 Ga0268264_10321437
702 Ga0268264_10363718
703 Ga0268264_10448368
704 Ga0268264_10645061
705 Ga0268264_10743299
706 Ga0268264_11007941
707 Ga0307410_10074170
708 Ga0307416_100373435
709 Ga0307411_10144767
710 Ga0373950_0004662
711 Ga0373958_0007730
712 Ga0373958_0096415
713 Ga0373959_0001179
714 Ga0373938_0001853
715 Ga0373928_0000193
716 Ga0373929_0000350
717 Ga0373934_0103407
718 Ga0373940_0019432
719 Ga0373940_0118112
720 Ga0373944_0116165
721 Ga0373949_0002871
722 Ga0373952_0004010
723 Ga0373936_0159040
724 Ga0373939_0001936
725 Ga0373941_0001215
726 Ga0373945_0193614
727 Ga0373953_0132127
728 Ga0373960_0000066
729 Ga0373960_0372706
730 Ga0373946_0159363
731 Ga0373955_0005367
732 Ga0373955_0302168
733 Ga0373955_0586675
734 Ga0373942_0001218
735 Ga0373961_0167169
736 Ga0373962_0002845
737 Ga0373924_0001601
738 Ga0373931_0000370
739 Ga0373931_0491692
740 Ga0373935_0317674
741 Ga0373947_0031770
742 Ga0373937_0400168
743 Ga0373925_0186100
744 Ga0373925_0253426
745 Ga0451576_0017531
746 Ga0451576_2512507
747 Ga0466967_0737908
748 Ga0495603_0267670
749 Ga0495629_0371443
750 Ga0495582_0260107
751 Ga0495584_0517763
752 Ga0495630_0352014
753 Ga0495665_0055353
754 Ga0495621_0228180
755 Ga0495647_0026905
756 Ga0495658_0367594
757 Ga0495613_0245871
758 Ga0495613_0377906
759 Ga0495581_0243055
760 Ga0495604_0200194
761 Ga0495674_0234487
762 Ga0495677_0445078
763 Ga0496101_1155812
764 Ga0496102_0178402
765 Ga0496104_0517772
766 Ga0496106_0190779
767 Ga0496106_0246872
768 Ga0496106_0848405
769 Ga0496107_0074621
770 Ga0496107_0192216
771 Ga0496108_0589134
772 Ga0496109_0153893
773 Ga0496109_0611274
774 Ga0496110_0316758
775 Ga0496111_1208575
776 Ga0496112_0296495
777 Ga0496113_0654853
778 Ga0496114_0018159
779 Ga0496114_1315782
780 Ga0496114_1328147
781 Ga0501225_0195751
782 Ga0501080_1227715
783 Ga0501083_0019614
784 nmdc:mga05p37_192609_c1
785 nmdc:mga05p37_26420_c1
786 nmdc:mga05p37_385458_c1
787 nmdc:mga05p37_561105_c1
788 nmdc:mga05p37_7398_c1
789 nmdc:mga09592_150164_c1
790 nmdc:mga09592_254221_c1
791 nmdc:mga06r32_329312_c1
792 nmdc:mga08y16_128240_c1
793 nmdc:mga08y16_536242_c1
794 nmdc:mga08y16_7169_c1
795 nmdc:mga0n895_1082469_c1
796 nmdc:mga0n895_196420_c1
797 nmdc:mga0n895_268243_c1
798 nmdc:mga0n895_385921_c1
799 nmdc:mga0n895_548361_c1
800 nmdc:mga0n895_595362_c1
801 nmdc:mga0n895_72_c1
802 nmdc:mga0n895_742092_c1
803 nmdc:mga0rr50_1013212_c1
804 nmdc:mga0rr50_13184_c1
805 nmdc:mga0rr50_27898_c1
806 nmdc:mga0rr50_57686_c1
807 nmdc:mga0rr50_9_c1
808 nmdc:mga08x19_127665_c1
809 nmdc:mga08x19_34744_c1
810 nmdc:mga08x19_3526_c1
811 nmdc:mga08x19_462437_c1
812 nmdc:mga08x19_70951_c1
813 nmdc:mga0a205_1261723_c1
814 nmdc:mga0a205_188318_c1
815 nmdc:mga0a205_19183_c1
816 nmdc:mga0a205_499812_c1
817 nmdc:mga0a205_820648_c1
818 Ga0495601_0018758
819 Ga0495612_0132156
820 Ga0495595_0112918
821 Ga0495595_0278179
822 Ga0495619_0150037

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00085

Thioredoxin

Thioredoxin

71

173

0.96

PF13098

Thioredoxin_2

Thioredoxin-like domain

84

171

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bzk-assembly1.cif.gz_B crystal structure of ferredoxin: thioredoxin reductase and thioredoxin y1 complex 0.9819 56 151
2i1u-assembly1.cif.gz_A mycobacterium tuberculosis thioredoxin c 0.973 48 145
6gn9-assembly1.cif.gz_A crystal structure of a thioredoxin from clostridium acetobutylicum at 1.75 a resolution 0.9717 50 150
2o7k-assembly1.cif.gz_A s. aureus thioredoxin 0.9712 47 150
2o85-assembly1.cif.gz_A s. aureus thioredoxin p31t mutant 0.9699 47 150
ID Description Score Start End Superfamily
af_Q5JMR9_59_168_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9813 57 156 3.40.30.10
3dieB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9786 77 150 3.40.30.10
5hr1G00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9667 73 147 3.40.30.10
4ulxA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9662 47 150 3.40.30.10
2pptB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9651 55 151 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2V6MNR0-F1-model_v4 Thioredoxin 0.9894 49 150 GO:0005737
GO:0015035
AF-A0A7C5H6U1-F1-model_v4 Thioredoxin 0.9891 54 150 GO:0005737
GO:0015035
AF-A0A835DSY4-F1-model_v4 Thioredoxin domain-containing protein 0.9866 57 151 GO:0005737
GO:0015035
AF-A0A1U8A7E4-F1-model_v4 Thioredoxin Y1, chloroplastic 0.9851 58 151 GO:0005737
GO:0015035
AF-A0A835HND0-F1-model_v4 Thioredoxin domain-containing protein 0.9849 57 151 GO:0005737
GO:0015035

Map