F437512

General Info

Members Datasets Scaffolds Average Seq Length
411 166 411 216

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10458885|Ga0157370_104588852
Length 245
Sequence LIPILIMSVVASTPPAQPARANPLITGTATRQACPDLVTPDALICRALDAEKAGNNASAAQGFEEAAKASGDKDPKTARMYAAAGNLWIAANEPAKAAADLDKSLALNGLEGKQRGEALLDRARAAEQQDDLATARAKLNQAKEIISDDPFYWYFSAALALREHDGQTAQLAIGKALSMAPGDPAVLFEAGHIADFNGDDDQARSYWMRAAGSDPDGPVGKAAAKAVEMLGVTPVLKTDPTPAKN

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
133 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
145 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 3.41
Rhizosphere 95.86
Stem 0
Stem Tuber 0
Unclassified 0.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1009606 3300001976 Bacteria 1262
2 JGI24740J21852_10000442 3300001979 Bacteria 17721
3 JGI24740J21852_10003212 3300001979 Bacteria 7212
4 JGI24739J22299_10000307 3300001989 Bacteria 16633
5 JGI24737J22298_10000206 3300001990 Bacteria 19194
6 JGI24737J22298_10000252 3300001990 Bacteria 17703
7 JGI24738J21930_10000885 3300002075 Bacteria 8575
8 Ga0070658_10000374 3300005327 Bacteria 38937
9 Ga0070658_10234221 3300005327 Bacteria 1555
10 Ga0070676_10007504 3300005328 Bacteria 5856
11 Ga0070683_100004192 3300005329 Bacteria 11822
12 Ga0070683_100091962 3300005329 Bacteria 2849
13 Ga0070690_100194437 3300005330 Bacteria 1408
14 Ga0070670_100148762 3300005331 Bacteria 2026
15 Ga0068869_100163275 3300005334 Bacteria 1735
16 Ga0070666_10046219 3300005335 Bacteria 2920
17 Ga0070680_100058253 3300005336 Bacteria 3159
18 Ga0070682_100043402 3300005337 Bacteria 2780
19 Ga0070682_100280308 3300005337 Bacteria 1215
20 Ga0068868_100001128 3300005338 Bacteria 18247
21 Ga0070660_100000209 3300005339 Bacteria 39223
22 Ga0070660_100068086 3300005339 Bacteria 2774
23 Ga0070660_100222197 3300005339 Bacteria 1535
24 Ga0070660_100279560 3300005339 Bacteria 1366
25 Ga0070660_100476090 3300005339 Bacteria 1037
26 Ga0070691_10017346 3300005341 Bacteria 3312
27 Ga0070661_100032636 3300005344 Bacteria 3768
28 Ga0070661_100085764 3300005344 Bacteria 2328
29 Ga0070692_10046140 3300005345 Bacteria 2251
30 Ga0070668_100007947 3300005347 Bacteria 7878
31 Ga0070669_100001511 3300005353 Bacteria 16803
32 Ga0070669_100149851 3300005353 Bacteria 1805
33 Ga0070675_100092185 3300005354 Bacteria 2540
34 Ga0070675_100171501 3300005354 Bacteria 1871
35 Ga0070671_100008331 3300005355 Bacteria 8301
36 Ga0070671_100015829 3300005355 Bacteria 6092
37 Ga0070674_100196452 3300005356 Bacteria 1555
38 Ga0070673_100002049 3300005364 Bacteria 12152
39 Ga0070673_100404988 3300005364 Bacteria 1220
40 Ga0070673_100407038 3300005364 Bacteria 1217
41 Ga0070659_100000565 3300005366 Bacteria 27071
42 Ga0070659_100007554 3300005366 Bacteria 7902
43 Ga0070659_100028961 3300005366 Bacteria 4278
44 Ga0070659_100075531 3300005366 Bacteria 2686
45 Ga0070659_100127386 3300005366 Bacteria 2066
46 Ga0070659_100317251 3300005366 Bacteria 1302
47 Ga0070659_100365248 3300005366 Bacteria 1213
48 Ga0070667_100001792 3300005367 Bacteria 19117
49 Ga0070667_100151191 3300005367 Bacteria 2039
50 Ga0070667_100158360 3300005367 Bacteria 1993
51 Ga0070667_100256718 3300005367 Bacteria 1564
52 Ga0070714_100028574 3300005435 Bacteria 4629
53 Ga0070714_100123453 3300005435 Unclassified 2306
54 Ga0070663_100014574 3300005455 Bacteria 5050
55 Ga0070663_100035009 3300005455 Bacteria 3481
56 Ga0070663_100039702 3300005455 Bacteria 3291
57 Ga0070678_100098004 3300005456 Bacteria 2266
58 Ga0070662_100000012 3300005457 Bacteria 129380
59 Ga0070662_100000854 3300005457 Bacteria 18719
60 Ga0070662_100323892 3300005457 Bacteria 1257
61 Ga0070681_10127401 3300005458 Bacteria 2479
62 Ga0068867_100000662 3300005459 Bacteria 22816
63 Ga0068867_100003278 3300005459 Bacteria 11405
64 Ga0070679_100119696 3300005530 Bacteria 2618
65 Ga0070679_100218021 3300005530 Bacteria 1870
66 Ga0070684_100026091 3300005535 Bacteria 4918
67 Ga0070684_100082577 3300005535 Bacteria 2845
68 Ga0070684_100507901 3300005535 Bacteria 1117
69 Ga0068853_100002629 3300005539 Bacteria 13520
70 Ga0068853_100045219 3300005539 Bacteria 3770
71 Ga0068853_100260724 3300005539 Bacteria 1593
72 Ga0068853_100272406 3300005539 Bacteria 1559
73 Ga0070672_100000558 3300005543 Bacteria 21795
74 Ga0070672_100068098 3300005543 Bacteria 2823
75 Ga0070693_100172350 3300005547 Bacteria 1387
76 Ga0070665_100026709 3300005548 Bacteria 5814
77 Ga0070665_100353984 3300005548 Bacteria 1474
78 Ga0068855_100000591 3300005563 Bacteria 44412
79 Ga0068855_100024315 3300005563 Bacteria 7252
80 Ga0068855_100050704 3300005563 Bacteria 4890
81 Ga0068855_100824487 3300005563 Bacteria 984
82 Ga0068855_100824488 3300005563 Bacteria 984
83 Ga0070664_100002849 3300005564 Bacteria 13993
84 Ga0070664_100038934 3300005564 Bacteria 4003
85 Ga0070664_100055645 3300005564 Bacteria 3360
86 Ga0070664_100059468 3300005564 Bacteria 3251
87 Ga0070664_100265622 3300005564 Bacteria 1545
88 Ga0070664_100723989 3300005564 Bacteria 928
89 Ga0068857_100003855 3300005577 Bacteria 12623
90 Ga0068857_100030612 3300005577 Bacteria 4753
91 Ga0068857_100215003 3300005577 Bacteria 1755
92 Ga0068857_100319179 3300005577 Unclassified 1434
93 Ga0068854_100004086 3300005578 Bacteria 9170
94 Ga0068854_100006478 3300005578 Bacteria 7451
95 Ga0068854_100030779 3300005578 Bacteria 3725
96 Ga0068854_100065629 3300005578 Bacteria 2639
97 Ga0068854_100106929 3300005578 Bacteria 2105
98 Ga0068856_100000190 3300005614 Bacteria 64644
99 Ga0068856_101130020 3300005614 Bacteria 800
100 Ga0068852_100000395 3300005616 Bacteria 29245
101 Ga0068852_100008050 3300005616 Bacteria 7731
102 Ga0068852_100033583 3300005616 Bacteria 4262
103 Ga0068852_100038247 3300005616 Bacteria 4031
104 Ga0068852_100777761 3300005616 Bacteria 970
105 Ga0068859_100003615 3300005617 Bacteria 15772
106 Ga0068859_100040131 3300005617 Bacteria 4698
107 Ga0068864_100003050 3300005618 Bacteria 13831
108 Ga0068864_100014893 3300005618 Bacteria 6460
109 Ga0068864_100092522 3300005618 Bacteria 2669
110 Ga0068861_100007538 3300005719 Bacteria 7462
111 Ga0068861_100079615 3300005719 Bacteria 2562
112 Ga0068851_10009379 3300005834 Bacteria 4549
113 Ga0068851_10058749 3300005834 Bacteria 1966
114 Ga0068851_10210792 3300005834 Unclassified 1088
115 Ga0068863_100007016 3300005841 Bacteria 11040
116 Ga0068863_100026328 3300005841 Bacteria 5549
117 Ga0068863_100193014 3300005841 Bacteria 1957
118 Ga0068858_100011989 3300005842 Bacteria 8171
119 Ga0068858_100238813 3300005842 Bacteria 1724
120 Ga0068860_100002873 3300005843 Bacteria 17873
121 Ga0068860_100080459 3300005843 Bacteria 3098
122 Ga0068860_100428066 3300005843 Bacteria 1313
123 Ga0068862_100011149 3300005844 Bacteria 7422
124 Ga0075366_10399725 3300006195 Bacteria 846
125 Ga0097621_100007674 3300006237 Bacteria 7737
126 Ga0097621_100047899 3300006237 Bacteria 3465
127 Ga0068871_100086882 3300006358 Bacteria 2599
128 Ga0068871_100320466 3300006358 Bacteria 1365
129 Ga0097620_100003615 3300006931 Bacteria 15772
130 Ga0097620_100040129 3300006931 Bacteria 4698
131 Ga0075435_100202712 3300007076 Bacteria 1681
132 Ga0105251_10048416 3300009011 Bacteria 2037
133 Ga0105240_10131645 3300009093 Bacteria 2999
134 Ga0105240_10689078 3300009093 Bacteria 1116
135 Ga0105245_10002121 3300009098 Bacteria 17965
136 Ga0105243_10088307 3300009148 Bacteria 2547
137 Ga0105241_10058462 3300009174 Bacteria 2961
138 Ga0105241_11016169 3300009174 Bacteria 776
139 Ga0105248_10000083 3300009177 Bacteria 110619
140 Ga0105248_10001592 3300009177 Bacteria 25260
141 Ga0105248_11206301 3300009177 Unclassified 855
142 Ga0105237_10027386 3300009545 Bacteria 5819
143 Ga0105237_10125346 3300009545 Bacteria 2563
144 Ga0105238_10060953 3300009551 Bacteria 3776
145 Ga0105238_10150193 3300009551 Bacteria 2305
146 Ga0105239_10012707 3300010375 Bacteria 9369
147 Ga0105239_10504831 3300010375 Bacteria 1375
148 Ga0157373_10014518 3300013100 Bacteria 5773
149 Ga0157373_10027921 3300013100 Bacteria 4072
150 Ga0157373_10101879 3300013100 Bacteria 2020
151 Ga0157373_10448692 3300013100 Bacteria 928
152 Ga0157371_10008908 3300013102 Bacteria 7947
153 Ga0157371_10013378 3300013102 Bacteria 6234
154 Ga0157371_10051752 3300013102 Bacteria 2918
155 Ga0157371_10127961 3300013102 Bacteria 1806
156 Ga0157371_10306408 3300013102 Bacteria 1150
157 Ga0157370_10005277 3300013104 Bacteria 14518
158 Ga0157370_10072675 3300013104 Bacteria 3245
159 Ga0157370_10458885 3300013104 Unclassified 1171
160 Ga0157369_10331056 3300013105 Bacteria 1582
161 Ga0157369_11018104 3300013105 Bacteria 848
162 Ga0157374_10025193 3300013296 Bacteria 5338
163 Ga0157374_10131121 3300013296 Bacteria 2426
164 Ga0157374_10279882 3300013296 Bacteria 1647
165 Ga0157378_10000154 3300013297 Bacteria 64986
166 Ga0163162_10087181 3300013306 Bacteria 3200
167 Ga0157372_10042514 3300013307 Bacteria 5027
168 Ga0157372_10113320 3300013307 Bacteria 3108
169 Ga0157372_10905372 3300013307 Bacteria 1023
170 Ga0157375_10577897 3300013308 Bacteria 1284
171 Ga0163163_10000364 3300014325 Bacteria 43563
172 Ga0163163_10095748 3300014325 Bacteria 2988
173 Ga0163163_10209021 3300014325 Bacteria 2000
174 Ga0157379_10005320 3300014968 Bacteria 11057
175 Ga0197907_10545280 3300020069 Bacteria 1390
176 Ga0207697_10000059 3300025315 Bacteria 45306
177 Ga0207656_10080149 3300025321 Bacteria 1466
178 Ga0207688_10001805 3300025901 Bacteria 11389
179 Ga0207688_10051977 3300025901 Bacteria 2295
180 Ga0207680_10022148 3300025903 Bacteria 3451
181 Ga0207680_10090791 3300025903 Bacteria 1942
182 Ga0207647_10001983 3300025904 Bacteria 15649
183 Ga0207647_10003750 3300025904 Bacteria 11358
184 Ga0207647_10005744 3300025904 Bacteria 9057
185 Ga0207647_10034868 3300025904 Bacteria 3209
186 Ga0207647_10190981 3300025904 Bacteria 1187
187 Ga0207647_10192723 3300025904 Unclassified 1181
188 Ga0207645_10008346 3300025907 Bacteria 7233
189 Ga0207705_10000072 3300025909 Bacteria 126043
190 Ga0207705_10025156 3300025909 Bacteria 4250
191 Ga0207705_10062574 3300025909 Bacteria 2688
192 Ga0207654_10033330 3300025911 Bacteria 2854
193 Ga0207654_10544103 3300025911 Bacteria 824
194 Ga0207707_10114422 3300025912 Bacteria 2358
195 Ga0207695_10005583 3300025913 Bacteria 16616
196 Ga0207671_10062809 3300025914 Bacteria 2759
197 Ga0207671_10383211 3300025914 Bacteria 1117
198 Ga0207660_10056156 3300025917 Bacteria 2817
199 Ga0207657_10000496 3300025919 Bacteria 41552
200 Ga0207657_10007401 3300025919 Bacteria 11255
201 Ga0207657_10009405 3300025919 Bacteria 9827
202 Ga0207657_10010147 3300025919 Bacteria 9413
203 Ga0207657_10036902 3300025919 Bacteria 4371
204 Ga0207649_10000158 3300025920 Bacteria 55609
205 Ga0207649_10022700 3300025920 Bacteria 3626
206 Ga0207649_10069176 3300025920 Bacteria 2247
207 Ga0207649_10238154 3300025920 Bacteria 1305
208 Ga0207652_10103256 3300025921 Bacteria 2520
209 Ga0207681_10004274 3300025923 Bacteria 8818
210 Ga0207694_10056766 3300025924 Bacteria 3042
211 Ga0207650_10007030 3300025925 Bacteria 7674
212 Ga0207650_10035924 3300025925 Bacteria 3602
213 Ga0207650_10055340 3300025925 Bacteria 2945
214 Ga0207650_10212949 3300025925 Bacteria 1552
215 Ga0207650_10533394 3300025925 Bacteria 983
216 Ga0207659_10079781 3300025926 Bacteria 2416
217 Ga0207659_10085399 3300025926 Bacteria 2345
218 Ga0207687_10000745 3300025927 Bacteria 21993
219 Ga0207664_10186671 3300025929 Bacteria 1783
220 Ga0207644_10014155 3300025931 Bacteria 5335
221 Ga0207690_10001410 3300025932 Bacteria 15127
222 Ga0207690_10005347 3300025932 Bacteria 7567
223 Ga0207690_10006807 3300025932 Bacteria 6779
224 Ga0207690_10009277 3300025932 Bacteria 5846
225 Ga0207690_10012196 3300025932 Bacteria 5143
226 Ga0207690_10061001 3300025932 Bacteria 2562
227 Ga0207690_10439077 3300025932 Bacteria 1047
228 Ga0207706_10000041 3300025933 Bacteria 130090
229 Ga0207706_10000426 3300025933 Bacteria 45291
230 Ga0207706_10009215 3300025933 Bacteria 9068
231 Ga0207706_10296958 3300025933 Bacteria 1408
232 Ga0207709_10081304 3300025935 Bacteria 2089
233 Ga0207669_10150285 3300025937 Bacteria 1630
234 Ga0207704_10008562 3300025938 Bacteria 4898
235 Ga0207691_10000563 3300025940 Bacteria 37125
236 Ga0207691_10036319 3300025940 Bacteria 4565
237 Ga0207711_10387692 3300025941 Bacteria 1297
238 Ga0207689_10000128 3300025942 Bacteria 64122
239 Ga0207661_10002967 3300025944 Bacteria 11736
240 Ga0207661_10062691 3300025944 Bacteria 3008
241 Ga0207679_10003505 3300025945 Bacteria 9706
242 Ga0207679_10009869 3300025945 Bacteria 6130
243 Ga0207679_10199466 3300025945 Bacteria 1670
244 Ga0207667_10002008 3300025949 Bacteria 25533
245 Ga0207667_10012442 3300025949 Bacteria 9805
246 Ga0207667_10029689 3300025949 Bacteria 5926
247 Ga0207667_10309687 3300025949 Bacteria 1613
248 Ga0207651_10009399 3300025960 Bacteria 5349
249 Ga0207651_10244472 3300025960 Bacteria 1464
250 Ga0207668_10081042 3300025972 Bacteria 2353
251 Ga0207640_10000791 3300025981 Bacteria 17974
252 Ga0207640_10033277 3300025981 Bacteria 3206
253 Ga0207640_10229117 3300025981 Bacteria 1428
254 Ga0207658_10006868 3300025986 Bacteria 7753
255 Ga0207658_10059695 3300025986 Bacteria 2842
256 Ga0207658_10162842 3300025986 Bacteria 1830
257 Ga0207658_10413477 3300025986 Bacteria 1188
258 Ga0207658_10459869 3300025986 Unclassified 1128
259 Ga0207677_10007597 3300026023 Bacteria 6013
260 Ga0207703_10016065 3300026035 Bacteria 5839
261 Ga0207703_10087439 3300026035 Bacteria 2613
262 Ga0207639_10009793 3300026041 Bacteria 6621
263 Ga0207639_10126298 3300026041 Bacteria 2110
264 Ga0207639_10135239 3300026041 Bacteria 2046
265 Ga0207639_10155784 3300026041 Bacteria 1919
266 Ga0207639_10210548 3300026041 Bacteria 1673
267 Ga0207678_10004407 3300026067 Bacteria 12660
268 Ga0207678_10005554 3300026067 Bacteria 11268
269 Ga0207678_10015630 3300026067 Bacteria 6673
270 Ga0207678_10029713 3300026067 Bacteria 4772
271 Ga0207678_10055631 3300026067 Bacteria 3408
272 Ga0207678_10497668 3300026067 Bacteria 1062
273 Ga0207702_10003674 3300026078 Bacteria 13889
274 Ga0207702_10008508 3300026078 Bacteria 8652
275 Ga0207702_10052679 3300026078 Bacteria 3444
276 Ga0207702_10233701 3300026078 Bacteria 1719
277 Ga0207641_10036013 3300026088 Bacteria 4128
278 Ga0207648_10003077 3300026089 Bacteria 17625
279 Ga0207648_10006572 3300026089 Bacteria 11545
280 Ga0207676_10001069 3300026095 Bacteria 20852
281 Ga0207676_10032734 3300026095 Bacteria 3921
282 Ga0207676_10051296 3300026095 Bacteria 3220
283 Ga0207674_10000086 3300026116 Bacteria 100722
284 Ga0207674_10000531 3300026116 Bacteria 49979
285 Ga0207674_10001687 3300026116 Bacteria 28359
286 Ga0207674_10001715 3300026116 Bacteria 28037
287 Ga0207674_10004612 3300026116 Bacteria 16545
288 Ga0207674_10005367 3300026116 Bacteria 15246
289 Ga0207674_10145971 3300026116 Bacteria 2324
290 Ga0207675_100017776 3300026118 Bacteria 6633
291 Ga0207683_10180294 3300026121 Bacteria 1915
292 Ga0207698_10001441 3300026142 Bacteria 13822
293 Ga0207698_10025207 3300026142 Bacteria 4185
294 Ga0207698_10028911 3300026142 Bacteria 3961
295 Ga0207698_10040073 3300026142 Bacteria 3476
296 Ga0207698_10056284 3300026142 Bacteria 3036
297 Ga0207698_10201539 3300026142 Bacteria 1782
298 Ga0207698_10813418 3300026142 Bacteria 937
299 Ga0268266_10182109 3300028379 Bacteria 1913
300 Ga0268264_10002856 3300028381 Bacteria 15052
301 Ga0268264_10264380 3300028381 Bacteria 1604
302 Ga0268264_10533908 3300028381 Bacteria 1148
303 Ga0373923_0299781 3300035111 Unclassified 760
304 Ga0373957_0065706 3300035120 Bacteria 1412
305 Ga0373946_0244536 3300035171 Bacteria 873
306 Ga0373955_0130359 3300035172 Bacteria 1467
307 Ga0373961_0043599 3300035241 Bacteria 1305
308 Ga0373931_0008000 3300035691 Bacteria 5003
309 Ga0373937_0195014 3300036401 Bacteria 1903
310 Ga0395899_0000302 3300037312 Bacteria 63367
311 Ga0395899_0004923 3300037312 Bacteria 10387
312 Ga0395899_0006981 3300037312 Bacteria 8749
313 Ga0395899_0042187 3300037312 Bacteria 3406
314 Ga0395899_0062515 3300037312 Bacteria 2742
315 Ga0395899_0076095 3300037312 Bacteria 2450
316 Ga0395899_0098289 3300037312 Bacteria 2115
317 Ga0395899_0299517 3300037312 Bacteria 1088
318 Ga0395899_0303887 3300037312 Unclassified 1079
319 Ga0395900_0004490 3300037418 Bacteria 14773
320 Ga0395900_0012172 3300037418 Bacteria 8795
321 Ga0395900_0014297 3300037418 Bacteria 8102
322 Ga0395900_0016744 3300037418 Bacteria 7479
323 Ga0395900_0031945 3300037418 Bacteria 5411
324 Ga0395900_0045765 3300037418 Bacteria 4507
325 Ga0395900_0082279 3300037418 Bacteria 3307
326 Ga0395900_0109824 3300037418 Bacteria 2833
327 Ga0395900_0129170 3300037418 Bacteria 2590
328 Ga0395900_0192963 3300037418 Bacteria 2065
329 Ga0395900_0208471 3300037418 Bacteria 1974
330 Ga0395900_0234598 3300037418 Unclassified 1843
331 Ga0395900_0395333 3300037418 Bacteria 1348
332 Ga0395900_0538475 3300037418 Bacteria 1114
333 Ga0395900_0684361 3300037418 Bacteria 960
334 Ga0395898_0000054 3300037466 Bacteria 279561
335 Ga0395898_0002701 3300037466 Bacteria 20519
336 Ga0395898_0010003 3300037466 Bacteria 9930
337 Ga0395898_0176111 3300037466 Bacteria 2044
338 Ga0395898_0176623 3300037466 Bacteria 2041
339 Ga0395898_0252662 3300037466 Bacteria 1681
340 Ga0395898_0264659 3300037466 Unclassified 1640
341 Ga0395898_0311781 3300037466 Bacteria 1501
342 Ga0395898_0417195 3300037466 Bacteria 1279
343 Ga0395898_0541028 3300037466 Bacteria 1106
344 Ga0395905_0000046 3300037471 Bacteria 240463
345 Ga0395905_0003223 3300037471 Bacteria 17551
346 Ga0395905_0008041 3300037471 Bacteria 10420
347 Ga0395905_0011911 3300037471 Bacteria 8387
348 Ga0395905_0014089 3300037471 Bacteria 7644
349 Ga0395905_0027561 3300037471 Bacteria 5357
350 Ga0395905_0030456 3300037471 Bacteria 5085
351 Ga0395905_0037798 3300037471 Bacteria 4531
352 Ga0395905_0043892 3300037471 Bacteria 4195
353 Ga0395905_0072172 3300037471 Bacteria 3236
354 Ga0395905_0079251 3300037471 Bacteria 3078
355 Ga0395905_0093281 3300037471 Bacteria 2823
356 Ga0395905_0293218 3300037471 Bacteria 1513
357 Ga0395905_0569958 3300037471 Bacteria 1033
358 Ga0436364_0834683 3300037853 Unclassified 1239
359 Ga0395901_0000375 3300038443 Bacteria 53750
360 Ga0395901_0002307 3300038443 Bacteria 19441
361 Ga0395901_0005438 3300038443 Bacteria 12892
362 Ga0395901_0006240 3300038443 Bacteria 12082
363 Ga0395901_0012705 3300038443 Bacteria 8541
364 Ga0395901_0049375 3300038443 Bacteria 4371
365 Ga0395901_0057638 3300038443 Bacteria 4040
366 Ga0395901_0070253 3300038443 Bacteria 3648
367 Ga0395901_0110468 3300038443 Bacteria 2886
368 Ga0395901_0123870 3300038443 Bacteria 2716
369 Ga0395901_0128414 3300038443 Bacteria 2664
370 Ga0395901_0190719 3300038443 Bacteria 2149
371 Ga0395901_0434505 3300038443 Bacteria 1344
372 Ga0466969_0165663 3300044656 Bacteria 1014
373 Ga0466965_0160049 3300044683 Bacteria 1180
374 Ga0466961_0164936 3300044693 Bacteria 1380
375 Ga0466963_0049141 3300044694 Bacteria 2789
376 Ga0466963_0131298 3300044694 Bacteria 1730
377 Ga0466963_0215962 3300044694 Bacteria 1342
378 Ga0466964_0008952 3300044706 Bacteria 3766
379 Ga0466964_0016475 3300044706 Bacteria 2823
380 Ga0466970_0009442 3300044765 Bacteria 4931
381 Ga0466970_0012120 3300044765 Bacteria 4402
382 Ga0466957_0012152 3300044842 Bacteria 4981
383 Ga0466960_0032729 3300044901 Bacteria 2410
384 Ga0466959_0036243 3300045049 Bacteria 3644
385 Ga0466959_0068370 3300045049 Bacteria 2574
386 Ga0466958_0016344 3300045836 Bacteria 4272
387 Ga0466958_0034867 3300045836 Bacteria 3003
388 Ga0466958_0048167 3300045836 Bacteria 2575
389 Ga0466967_0002087 3300045976 Bacteria 12237
390 Ga0466967_0019275 3300045976 Bacteria 5482
391 Ga0466967_0054900 3300045976 Bacteria 3508
392 Ga0466967_0152179 3300045976 Bacteria 2163
393 Ga0466967_0400436 3300045976 Bacteria 1335
394 Ga0466967_0625400 3300045976 Bacteria 1063
395 Ga0466967_0779542 3300045976 Unclassified 949
396 Ga0495623_0119267 3300046679 Bacteria 1590
397 Ga0496100_0191006 3300048903 Bacteria 1487
398 Ga0496102_0022374 3300048905 Bacteria 5601
399 Ga0496103_0031204 3300048906 Bacteria 3246
400 Ga0496106_0269354 3300048909 Bacteria 1363
401 Ga0496107_0042345 3300048910 Bacteria 3270
402 Ga0496109_0023599 3300048912 Bacteria 5460
403 Ga0496110_0324488 3300048913 Bacteria 1402
404 Ga0496111_0039667 3300048914 Bacteria 3377
405 Ga0496111_0714966 3300048914 Bacteria 728
406 Ga0496112_0000950 3300048915 Bacteria 21045
407 Ga0496112_0056604 3300048915 Bacteria 3859
408 Ga0496112_0278102 3300048915 Bacteria 1622
409 Ga0496113_0000977 3300048916 Bacteria 15240
410 Ga0496113_0114074 3300048916 Bacteria 2106
411 nmdc:mga0k408_267144_c1 3300050493 Unclassified 1021

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013102 Ga0157371_10127961 Ga0157371_101279612 151
2 3300037418 Ga0395900_0014297 Ga0395900_0014297_1061_1750 163
3 3300037466 Ga0395898_0311781 Ga0395898_0311781_585_1274 163
4 3300038443 Ga0395901_0000375 Ga0395901_0000375_40018_40707 163
5 3300038443 Ga0395901_0005438 Ga0395901_0005438_7230_7928 164
6 3300037312 Ga0395899_0062515 Ga0395899_0062515_1190_1888 165
7 3300037418 Ga0395900_0234598 Ga0395900_0234598_1063_1761 165
8 3300044694 Ga0466963_0049141 Ga0466963_0049141_745_1437 165
9 3300044901 Ga0466960_0032729 Ga0466960_0032729_46_735 165
10 3300035120 Ga0373957_0065706 Ga0373957_0065706_208_897 166
11 3300035111 Ga0373923_0299781 Ga0373923_0299781_25_714 168
12 3300035172 Ga0373955_0130359 Ga0373955_0130359_374_1063 168
13 3300036401 Ga0373937_0195014 Ga0373937_0195014_530_1219 168
14 3300046679 Ga0495623_0119267 Ga0495623_0119267_398_1087 168
15 3300044765 Ga0466970_0012120 Ga0466970_0012120_2836_3579 170
16 3300045976 Ga0466967_0054900 Ga0466967_0054900_986_1678 170
17 3300005435 Ga0070714_100123453 Ga0070714_1001234533 171
18 3300013296 Ga0157374_10131121 Ga0157374_101311212 173
19 3300005327 Ga0070658_10000374 Ga0070658_1000037411 174
20 3300005330 Ga0070690_100194437 Ga0070690_1001944372 174
21 3300005339 Ga0070660_100000209 Ga0070660_10000020911 174
22 3300005457 Ga0070662_100000012 Ga0070662_10000001271 174
23 3300005548 Ga0070665_100026709 Ga0070665_1000267097 174
24 3300005563 Ga0068855_100000591 Ga0068855_10000059144 174
25 3300005564 Ga0070664_100002849 Ga0070664_10000284911 174
26 3300005578 Ga0068854_100006478 Ga0068854_1000064788 174
27 3300005614 Ga0068856_100000190 Ga0068856_10000019011 174
28 3300005616 Ga0068852_100000395 Ga0068852_10000039513 174
29 3300005618 Ga0068864_100014893 Ga0068864_1000148933 174
30 3300005843 Ga0068860_100428066 Ga0068860_1004280662 174
31 3300006358 Ga0068871_100086882 Ga0068871_1000868822 174
32 3300009177 Ga0105248_10000083 Ga0105248_1000008349 174
33 3300013102 Ga0157371_10013378 Ga0157371_100133787 174
34 3300013104 Ga0157370_10072675 Ga0157370_100726753 174
35 3300014325 Ga0163163_10000364 Ga0163163_1000036442 174
36 3300025903 Ga0207680_10022148 Ga0207680_100221483 174
37 3300025904 Ga0207647_10005744 Ga0207647_100057444 174
38 3300025909 Ga0207705_10000072 Ga0207705_1000007254 174
39 3300025919 Ga0207657_10000496 Ga0207657_1000049611 174
40 3300025920 Ga0207649_10000158 Ga0207649_1000015837 174
41 3300025925 Ga0207650_10055340 Ga0207650_100553403 174
42 3300025931 Ga0207644_10014155 Ga0207644_100141553 174
43 3300025932 Ga0207690_10005347 Ga0207690_100053478 174
44 3300025933 Ga0207706_10000041 Ga0207706_1000004155 174
45 3300025941 Ga0207711_10387692 Ga0207711_103876922 174
46 3300025944 Ga0207661_10002967 Ga0207661_1000296711 174
47 3300025945 Ga0207679_10003505 Ga0207679_100035054 174
48 3300025949 Ga0207667_10002008 Ga0207667_1000200825 174
49 3300025981 Ga0207640_10033277 Ga0207640_100332773 174
50 3300025986 Ga0207658_10006868 Ga0207658_100068682 174
51 3300026041 Ga0207639_10009793 Ga0207639_100097934 174
52 3300026067 Ga0207678_10005554 Ga0207678_1000555412 174
53 3300026078 Ga0207702_10003674 Ga0207702_1000367411 174
54 3300026095 Ga0207676_10032734 Ga0207676_100327344 174
55 3300026142 Ga0207698_10001441 Ga0207698_100014419 174
56 3300028379 Ga0268266_10182109 Ga0268266_101821092 174
57 3300028381 Ga0268264_10533908 Ga0268264_105339082 174
58 3300035241 Ga0373961_0043599 Ga0373961_0043599_375_1067 174
59 3300035691 Ga0373931_0008000 Ga0373931_0008000_44_736 174
60 3300037471 Ga0395905_0030456 Ga0395905_0030456_502_1200 174
61 3300044656 Ga0466969_0165663 Ga0466969_0165663_15_752 174
62 3300048914 Ga0496111_0714966 Ga0496111_0714966_15_707 174
63 3300005366 Ga0070659_100317251 Ga0070659_1003172512 175
64 3300005455 Ga0070663_100039702 Ga0070663_1000397024 175
65 3300005563 Ga0068855_100824487 Ga0068855_1008244871 175
66 3300005578 Ga0068854_100106929 Ga0068854_1001069292 175
67 3300013100 Ga0157373_10448692 Ga0157373_104486922 175
68 3300013307 Ga0157372_10905372 Ga0157372_109053722 175
69 3300026116 Ga0207674_10004612 Ga0207674_1000461211 176
70 3300005366 Ga0070659_100127386 Ga0070659_1001273863 177
71 3300037312 Ga0395899_0004923 Ga0395899_0004923_4027_4716 177
72 3300037418 Ga0395900_0031945 Ga0395900_0031945_1821_2510 177
73 3300037466 Ga0395898_0002701 Ga0395898_0002701_10525_11214 177
74 3300037471 Ga0395905_0011911 Ga0395905_0011911_4917_5606 177
75 3300044706 Ga0466964_0008952 Ga0466964_0008952_360_1049 177
76 3300044683 Ga0466965_0160049 Ga0466965_0160049_394_1131 178
77 3300045976 Ga0466967_0152179 Ga0466967_0152179_76_765 178
78 3300045976 Ga0466967_0400436 Ga0466967_0400436_608_1297 178
79 3300045976 Ga0466967_0779542 Ga0466967_0779542_166_855 178
80 3300045976 Ga0466967_0625400 Ga0466967_0625400_111_821 179
81 3300035171 Ga0373946_0244536 Ga0373946_0244536_74_700 180
82 3300037471 Ga0395905_0027561 Ga0395905_0027561_1691_2401 182
83 3300038443 Ga0395901_0006240 Ga0395901_0006240_4122_4832 182
84 3300025932 Ga0207690_10006807 Ga0207690_100068078 184
85 3300045976 Ga0466967_0002087 Ga0466967_0002087_5833_6522 184
86 3300026095 Ga0207676_10001069 Ga0207676_1000106915 185
87 3300001990 JGI24737J22298_10000206 JGI24737J22298_100002064 186
88 3300005353 Ga0070669_100149851 Ga0070669_1001498512 186
89 3300005577 Ga0068857_100319179 Ga0068857_1003191792 186
90 3300005719 Ga0068861_100079615 Ga0068861_1000796154 186
91 3300005841 Ga0068863_100193014 Ga0068863_1001930143 186
92 3300014325 Ga0163163_10095748 Ga0163163_100957482 186
93 3300025901 Ga0207688_10051977 Ga0207688_100519774 186
94 3300025904 Ga0207647_10192723 Ga0207647_101927231 186
95 3300025925 Ga0207650_10035924 Ga0207650_100359243 186
96 3300025932 Ga0207690_10012196 Ga0207690_100121964 186
97 3300026116 Ga0207674_10000086 Ga0207674_1000008679 186
98 3300045049 Ga0466959_0068370 Ga0466959_0068370_1597_2250 186
99 3300048915 Ga0496112_0278102 Ga0496112_0278102_443_1177 186
100 3300005563 Ga0068855_100050704 Ga0068855_1000507046 188
101 3300009093 Ga0105240_10689078 Ga0105240_106890782 188
102 3300013104 Ga0157370_10005277 Ga0157370_100052773 188
103 3300025949 Ga0207667_10309687 Ga0207667_103096871 188
104 3300005344 Ga0070661_100032636 Ga0070661_1000326364 190
105 3300005356 Ga0070674_100196452 Ga0070674_1001964522 190
106 3300005366 Ga0070659_100028961 Ga0070659_1000289612 190
107 3300005535 Ga0070684_100507901 Ga0070684_1005079011 190
108 3300013100 Ga0157373_10101879 Ga0157373_101018792 190
109 3300013105 Ga0157369_11018104 Ga0157369_110181042 190
110 3300025925 Ga0207650_10533394 Ga0207650_105333942 190
111 3300025933 Ga0207706_10296958 Ga0207706_102969582 190
112 3300025937 Ga0207669_10150285 Ga0207669_101502852 190
113 3300026067 Ga0207678_10015630 Ga0207678_100156305 190
114 3300026116 Ga0207674_10145971 Ga0207674_101459713 190
115 3300037312 Ga0395899_0042187 Ga0395899_0042187_2608_3306 190
116 3300037418 Ga0395900_0082279 Ga0395900_0082279_1704_2402 190
117 3300037418 Ga0395900_0538475 Ga0395900_0538475_116_844 190
118 3300037466 Ga0395898_0541028 Ga0395898_0541028_308_1006 190
119 3300037471 Ga0395905_0093281 Ga0395905_0093281_2026_2724 190
120 3300038443 Ga0395901_0434505 Ga0395901_0434505_339_1037 190
121 3300001979 JGI24740J21852_10000442 JGI24740J21852_100004429 191
122 3300001989 JGI24739J22299_10000307 JGI24739J22299_100003073 191
123 3300001990 JGI24737J22298_10000252 JGI24737J22298_100002528 191
124 3300002075 JGI24738J21930_10000885 JGI24738J21930_100008853 191
125 3300005328 Ga0070676_10007504 Ga0070676_100075042 191
126 3300005331 Ga0070670_100148762 Ga0070670_1001487622 191
127 3300005334 Ga0068869_100163275 Ga0068869_1001632751 191
128 3300005338 Ga0068868_100001128 Ga0068868_1000011286 191
129 3300005347 Ga0070668_100007947 Ga0070668_1000079474 191
130 3300005353 Ga0070669_100001511 Ga0070669_10000151115 191
131 3300005354 Ga0070675_100171501 Ga0070675_1001715012 191
132 3300005355 Ga0070671_100008331 Ga0070671_1000083312 191
133 3300005364 Ga0070673_100002049 Ga0070673_10000204912 191
134 3300005366 Ga0070659_100000565 Ga0070659_10000056514 191
135 3300005367 Ga0070667_100001792 Ga0070667_10000179211 191
136 3300005457 Ga0070662_100000854 Ga0070662_10000085410 191
137 3300005459 Ga0068867_100000662 Ga0068867_10000066212 191
138 3300005539 Ga0068853_100002629 Ga0068853_10000262912 191
139 3300005543 Ga0070672_100000558 Ga0070672_1000005589 191
140 3300005548 Ga0070665_100353984 Ga0070665_1003539841 191
141 3300005563 Ga0068855_100024315 Ga0068855_1000243156 191
142 3300005564 Ga0070664_100055645 Ga0070664_1000556454 191
143 3300005577 Ga0068857_100003855 Ga0068857_1000038558 191
144 3300005578 Ga0068854_100004086 Ga0068854_10000408610 191
145 3300005616 Ga0068852_100008050 Ga0068852_1000080508 191
146 3300005617 Ga0068859_100003615 Ga0068859_1000036157 191
147 3300005618 Ga0068864_100003050 Ga0068864_1000030506 191
148 3300005719 Ga0068861_100007538 Ga0068861_1000075388 191
149 3300005834 Ga0068851_10058749 Ga0068851_100587493 191
150 3300005841 Ga0068863_100007016 Ga0068863_1000070162 191
151 3300005842 Ga0068858_100011989 Ga0068858_1000119899 191
152 3300005843 Ga0068860_100002873 Ga0068860_1000028734 191
153 3300005844 Ga0068862_100011149 Ga0068862_1000111492 191
154 3300006237 Ga0097621_100047899 Ga0097621_1000478992 191
155 3300006358 Ga0068871_100320466 Ga0068871_1003204661 191
156 3300006931 Ga0097620_100003615 Ga0097620_1000036157 191
157 3300009098 Ga0105245_10002121 Ga0105245_100021219 191
158 3300009148 Ga0105243_10088307 Ga0105243_100883072 191
159 3300009174 Ga0105241_10058462 Ga0105241_100584623 191
160 3300009177 Ga0105248_10001592 Ga0105248_1000159212 191
161 3300009551 Ga0105238_10150193 Ga0105238_101501932 191
162 3300013100 Ga0157373_10014518 Ga0157373_100145187 191
163 3300013102 Ga0157371_10008908 Ga0157371_100089089 191
164 3300013297 Ga0157378_10000154 Ga0157378_1000015475 191
165 3300013306 Ga0163162_10087181 Ga0163162_100871813 191
166 3300013307 Ga0157372_10042514 Ga0157372_100425147 191
167 3300013308 Ga0157375_10577897 Ga0157375_105778972 191
168 3300025315 Ga0207697_10000059 Ga0207697_1000005912 191
169 3300025901 Ga0207688_10001805 Ga0207688_1000180512 191
170 3300025904 Ga0207647_10001983 Ga0207647_1000198311 191
171 3300025907 Ga0207645_10008346 Ga0207645_100083468 191
172 3300025911 Ga0207654_10033330 Ga0207654_100333303 191
173 3300025919 Ga0207657_10010147 Ga0207657_100101473 191
174 3300025923 Ga0207681_10004274 Ga0207681_100042744 191
175 3300025925 Ga0207650_10007030 Ga0207650_100070308 191
176 3300025926 Ga0207659_10079781 Ga0207659_100797811 191
177 3300025927 Ga0207687_10000745 Ga0207687_100007453 191
178 3300025933 Ga0207706_10000426 Ga0207706_1000042612 191
179 3300025935 Ga0207709_10081304 Ga0207709_100813043 191
180 3300025938 Ga0207704_10008562 Ga0207704_100085624 191
181 3300025940 Ga0207691_10000563 Ga0207691_1000056323 191
182 3300025942 Ga0207689_10000128 Ga0207689_1000012852 191
183 3300025945 Ga0207679_10199466 Ga0207679_101994661 191
184 3300025949 Ga0207667_10029689 Ga0207667_100296898 191
185 3300025960 Ga0207651_10009399 Ga0207651_100093997 191
186 3300025972 Ga0207668_10081042 Ga0207668_100810423 191
187 3300025981 Ga0207640_10000791 Ga0207640_100007918 191
188 3300025986 Ga0207658_10059695 Ga0207658_100596952 191
189 3300026023 Ga0207677_10007597 Ga0207677_100075978 191
190 3300026035 Ga0207703_10016065 Ga0207703_100160652 191
191 3300026041 Ga0207639_10126298 Ga0207639_101262983 191
192 3300026089 Ga0207648_10003077 Ga0207648_100030778 191
193 3300026116 Ga0207674_10000531 Ga0207674_1000053155 191
194 3300026118 Ga0207675_100017776 Ga0207675_1000177765 191
195 3300026142 Ga0207698_10028911 Ga0207698_100289115 191
196 3300028381 Ga0268264_10002856 Ga0268264_100028564 191
197 3300005335 Ga0070666_10046219 Ga0070666_100462192 192
198 3300005354 Ga0070675_100092185 Ga0070675_1000921853 192
199 3300005364 Ga0070673_100404988 Ga0070673_1004049882 192
200 3300005364 Ga0070673_100407038 Ga0070673_1004070382 192
201 3300005367 Ga0070667_100158360 Ga0070667_1001583603 192
202 3300005367 Ga0070667_100256718 Ga0070667_1002567182 192
203 3300005456 Ga0070678_100098004 Ga0070678_1000980042 192
204 3300005458 Ga0070681_10127401 Ga0070681_101274012 192
205 3300005459 Ga0068867_100003278 Ga0068867_10000327810 192
206 3300005530 Ga0070679_100218021 Ga0070679_1002180212 192
207 3300005539 Ga0068853_100272406 Ga0068853_1002724062 192
208 3300005543 Ga0070672_100068098 Ga0070672_1000680983 192
209 3300005564 Ga0070664_100723989 Ga0070664_1007239891 192
210 3300005577 Ga0068857_100215003 Ga0068857_1002150032 192
211 3300005578 Ga0068854_100065629 Ga0068854_1000656292 192
212 3300005616 Ga0068852_100033583 Ga0068852_1000335835 192
213 3300005834 Ga0068851_10009379 Ga0068851_100093793 192
214 3300009177 Ga0105248_11206301 Ga0105248_112063012 192
215 3300025903 Ga0207680_10090791 Ga0207680_100907912 192
216 3300025911 Ga0207654_10544103 Ga0207654_105441032 192
217 3300025912 Ga0207707_10114422 Ga0207707_101144223 192
218 3300025919 Ga0207657_10036902 Ga0207657_100369024 192
219 3300025925 Ga0207650_10212949 Ga0207650_102129492 192
220 3300025926 Ga0207659_10085399 Ga0207659_100853992 192
221 3300025940 Ga0207691_10036319 Ga0207691_100363196 192
222 3300025960 Ga0207651_10244472 Ga0207651_102444722 192
223 3300025986 Ga0207658_10413477 Ga0207658_104134772 192
224 3300025986 Ga0207658_10459869 Ga0207658_104598692 192
225 3300026035 Ga0207703_10087439 Ga0207703_100874392 192
226 3300026041 Ga0207639_10155784 Ga0207639_101557843 192
227 3300026089 Ga0207648_10006572 Ga0207648_1000657210 192
228 3300026121 Ga0207683_10180294 Ga0207683_101802943 192
229 3300026142 Ga0207698_10025207 Ga0207698_100252072 192
230 3300037853 Ga0436364_0834683 Ga0436364_0834683_283_996 192
231 3300038443 Ga0395901_0123870 Ga0395901_0123870_403_1092 192
232 3300001976 JGI24752J21851_1009606 JGI24752J21851_10096062 193
233 3300001979 JGI24740J21852_10003212 JGI24740J21852_100032126 193
234 3300005327 Ga0070658_10234221 Ga0070658_102342211 193
235 3300005329 Ga0070683_100004192 Ga0070683_10000419213 193
236 3300005329 Ga0070683_100091962 Ga0070683_1000919624 193
237 3300005336 Ga0070680_100058253 Ga0070680_1000582532 193
238 3300005337 Ga0070682_100043402 Ga0070682_1000434023 193
239 3300005337 Ga0070682_100280308 Ga0070682_1002803082 193
240 3300005339 Ga0070660_100068086 Ga0070660_1000680863 193
241 3300005339 Ga0070660_100222197 Ga0070660_1002221972 193
242 3300005339 Ga0070660_100279560 Ga0070660_1002795603 193
243 3300005339 Ga0070660_100476090 Ga0070660_1004760902 193
244 3300005341 Ga0070691_10017346 Ga0070691_100173462 193
245 3300005344 Ga0070661_100085764 Ga0070661_1000857642 193
246 3300005345 Ga0070692_10046140 Ga0070692_100461403 193
247 3300005355 Ga0070671_100015829 Ga0070671_1000158297 193
248 3300005366 Ga0070659_100007554 Ga0070659_1000075542 193
249 3300005366 Ga0070659_100075531 Ga0070659_1000755312 193
250 3300005366 Ga0070659_100365248 Ga0070659_1003652482 193
251 3300005367 Ga0070667_100151191 Ga0070667_1001511913 193
252 3300005435 Ga0070714_100028574 Ga0070714_1000285746 193
253 3300005455 Ga0070663_100014574 Ga0070663_1000145743 193
254 3300005455 Ga0070663_100035009 Ga0070663_1000350093 193
255 3300005457 Ga0070662_100323892 Ga0070662_1003238922 193
256 3300005530 Ga0070679_100119696 Ga0070679_1001196962 193
257 3300005535 Ga0070684_100026091 Ga0070684_1000260914 193
258 3300005535 Ga0070684_100082577 Ga0070684_1000825772 193
259 3300005539 Ga0068853_100045219 Ga0068853_1000452193 193
260 3300005539 Ga0068853_100260724 Ga0068853_1002607242 193
261 3300005547 Ga0070693_100172350 Ga0070693_1001723502 193
262 3300005563 Ga0068855_100824488 Ga0068855_1008244881 193
263 3300005564 Ga0070664_100038934 Ga0070664_1000389343 193
264 3300005564 Ga0070664_100059468 Ga0070664_1000594683 193
265 3300005564 Ga0070664_100265622 Ga0070664_1002656223 193
266 3300005577 Ga0068857_100030612 Ga0068857_1000306123 193
267 3300005578 Ga0068854_100030779 Ga0068854_1000307793 193
268 3300005614 Ga0068856_101130020 Ga0068856_1011300201 193
269 3300005616 Ga0068852_100038247 Ga0068852_1000382472 193
270 3300005616 Ga0068852_100777761 Ga0068852_1007777612 193
271 3300005617 Ga0068859_100040131 Ga0068859_1000401315 193
272 3300005618 Ga0068864_100092522 Ga0068864_1000925223 193
273 3300005834 Ga0068851_10210792 Ga0068851_102107922 193
274 3300005841 Ga0068863_100026328 Ga0068863_1000263283 193
275 3300005842 Ga0068858_100238813 Ga0068858_1002388132 193
276 3300005843 Ga0068860_100080459 Ga0068860_1000804593 193
277 3300006195 Ga0075366_10399725 Ga0075366_103997252 193
278 3300006237 Ga0097621_100007674 Ga0097621_1000076748 193
279 3300006931 Ga0097620_100040129 Ga0097620_1000401293 193
280 3300007076 Ga0075435_100202712 Ga0075435_1002027123 193
281 3300009011 Ga0105251_10048416 Ga0105251_100484162 193
282 3300009093 Ga0105240_10131645 Ga0105240_101316452 193
283 3300009174 Ga0105241_11016169 Ga0105241_110161691 193
284 3300009545 Ga0105237_10027386 Ga0105237_100273867 193
285 3300009545 Ga0105237_10125346 Ga0105237_101253462 193
286 3300009551 Ga0105238_10060953 Ga0105238_100609533 193
287 3300010375 Ga0105239_10012707 Ga0105239_100127078 193
288 3300010375 Ga0105239_10504831 Ga0105239_105048312 193
289 3300013100 Ga0157373_10027921 Ga0157373_100279216 193
290 3300013102 Ga0157371_10051752 Ga0157371_100517522 193
291 3300013102 Ga0157371_10306408 Ga0157371_103064082 193
292 3300013104 Ga0157370_10458885 Ga0157370_104588852 193
293 3300013105 Ga0157369_10331056 Ga0157369_103310562 193
294 3300013296 Ga0157374_10025193 Ga0157374_100251932 193
295 3300013296 Ga0157374_10279882 Ga0157374_102798822 193
296 3300013307 Ga0157372_10113320 Ga0157372_101133202 193
297 3300014325 Ga0163163_10209021 Ga0163163_102090211 193
298 3300014968 Ga0157379_10005320 Ga0157379_100053202 193
299 3300020069 Ga0197907_10545280 Ga0197907_105452802 193
300 3300025321 Ga0207656_10080149 Ga0207656_100801492 193
301 3300025904 Ga0207647_10003750 Ga0207647_1000375012 193
302 3300025904 Ga0207647_10034868 Ga0207647_100348682 193
303 3300025904 Ga0207647_10190981 Ga0207647_101909812 193
304 3300025909 Ga0207705_10025156 Ga0207705_100251562 193
305 3300025909 Ga0207705_10062574 Ga0207705_100625743 193
306 3300025913 Ga0207695_10005583 Ga0207695_1000558316 193
307 3300025914 Ga0207671_10062809 Ga0207671_100628092 193
308 3300025914 Ga0207671_10383211 Ga0207671_103832112 193
309 3300025917 Ga0207660_10056156 Ga0207660_100561562 193
310 3300025919 Ga0207657_10007401 Ga0207657_1000740111 193
311 3300025919 Ga0207657_10009405 Ga0207657_100094057 193
312 3300025920 Ga0207649_10022700 Ga0207649_100227004 193
313 3300025920 Ga0207649_10069176 Ga0207649_100691762 193
314 3300025920 Ga0207649_10238154 Ga0207649_102381542 193
315 3300025921 Ga0207652_10103256 Ga0207652_101032562 193
316 3300025924 Ga0207694_10056766 Ga0207694_100567664 193
317 3300025929 Ga0207664_10186671 Ga0207664_101866712 193
318 3300025932 Ga0207690_10001410 Ga0207690_1000141018 193
319 3300025932 Ga0207690_10009277 Ga0207690_100092777 193
320 3300025932 Ga0207690_10061001 Ga0207690_100610013 193
321 3300025932 Ga0207690_10439077 Ga0207690_104390772 193
322 3300025933 Ga0207706_10009215 Ga0207706_100092157 193
323 3300025944 Ga0207661_10062691 Ga0207661_100626912 193
324 3300025945 Ga0207679_10009869 Ga0207679_100098697 193
325 3300025949 Ga0207667_10012442 Ga0207667_100124423 193
326 3300025981 Ga0207640_10229117 Ga0207640_102291173 193
327 3300025986 Ga0207658_10162842 Ga0207658_101628423 193
328 3300026041 Ga0207639_10135239 Ga0207639_101352392 193
329 3300026041 Ga0207639_10210548 Ga0207639_102105481 193
330 3300026067 Ga0207678_10004407 Ga0207678_100044078 193
331 3300026067 Ga0207678_10029713 Ga0207678_100297134 193
332 3300026067 Ga0207678_10055631 Ga0207678_100556312 193
333 3300026067 Ga0207678_10497668 Ga0207678_104976681 193
334 3300026078 Ga0207702_10008508 Ga0207702_100085083 193
335 3300026078 Ga0207702_10052679 Ga0207702_100526792 193
336 3300026078 Ga0207702_10233701 Ga0207702_102337011 193
337 3300026088 Ga0207641_10036013 Ga0207641_100360135 193
338 3300026095 Ga0207676_10051296 Ga0207676_100512963 193
339 3300026116 Ga0207674_10001687 Ga0207674_1000168735 193
340 3300026116 Ga0207674_10001715 Ga0207674_1000171512 193
341 3300026116 Ga0207674_10005367 Ga0207674_1000536713 193
342 3300026142 Ga0207698_10040073 Ga0207698_100400734 193
343 3300026142 Ga0207698_10056284 Ga0207698_100562843 193
344 3300026142 Ga0207698_10201539 Ga0207698_102015392 193
345 3300026142 Ga0207698_10813418 Ga0207698_108134182 193
346 3300028381 Ga0268264_10264380 Ga0268264_102643802 193
347 3300037312 Ga0395899_0000302 Ga0395899_0000302_55926_56624 193
348 3300037312 Ga0395899_0006981 Ga0395899_0006981_5829_6545 193
349 3300037312 Ga0395899_0076095 Ga0395899_0076095_359_1048 193
350 3300037312 Ga0395899_0098289 Ga0395899_0098289_644_1339 193
351 3300037312 Ga0395899_0299517 Ga0395899_0299517_52_783 193
352 3300037312 Ga0395899_0303887 Ga0395899_0303887_46_783 193
353 3300037418 Ga0395900_0004490 Ga0395900_0004490_7557_8255 193
354 3300037418 Ga0395900_0012172 Ga0395900_0012172_546_1262 193
355 3300037418 Ga0395900_0016744 Ga0395900_0016744_840_1550 193
356 3300037418 Ga0395900_0045765 Ga0395900_0045765_2434_3126 193
357 3300037418 Ga0395900_0109824 Ga0395900_0109824_1696_2385 193
358 3300037418 Ga0395900_0129170 Ga0395900_0129170_370_1086 193
359 3300037418 Ga0395900_0192963 Ga0395900_0192963_1222_1938 193
360 3300037418 Ga0395900_0208471 Ga0395900_0208471_1142_1837 193
361 3300037418 Ga0395900_0395333 Ga0395900_0395333_551_1252 193
362 3300037418 Ga0395900_0684361 Ga0395900_0684361_168_866 193
363 3300037466 Ga0395898_0000054 Ga0395898_0000054_46581_47279 193
364 3300037466 Ga0395898_0010003 Ga0395898_0010003_8904_9620 193
365 3300037466 Ga0395898_0176111 Ga0395898_0176111_602_1333 193
366 3300037466 Ga0395898_0176623 Ga0395898_0176623_455_1171 193
367 3300037466 Ga0395898_0252662 Ga0395898_0252662_894_1631 193
368 3300037466 Ga0395898_0264659 Ga0395898_0264659_222_938 193
369 3300037466 Ga0395898_0417195 Ga0395898_0417195_478_1167 193
370 3300037471 Ga0395905_0000046 Ga0395905_0000046_7587_8285 193
371 3300037471 Ga0395905_0003223 Ga0395905_0003223_5005_5712 193
372 3300037471 Ga0395905_0008041 Ga0395905_0008041_8883_9599 193
373 3300037471 Ga0395905_0014089 Ga0395905_0014089_5574_6263 193
374 3300037471 Ga0395905_0037798 Ga0395905_0037798_1796_2497 193
375 3300037471 Ga0395905_0043892 Ga0395905_0043892_2667_3383 193
376 3300037471 Ga0395905_0072172 Ga0395905_0072172_833_1549 193
377 3300037471 Ga0395905_0079251 Ga0395905_0079251_2128_2844 193
378 3300037471 Ga0395905_0293218 Ga0395905_0293218_137_832 193
379 3300037471 Ga0395905_0569958 Ga0395905_0569958_188_877 193
380 3300038443 Ga0395901_0002307 Ga0395901_0002307_1359_2066 193
381 3300038443 Ga0395901_0012705 Ga0395901_0012705_7234_7932 193
382 3300038443 Ga0395901_0049375 Ga0395901_0049375_2169_2885 193
383 3300038443 Ga0395901_0057638 Ga0395901_0057638_2670_3386 193
384 3300038443 Ga0395901_0070253 Ga0395901_0070253_1600_2316 193
385 3300038443 Ga0395901_0110468 Ga0395901_0110468_1260_1976 193
386 3300038443 Ga0395901_0128414 Ga0395901_0128414_273_962 193
387 3300038443 Ga0395901_0190719 Ga0395901_0190719_1278_2009 193
388 3300044693 Ga0466961_0164936 Ga0466961_0164936_28_765 193
389 3300044694 Ga0466963_0131298 Ga0466963_0131298_509_1252 193
390 3300044694 Ga0466963_0215962 Ga0466963_0215962_302_1036 193
391 3300044706 Ga0466964_0016475 Ga0466964_0016475_1123_1860 193
392 3300044765 Ga0466970_0009442 Ga0466970_0009442_3423_4160 193
393 3300044842 Ga0466957_0012152 Ga0466957_0012152_364_1101 193
394 3300045049 Ga0466959_0036243 Ga0466959_0036243_1952_2689 193
395 3300045836 Ga0466958_0016344 Ga0466958_0016344_2375_3112 193
396 3300045836 Ga0466958_0034867 Ga0466958_0034867_2162_2899 193
397 3300045836 Ga0466958_0048167 Ga0466958_0048167_1399_2133 193
398 3300045976 Ga0466967_0019275 Ga0466967_0019275_825_1568 193
399 3300048903 Ga0496100_0191006 Ga0496100_0191006_440_1141 193
400 3300048905 Ga0496102_0022374 Ga0496102_0022374_3796_4497 193
401 3300048906 Ga0496103_0031204 Ga0496103_0031204_1338_2039 193
402 3300048909 Ga0496106_0269354 Ga0496106_0269354_291_992 193
403 3300048910 Ga0496107_0042345 Ga0496107_0042345_1286_1987 193
404 3300048912 Ga0496109_0023599 Ga0496109_0023599_3486_4187 193
405 3300048913 Ga0496110_0324488 Ga0496110_0324488_579_1280 193
406 3300048914 Ga0496111_0039667 Ga0496111_0039667_950_1651 193
407 3300048915 Ga0496112_0000950 Ga0496112_0000950_9722_10420 193
408 3300048915 Ga0496112_0056604 Ga0496112_0056604_2939_3640 193
409 3300048916 Ga0496113_0000977 Ga0496113_0000977_13231_13929 193
410 3300048916 Ga0496113_0114074 Ga0496113_0114074_1181_1882 193
411 3300050493 nmdc:mga0k408_267144_c1 nmdc:mga0k408_267144_c1_50_766 193

Structural Annotation

Top 5 Hits

ID Description Score Start End
2avp-assembly1.cif.gz_A crystal structure of an 8 repeat consensus tpr superhelix 0.8767 112 175
4u0z-assembly7.cif.gz_D eukaryotic fic domain containing protein with bound apcpp 0.8494 108 181
5jj6-assembly3.cif.gz_B fic-1 (aa134 - 508) from c. elegans 0.8487 126 183
4u04-assembly1.cif.gz_B structure of a eukaryotic fic domain containing protein 0.8483 108 182
5jj7-assembly1.cif.gz_B fic-1 (aa134 - 508 e274g) from c. elegans 0.8405 128 183
ID Description Score Start End Superfamily
af_O06917_4_76_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9093 109 171 1.25.40.10
af_Q86TZ1_263_346_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9071 93 173 1.25.40.10
af_O15050_4_90_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.893 109 175 1.25.40.10
af_A4I5Y0_716_784_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8865 116 174 1.25.40.10
4gywC01 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8856 96 174 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A2W5I2R0-F1-model_v4 deleted 0.9264 91 175
AF-A0A3M0YE04-F1-model_v4 Tetratricopeptide repeat protein 0.904 86 174
AF-A0A257JAC0-F1-model_v4 Uncharacterized protein 0.8916 88 173
AF-A0A254QD01-F1-model_v4 Uncharacterized protein 0.871 90 177
AF-A0A2W5I2R0-F1-model_v4 deleted 0.8692 91 175

Feature Viewer

pLDDT pTM Quality
86.99 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map