F437357

General Info

Members Datasets Scaffolds Average Seq Length
410 187 820 342

Family's Representative Sequence

Representative Sequence 3300047321|Ga0495676_0106156|Ga0495676_0106156_262_1428
Length 388
Sequence VKRRLGLTGWADRLGAGGRRAGRWVGRARVIARLDGVTDTRRPASFGSDNHAGAHDAVLAKISEVSSGPAGGYGDDDWTRQAEQQLARLFGAEGGVFFVFTGTAANVLGLSLLLRPFEAVICAESAHLNVDECGAPERVLGAKLLTVATPDGKLTPGLIEGRLGGRGDEHRAQPRVVAITQVTELGTCYSLDELRELSAFCRSQGLRLYLDGARLANAAVHLGCSLADLAANVDVFSFGGTKNGAVGAEAVVVMDPSITDVVPYLRKQQMQLASKMRFLAAQFLALLEDDLWSRSAQHANEMAGRLAAAVDGLPGVDVRYPVQSNAVFAALDPVHIKALQADWNFSVWDPDTNVVRWMTAFNTTEGDVDAFAAAIKAVTAGQPYDPAK

Samples

Sample ID Description Type Environment
1 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
96 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
97 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
98 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
99 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
100 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
101 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
102 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
105 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
106 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
107 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
108 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
109 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
110 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
111 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
112 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
123 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
182 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
183 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
186 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
187 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.27
Metatranscriptomes 0
Isolates 0.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.15
Rhizosphere 94.39
Stem 0
Stem Tuber 0
Unclassified 0.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495676_0106156 3300047321 Bacteria 2070
2 Ga0070658_10099413 3300005327 Bacteria 2404
3 Ga0070676_10097599 3300005328 Bacteria 1810
4 Ga0070690_100017340 3300005330 Bacteria 4328
5 Ga0070666_10013547 3300005335 Bacteria 5176
6 Ga0070682_100041344 3300005337 Bacteria 2841
7 Ga0070675_100207132 3300005354 Bacteria 1704
8 Ga0070659_100218999 3300005366 Bacteria 1570
9 Ga0070667_100218617 3300005367 Bacteria 1695
10 Ga0070709_10031170 3300005434 Bacteria 3206
11 Ga0070709_10102501 3300005434 Bacteria 1909
12 Ga0070709_10227597 3300005434 Bacteria 1333
13 Ga0070714_100000410 3300005435 Bacteria 31536
14 Ga0070714_100001643 3300005435 Bacteria 16246
15 Ga0070714_100015004 3300005435 Bacteria 6227
16 Ga0070714_100019903 3300005435 Bacteria 5476
17 Ga0070714_100121433 3300005435 Bacteria 2325
18 Ga0070714_100283090 3300005435 Bacteria 1541
19 Ga0070713_100023765 3300005436 Bacteria 4763
20 Ga0070713_100051344 3300005436 Bacteria 3410
21 Ga0070713_100065573 3300005436 Bacteria 3051
22 Ga0070713_100093160 3300005436 Unclassified 2595
23 Ga0070713_100205604 3300005436 Bacteria 1780
24 Ga0070710_10001840 3300005437 Bacteria 9998
25 Ga0070710_10014904 3300005437 Bacteria 3921
26 Ga0070710_10023942 3300005437 Bacteria 3215
27 Ga0070710_10038884 3300005437 Bacteria 2615
28 Ga0070710_10095951 3300005437 Bacteria 1757
29 Ga0070710_10127509 3300005437 Bacteria 1548
30 Ga0070701_10032685 3300005438 Bacteria 2593
31 Ga0070711_100013044 3300005439 Bacteria 5211
32 Ga0070711_100027635 3300005439 Bacteria 3726
33 Ga0070711_100122073 3300005439 Bacteria 1929
34 Ga0070711_100280786 3300005439 Bacteria 1317
35 Ga0070705_100078703 3300005440 Bacteria 2017
36 Ga0070705_100181678 3300005440 Bacteria 1425
37 Ga0070708_100002750 3300005445 Bacteria 13650
38 Ga0070708_100008942 3300005445 Bacteria 8067
39 Ga0070708_100070194 3300005445 Bacteria 3151
40 Ga0070663_100019985 3300005455 Bacteria 4424
41 Ga0070681_10201851 3300005458 Bacteria 1906
42 Ga0070706_100000620 3300005467 Bacteria 40956
43 Ga0070706_100002912 3300005467 Bacteria 17037
44 Ga0070706_100006505 3300005467 Bacteria 11029
45 Ga0070706_100046439 3300005467 Bacteria 4009
46 Ga0070706_100127518 3300005467 Bacteria 2373
47 Ga0070706_100264713 3300005467 Bacteria 1605
48 Ga0070707_100003742 3300005468 Bacteria 14356
49 Ga0070707_100011154 3300005468 Bacteria 8375
50 Ga0070707_100012669 3300005468 Bacteria 7876
51 Ga0070707_100012889 3300005468 Bacteria 7809
52 Ga0070707_100019236 3300005468 Bacteria 6432
53 Ga0070707_100034412 3300005468 Bacteria 4832
54 Ga0070707_100034729 3300005468 Bacteria 4811
55 Ga0070707_100255464 3300005468 Bacteria 1705
56 Ga0070698_100000251 3300005471 Bacteria 53834
57 Ga0070698_100001735 3300005471 Bacteria 24317
58 Ga0070698_100002564 3300005471 Bacteria 19997
59 Ga0070698_100038132 3300005471 Bacteria 4952
60 Ga0070698_100061078 3300005471 Bacteria 3802
61 Ga0070698_100198332 3300005471 Bacteria 1943
62 Ga0070699_100007421 3300005518 Bacteria 9544
63 Ga0070699_100114644 3300005518 Bacteria 2368
64 Ga0070697_100200877 3300005536 Bacteria 1695
65 Ga0068853_100249744 3300005539 Bacteria 1627
66 Ga0070695_100091090 3300005545 Bacteria 2036
67 Ga0070693_100149110 3300005547 Bacteria 1479
68 Ga0070704_100076594 3300005549 Bacteria 2447
69 Ga0070664_100024438 3300005564 Bacteria 4997
70 Ga0068854_100212562 3300005578 Bacteria 1526
71 Ga0068856_100227566 3300005614 Bacteria 1880
72 Ga0070702_100155752 3300005615 Bacteria 1471
73 Ga0068851_10075947 3300005834 Bacteria 1747
74 Ga0068863_100204649 3300005841 Bacteria 1899
75 Ga0068858_100186662 3300005842 Bacteria 1958
76 Ga0068860_100249720 3300005843 Bacteria 1727
77 Ga0068862_100142034 3300005844 Bacteria 2132
78 Ga0081540_1000388 3300005983 Bacteria 44164
79 Ga0070717_10014423 3300006028 Bacteria 6080
80 Ga0070717_10048699 3300006028 Bacteria 3477
81 Ga0070717_10054974 3300006028 Bacteria 3284
82 Ga0070717_10060932 3300006028 Bacteria 3126
83 Ga0070717_10118725 3300006028 Bacteria 2263
84 Ga0070717_10131858 3300006028 Bacteria 2150
85 Ga0070717_10231404 3300006028 Bacteria 1627
86 Ga0070715_10012614 3300006163 Bacteria 3082
87 Ga0070715_10016151 3300006163 Bacteria 2799
88 Ga0070715_10029030 3300006163 Bacteria 2225
89 Ga0070716_100004459 3300006173 Bacteria 6693
90 Ga0070716_100009675 3300006173 Bacteria 4809
91 Ga0070712_100008012 3300006175 Bacteria 6626
92 Ga0070712_100034611 3300006175 Bacteria 3424
93 Ga0070712_100047021 3300006175 Bacteria 2985
94 Ga0070712_100060729 3300006175 Bacteria 2667
95 Ga0070712_100070699 3300006175 Bacteria 2495
96 Ga0070712_100103639 3300006175 Bacteria 2110
97 Ga0070712_100186330 3300006175 Bacteria 1620
98 Ga0068871_100093759 3300006358 Bacteria 2505
99 Ga0075433_10106078 3300006852 Bacteria 2490
100 Ga0075434_100076505 3300006871 Bacteria 3342
101 Ga0075435_100012924 3300007076 Bacteria 6193
102 Ga0105240_10239077 3300009093 Bacteria 2106
103 Ga0105248_10235223 3300009177 Unclassified 2062
104 Ga0105238_10242115 3300009551 Bacteria 1781
105 Ga0105249_10396375 3300009553 Bacteria 1410
106 Ga0105246_10121903 3300011119 Bacteria 1933
107 Ga0157373_10020012 3300013100 Bacteria 4869
108 Ga0157370_10087707 3300013104 Bacteria 2923
109 Ga0157369_10329470 3300013105 Bacteria 1587
110 Ga0157374_10304193 3300013296 Bacteria 1578
111 Ga0157378_10073053 3300013297 Bacteria 3083
112 Ga0163162_10406950 3300013306 Bacteria 1493
113 Ga0157375_10023904 3300013308 Bacteria 5645
114 Ga0163163_10190387 3300014325 Bacteria 2100
115 Ga0157379_10097848 3300014968 Bacteria 2634
116 Ga0157379_10102234 3300014968 Bacteria 2572
117 Ga0157376_10386929 3300014969 Bacteria 1349
118 Ga0213875_10058275 3300021388 Bacteria 1808
119 Ga0207692_10005462 3300025898 Bacteria 5093
120 Ga0207692_10007425 3300025898 Bacteria 4494
121 Ga0207692_10037511 3300025898 Bacteria 2371
122 Ga0207692_10087644 3300025898 Bacteria 1680
123 Ga0207692_10096231 3300025898 Bacteria 1616
124 Ga0207688_10005537 3300025901 Bacteria 6867
125 Ga0207680_10027251 3300025903 Bacteria 3179
126 Ga0207685_10003118 3300025905 Bacteria 3963
127 Ga0207685_10014355 3300025905 Bacteria 2478
128 Ga0207699_10008422 3300025906 Bacteria 5090
129 Ga0207699_10012039 3300025906 Bacteria 4390
130 Ga0207699_10017295 3300025906 Bacteria 3791
131 Ga0207699_10101554 3300025906 Bacteria 1826
132 Ga0207643_10132643 3300025908 Bacteria 1483
133 Ga0207684_10000797 3300025910 Bacteria 36435
134 Ga0207684_10009785 3300025910 Bacteria 8457
135 Ga0207684_10025277 3300025910 Bacteria 5061
136 Ga0207684_10043901 3300025910 Bacteria 3790
137 Ga0207684_10262789 3300025910 Bacteria 1489
138 Ga0207695_10213643 3300025913 Bacteria 1839
139 Ga0207693_10000923 3300025915 Bacteria 26413
140 Ga0207693_10004900 3300025915 Bacteria 11251
141 Ga0207693_10013080 3300025915 Bacteria 6695
142 Ga0207693_10027816 3300025915 Bacteria 4469
143 Ga0207693_10037217 3300025915 Bacteria 3835
144 Ga0207693_10066661 3300025915 Bacteria 2818
145 Ga0207693_10105819 3300025915 Bacteria 2206
146 Ga0207693_10192703 3300025915 Bacteria 1604
147 Ga0207663_10010856 3300025916 Bacteria 4864
148 Ga0207663_10015000 3300025916 Bacteria 4262
149 Ga0207663_10033520 3300025916 Bacteria 3060
150 Ga0207663_10060273 3300025916 Bacteria 2404
151 Ga0207663_10266282 3300025916 Bacteria 1268
152 Ga0207663_10281086 3300025916 Bacteria 1236
153 Ga0207660_10153466 3300025917 Bacteria 1771
154 Ga0207662_10011958 3300025918 Bacteria 4828
155 Ga0207657_10002883 3300025919 Bacteria 18471
156 Ga0207646_10013331 3300025922 Bacteria 7863
157 Ga0207646_10022258 3300025922 Bacteria 5843
158 Ga0207646_10064219 3300025922 Bacteria 3276
159 Ga0207646_10074981 3300025922 Bacteria 3022
160 Ga0207646_10093233 3300025922 Bacteria 2696
161 Ga0207646_10117646 3300025922 Bacteria 2387
162 Ga0207646_10130049 3300025922 Bacteria 2266
163 Ga0207646_10192562 3300025922 Bacteria 1842
164 Ga0207646_10209598 3300025922 Bacteria 1760
165 Ga0207700_10005678 3300025928 Bacteria 7488
166 Ga0207700_10008493 3300025928 Bacteria 6368
167 Ga0207700_10009268 3300025928 Bacteria 6140
168 Ga0207700_10012015 3300025928 Bacteria 5558
169 Ga0207700_10020345 3300025928 Bacteria 4505
170 Ga0207700_10030936 3300025928 Bacteria 3797
171 Ga0207700_10110169 3300025928 Bacteria 2214
172 Ga0207700_10134340 3300025928 Bacteria 2024
173 Ga0207700_10167540 3300025928 Bacteria 1830
174 Ga0207700_10173734 3300025928 Bacteria 1799
175 Ga0207700_10386800 3300025928 Bacteria 1224
176 Ga0207664_10000125 3300025929 Bacteria 66876
177 Ga0207664_10000442 3300025929 Bacteria 29595
178 Ga0207664_10001377 3300025929 Bacteria 15958
179 Ga0207664_10010871 3300025929 Bacteria 6446
180 Ga0207664_10057427 3300025929 Bacteria 3093
181 Ga0207664_10107341 3300025929 Bacteria 2316
182 Ga0207664_10172066 3300025929 Bacteria 1854
183 Ga0207706_10023435 3300025933 Bacteria 5543
184 Ga0207709_10061912 3300025935 Bacteria 2340
185 Ga0207665_10005039 3300025939 Bacteria 8817
186 Ga0207665_10006553 3300025939 Bacteria 7719
187 Ga0207665_10007047 3300025939 Bacteria 7443
188 Ga0207665_10011898 3300025939 Bacteria 5715
189 Ga0207665_10034460 3300025939 Bacteria 3359
190 Ga0207665_10086522 3300025939 Bacteria 2165
191 Ga0207691_10044210 3300025940 Bacteria 4101
192 Ga0207711_10134782 3300025941 Bacteria 2217
193 Ga0207689_10012474 3300025942 Bacteria 7260
194 Ga0207661_10055722 3300025944 Bacteria 3172
195 Ga0207658_10028964 3300025986 Bacteria 3905
196 Ga0207677_10165134 3300026023 Bacteria 1725
197 Ga0207677_10185639 3300026023 Bacteria 1640
198 Ga0207678_10000729 3300026067 Bacteria 30064
199 Ga0207702_10161125 3300026078 Bacteria 2049
200 Ga0207674_10006451 3300026116 Bacteria 13794
201 Ga0207675_100059192 3300026118 Bacteria 3575
202 Ga0207683_10316663 3300026121 Bacteria 1429
203 Ga0268265_10409612 3300028380 Bacteria 1256
204 Ga0265338_10004507 3300028800 Bacteria 18779
205 Ga0316576_10048415 3300031727 Bacteria 3083
206 Ga0316576_10055261 3300031727 Bacteria 2897
207 Ga0373950_0011123 3300034818 Bacteria 1466
208 Ga0373938_0020564 3300034957 Bacteria 1331
209 Ga0373926_0001159 3300035083 Bacteria 7837
210 Ga0373926_0027882 3300035083 Bacteria 1980
211 Ga0373934_0016452 3300035086 Bacteria 2812
212 Ga0373944_0000183 3300035089 Bacteria 13029
213 Ga0373944_0002162 3300035089 Bacteria 5000
214 Ga0373951_0017633 3300035091 Bacteria 1617
215 Ga0373923_0003253 3300035111 Bacteria 5176
216 Ga0373923_0024929 3300035111 Bacteria 2365
217 Ga0373923_0074906 3300035111 Bacteria 1460
218 Ga0373936_0001786 3300035113 Bacteria 7910
219 Ga0373936_0005587 3300035113 Bacteria 4743
220 Ga0373936_0037024 3300035113 Bacteria 1947
221 Ga0373936_0046460 3300035113 Bacteria 1751
222 Ga0373939_0005147 3300035114 Bacteria 3109
223 Ga0373945_0000218 3300035116 Bacteria 15714
224 Ga0373945_0004612 3300035116 Bacteria 4387
225 Ga0373953_0013224 3300035117 Bacteria 2943
226 Ga0373956_0062604 3300035119 Bacteria 1686
227 Ga0373943_0005233 3300035170 Bacteria 5837
228 Ga0373943_0046995 3300035170 Bacteria 2108
229 Ga0373946_0000082 3300035171 Bacteria 25981
230 Ga0373946_0003809 3300035171 Bacteria 5351
231 Ga0373955_0062925 3300035172 Bacteria 2053
232 Ga0373942_0009774 3300035207 Bacteria 2248
233 Ga0373924_0003227 3300035410 Bacteria 5581
234 Ga0373924_0049388 3300035410 Bacteria 1740
235 Ga0373931_0005582 3300035691 Bacteria 5833
236 Ga0373935_0001323 3300035692 Bacteria 13722
237 Ga0373935_0078829 3300035692 Bacteria 2137
238 Ga0373927_0001404 3300035695 Bacteria 18156
239 Ga0373927_0063716 3300035695 Bacteria 2384
240 Ga0373933_0009029 3300035724 Bacteria 5439
241 Ga0373933_0042288 3300035724 Bacteria 2693
242 Ga0373947_0002121 3300035725 Bacteria 12087
243 Ga0373937_0013085 3300036401 Bacteria 7307
244 Ga0373937_0104782 3300036401 Bacteria 2627
245 Ga0373937_0116631 3300036401 Bacteria 2486
246 Ga0373937_0125143 3300036401 Bacteria 2397
247 Ga0373937_0208268 3300036401 Bacteria 1839
248 Ga0373937_0212734 3300036401 Bacteria 1819
249 Ga0373937_0416834 3300036401 Bacteria 1274
250 Ga0373925_0026767 3300037068 Bacteria 4221
251 Ga0373925_0045153 3300037068 Bacteria 3273
252 Ga0436364_0050731 3300037853 Bacteria 10028
253 Ga0436364_0544586 3300037853 Bacteria 1701
254 Ga0436363_1212844 3300039450 Bacteria 3883
255 Ga0451577_0000034 3300042876 Bacteria 376183
256 Ga0451577_0005646 3300042876 Bacteria 12713
257 Ga0451577_0009371 3300042876 Bacteria 9439
258 Ga0451577_0045881 3300042876 Bacteria 3911
259 Ga0453683_0000023 3300044673 Bacteria 264522
260 Ga0453683_0000057 3300044673 Bacteria 190239
261 Ga0453683_0005972 3300044673 Bacteria 8394
262 Ga0453683_0264874 3300044673 Bacteria 1096
263 Ga0466963_0070801 3300044694 Bacteria 2346
264 Ga0453684_0000098 3300044712 Bacteria 376183
265 Ga0453684_0000467 3300044712 Bacteria 161003
266 Ga0453684_0000603 3300044712 Bacteria 132340
267 Ga0453684_0001278 3300044712 Bacteria 75250
268 Ga0453684_0004462 3300044712 Bacteria 29480
269 Ga0453684_0053220 3300044712 Bacteria 5286
270 Ga0453684_0337307 3300044712 Bacteria 1703
271 Ga0451576_0000036 3300045051 Bacteria 376183
272 Ga0451576_0000397 3300045051 Bacteria 101182
273 Ga0451576_0184473 3300045051 Bacteria 2178
274 Ga0495592_0003471 3300046454 Bacteria 11312
275 Ga0495603_0168617 3300046455 Bacteria 1268
276 Ga0495629_0015089 3300046459 Bacteria 5553
277 Ga0495651_0000686 3300046462 Bacteria 26379
278 Ga0495651_0002811 3300046462 Bacteria 13493
279 Ga0495651_0033599 3300046462 Bacteria 4001
280 Ga0495651_0047698 3300046462 Bacteria 3310
281 Ga0495653_0010004 3300046463 Bacteria 7758
282 Ga0495653_0042105 3300046463 Bacteria 3559
283 Ga0495580_0067926 3300046472 Bacteria 2493
284 Ga0495582_0007308 3300046473 Bacteria 6120
285 Ga0495662_0001467 3300046476 Bacteria 11672
286 Ga0495662_0028547 3300046476 Bacteria 2693
287 Ga0495664_0007296 3300046477 Bacteria 6132
288 Ga0495664_0028009 3300046477 Bacteria 3288
289 Ga0495594_0051948 3300046499 Bacteria 2256
290 Ga0495608_0003707 3300046511 Bacteria 10979
291 Ga0495608_0004123 3300046511 Bacteria 10420
292 Ga0495608_0042435 3300046511 Bacteria 3042
293 Ga0495608_0068029 3300046511 Bacteria 2329
294 Ga0495618_0015728 3300046514 Bacteria 4617
295 Ga0495618_0029732 3300046514 Bacteria 3409
296 Ga0495628_0044290 3300046516 Bacteria 3541
297 Ga0495628_0045605 3300046516 Bacteria 3484
298 Ga0495628_0104512 3300046516 Bacteria 2182
299 Ga0495630_0158085 3300046517 Bacteria 1725
300 Ga0495630_0207450 3300046517 Bacteria 1495
301 Ga0495630_0245979 3300046517 Bacteria 1366
302 Ga0495652_0002763 3300046529 Bacteria 17736
303 Ga0495652_0015426 3300046529 Bacteria 6842
304 Ga0495652_0113881 3300046529 Bacteria 2170
305 Ga0495665_0033080 3300046531 Bacteria 2765
306 Ga0495665_0099047 3300046531 Bacteria 1530
307 Ga0495665_0099868 3300046531 Bacteria 1523
308 Ga0495640_0029489 3300046533 Bacteria 3939
309 Ga0495640_0039381 3300046533 Bacteria 3317
310 Ga0495586_0086972 3300046535 Bacteria 1723
311 Ga0495587_0001849 3300046536 Bacteria 14090
312 Ga0495587_0002778 3300046536 Bacteria 11689
313 Ga0495587_0033742 3300046536 Bacteria 3087
314 Ga0495587_0052722 3300046536 Bacteria 2399
315 Ga0495587_0068988 3300046536 Bacteria 2059
316 Ga0495645_0044456 3300046543 Bacteria 3239
317 Ga0495645_0088459 3300046543 Bacteria 2215
318 Ga0495645_0206920 3300046543 Bacteria 1327
319 Ga0495667_0000303 3300046559 Bacteria 31334
320 Ga0495667_0006656 3300046559 Bacteria 7843
321 Ga0495634_0046548 3300046642 Bacteria 2926
322 Ga0495634_0098297 3300046642 Bacteria 1894
323 Ga0495634_0128916 3300046642 Bacteria 1614
324 Ga0495635_0001296 3300046663 Bacteria 16708
325 Ga0495635_0011916 3300046663 Bacteria 6093
326 Ga0495635_0013718 3300046663 Bacteria 5670
327 Ga0495635_0029400 3300046663 Bacteria 3821
328 Ga0495635_0039974 3300046663 Bacteria 3242
329 Ga0495635_0056052 3300046663 Bacteria 2714
330 Ga0495635_0140817 3300046663 Bacteria 1643
331 Ga0495588_0078539 3300046674 Bacteria 1722
332 Ga0495657_0001247 3300046675 Bacteria 22205
333 Ga0495657_0056090 3300046675 Bacteria 2625
334 Ga0495657_0062232 3300046675 Bacteria 2466
335 Ga0495599_0001196 3300046678 Bacteria 14716
336 Ga0495599_0023716 3300046678 Bacteria 3836
337 Ga0495599_0045582 3300046678 Bacteria 2750
338 Ga0495599_0082796 3300046678 Bacteria 2004
339 Ga0495623_0029620 3300046679 Bacteria 3522
340 Ga0495623_0111093 3300046679 Bacteria 1661
341 Ga0495646_0015378 3300046680 Bacteria 4858
342 Ga0495646_0118755 3300046680 Bacteria 1498
343 Ga0495658_0025611 3300046683 Bacteria 3154
344 Ga0495613_0017805 3300046689 Bacteria 5294
345 Ga0495624_0005582 3300046690 Bacteria 9046
346 Ga0495624_0017470 3300046690 Bacteria 4817
347 Ga0495600_0009497 3300046809 Bacteria 6012
348 Ga0495600_0042706 3300046809 Bacteria 2956
349 Ga0495600_0049212 3300046809 Bacteria 2750
350 Ga0495581_0095684 3300047315 Bacteria 1724
351 Ga0495604_0026113 3300047317 Bacteria 4649
352 Ga0495604_0103065 3300047317 Bacteria 2094
353 Ga0495604_0171344 3300047317 Bacteria 1526
354 Ga0495674_0001865 3300047319 Bacteria 20782
355 Ga0495674_0003668 3300047319 Bacteria 14934
356 Ga0495674_0055904 3300047319 Bacteria 3459
357 Ga0495674_0193180 3300047319 Bacteria 1691
358 Ga0495674_0212800 3300047319 Bacteria 1600
359 Ga0495676_0069163 3300047321 Bacteria 2725
360 Ga0495676_0075286 3300047321 Bacteria 2582
361 Ga0495680_0003613 3300047322 Bacteria 15131
362 Ga0495680_0013690 3300047322 Bacteria 7062
363 Ga0495680_0090281 3300047322 Bacteria 2298
364 Ga0495680_0093524 3300047322 Bacteria 2250
365 Ga0495675_0013644 3300047444 Bacteria 5133
366 Ga0495675_0025518 3300047444 Bacteria 3767
367 Ga0495675_0105508 3300047444 Bacteria 1761
368 Ga0495684_0001175 3300047471 Bacteria 21106
369 Ga0495684_0004135 3300047471 Bacteria 11335
370 Ga0495684_0080168 3300047471 Bacteria 2478
371 Ga0495684_0161244 3300047471 Bacteria 1672
372 Ga0495593_0005653 3300047673 Bacteria 7380
373 Ga0495593_0142909 3300047673 Bacteria 1212
374 Ga0495602_0017732 3300048088 Bacteria 7130
375 Ga0495602_0018538 3300048088 Bacteria 6947
376 Ga0495602_0077883 3300048088 Bacteria 2802
377 Ga0495602_0131397 3300048088 Bacteria 1996
378 Ga0495614_0048528 3300048089 Bacteria 1820
379 Ga0496100_0059938 3300048903 Bacteria 2503
380 Ga0496101_0023834 3300048904 Bacteria 4231
381 Ga0496103_0314231 3300048906 Bacteria 1008
382 Ga0496104_0059550 3300048907 Bacteria 3615
383 Ga0496104_0074670 3300048907 Bacteria 3227
384 Ga0496104_0249844 3300048907 Unclassified 1686
385 Ga0496105_0111967 3300048908 Bacteria 2252
386 Ga0496105_0119489 3300048908 Bacteria 2174
387 Ga0496105_0130882 3300048908 Bacteria 2068
388 Ga0496106_0086504 3300048909 Bacteria 2414
389 Ga0496106_0202352 3300048909 Bacteria 1580
390 Ga0496109_0042820 3300048912 Bacteria 4103
391 Ga0496110_0375154 3300048913 Bacteria 1296
392 Ga0496112_0193187 3300048915 Bacteria 1996
393 Ga0496112_0371460 3300048915 Unclassified 1372
394 Ga0496113_0016796 3300048916 Bacteria 5063
395 Ga0496114_0118964 3300048917 Bacteria 2270
396 nmdc:mga0n895_56088_c1 3300050512 Bacteria 3880
397 nmdc:mga08x19_184304_c1 3300050514 Bacteria 1426
398 nmdc:mga08x19_223196_c1 3300050514 Bacteria 1295
399 Ga0495601_0047175 3300053077 Bacteria 2712
400 Ga0495601_0081876 3300053077 Bacteria 2072
401 Ga0495612_0007692 3300053078 Bacteria 4400
402 Ga0495612_0033979 3300053078 Bacteria 2064
403 Ga0495595_0031423 3300053084 Bacteria 2386
404 Ga0495595_0033581 3300053084 Bacteria 2316
405 Ga0495619_0047427 3300053085 Bacteria 2828
406 Ga0495619_0083178 3300053085 Bacteria 2158
407 Ga0495619_0141764 3300053085 Bacteria 1655
408 2873315818 2873314349 Bacteria 8512634
409 8055068286 8055066027 Bacteria 9479577
410 8055178611 8055172936 Bacteria 9305943
411 Ga0495676_0106156
412 Ga0070658_10099413
413 Ga0070676_10097599
414 Ga0070690_100017340
415 Ga0070666_10013547
416 Ga0070682_100041344
417 Ga0070675_100207132
418 Ga0070659_100218999
419 Ga0070667_100218617
420 Ga0070709_10031170
421 Ga0070709_10102501
422 Ga0070709_10227597
423 Ga0070714_100000410
424 Ga0070714_100001643
425 Ga0070714_100015004
426 Ga0070714_100019903
427 Ga0070714_100121433
428 Ga0070714_100283090
429 Ga0070713_100023765
430 Ga0070713_100051344
431 Ga0070713_100065573
432 Ga0070713_100093160
433 Ga0070713_100205604
434 Ga0070710_10001840
435 Ga0070710_10014904
436 Ga0070710_10023942
437 Ga0070710_10038884
438 Ga0070710_10095951
439 Ga0070710_10127509
440 Ga0070701_10032685
441 Ga0070711_100013044
442 Ga0070711_100027635
443 Ga0070711_100122073
444 Ga0070711_100280786
445 Ga0070705_100078703
446 Ga0070705_100181678
447 Ga0070708_100002750
448 Ga0070708_100008942
449 Ga0070708_100070194
450 Ga0070663_100019985
451 Ga0070681_10201851
452 Ga0070706_100000620
453 Ga0070706_100002912
454 Ga0070706_100006505
455 Ga0070706_100046439
456 Ga0070706_100127518
457 Ga0070706_100264713
458 Ga0070707_100003742
459 Ga0070707_100011154
460 Ga0070707_100012669
461 Ga0070707_100012889
462 Ga0070707_100019236
463 Ga0070707_100034412
464 Ga0070707_100034729
465 Ga0070707_100255464
466 Ga0070698_100000251
467 Ga0070698_100001735
468 Ga0070698_100002564
469 Ga0070698_100038132
470 Ga0070698_100061078
471 Ga0070698_100198332
472 Ga0070699_100007421
473 Ga0070699_100114644
474 Ga0070697_100200877
475 Ga0068853_100249744
476 Ga0070695_100091090
477 Ga0070693_100149110
478 Ga0070704_100076594
479 Ga0070664_100024438
480 Ga0068854_100212562
481 Ga0068856_100227566
482 Ga0070702_100155752
483 Ga0068851_10075947
484 Ga0068863_100204649
485 Ga0068858_100186662
486 Ga0068860_100249720
487 Ga0068862_100142034
488 Ga0081540_1000388
489 Ga0070717_10014423
490 Ga0070717_10048699
491 Ga0070717_10054974
492 Ga0070717_10060932
493 Ga0070717_10118725
494 Ga0070717_10131858
495 Ga0070717_10231404
496 Ga0070715_10012614
497 Ga0070715_10016151
498 Ga0070715_10029030
499 Ga0070716_100004459
500 Ga0070716_100009675
501 Ga0070712_100008012
502 Ga0070712_100034611
503 Ga0070712_100047021
504 Ga0070712_100060729
505 Ga0070712_100070699
506 Ga0070712_100103639
507 Ga0070712_100186330
508 Ga0068871_100093759
509 Ga0075433_10106078
510 Ga0075434_100076505
511 Ga0075435_100012924
512 Ga0105240_10239077
513 Ga0105248_10235223
514 Ga0105238_10242115
515 Ga0105249_10396375
516 Ga0105246_10121903
517 Ga0157373_10020012
518 Ga0157370_10087707
519 Ga0157369_10329470
520 Ga0157374_10304193
521 Ga0157378_10073053
522 Ga0163162_10406950
523 Ga0157375_10023904
524 Ga0163163_10190387
525 Ga0157379_10097848
526 Ga0157379_10102234
527 Ga0157376_10386929
528 Ga0213875_10058275
529 Ga0207692_10005462
530 Ga0207692_10007425
531 Ga0207692_10037511
532 Ga0207692_10087644
533 Ga0207692_10096231
534 Ga0207688_10005537
535 Ga0207680_10027251
536 Ga0207685_10003118
537 Ga0207685_10014355
538 Ga0207699_10008422
539 Ga0207699_10012039
540 Ga0207699_10017295
541 Ga0207699_10101554
542 Ga0207643_10132643
543 Ga0207684_10000797
544 Ga0207684_10009785
545 Ga0207684_10025277
546 Ga0207684_10043901
547 Ga0207684_10262789
548 Ga0207695_10213643
549 Ga0207693_10000923
550 Ga0207693_10004900
551 Ga0207693_10013080
552 Ga0207693_10027816
553 Ga0207693_10037217
554 Ga0207693_10066661
555 Ga0207693_10105819
556 Ga0207693_10192703
557 Ga0207663_10010856
558 Ga0207663_10015000
559 Ga0207663_10033520
560 Ga0207663_10060273
561 Ga0207663_10266282
562 Ga0207663_10281086
563 Ga0207660_10153466
564 Ga0207662_10011958
565 Ga0207657_10002883
566 Ga0207646_10013331
567 Ga0207646_10022258
568 Ga0207646_10064219
569 Ga0207646_10074981
570 Ga0207646_10093233
571 Ga0207646_10117646
572 Ga0207646_10130049
573 Ga0207646_10192562
574 Ga0207646_10209598
575 Ga0207700_10005678
576 Ga0207700_10008493
577 Ga0207700_10009268
578 Ga0207700_10012015
579 Ga0207700_10020345
580 Ga0207700_10030936
581 Ga0207700_10110169
582 Ga0207700_10134340
583 Ga0207700_10167540
584 Ga0207700_10173734
585 Ga0207700_10386800
586 Ga0207664_10000125
587 Ga0207664_10000442
588 Ga0207664_10001377
589 Ga0207664_10010871
590 Ga0207664_10057427
591 Ga0207664_10107341
592 Ga0207664_10172066
593 Ga0207706_10023435
594 Ga0207709_10061912
595 Ga0207665_10005039
596 Ga0207665_10006553
597 Ga0207665_10007047
598 Ga0207665_10011898
599 Ga0207665_10034460
600 Ga0207665_10086522
601 Ga0207691_10044210
602 Ga0207711_10134782
603 Ga0207689_10012474
604 Ga0207661_10055722
605 Ga0207658_10028964
606 Ga0207677_10165134
607 Ga0207677_10185639
608 Ga0207678_10000729
609 Ga0207702_10161125
610 Ga0207674_10006451
611 Ga0207675_100059192
612 Ga0207683_10316663
613 Ga0268265_10409612
614 Ga0265338_10004507
615 Ga0316576_10048415
616 Ga0316576_10055261
617 Ga0373950_0011123
618 Ga0373938_0020564
619 Ga0373926_0001159
620 Ga0373926_0027882
621 Ga0373934_0016452
622 Ga0373944_0000183
623 Ga0373944_0002162
624 Ga0373951_0017633
625 Ga0373923_0003253
626 Ga0373923_0024929
627 Ga0373923_0074906
628 Ga0373936_0001786
629 Ga0373936_0005587
630 Ga0373936_0037024
631 Ga0373936_0046460
632 Ga0373939_0005147
633 Ga0373945_0000218
634 Ga0373945_0004612
635 Ga0373953_0013224
636 Ga0373956_0062604
637 Ga0373943_0005233
638 Ga0373943_0046995
639 Ga0373946_0000082
640 Ga0373946_0003809
641 Ga0373955_0062925
642 Ga0373942_0009774
643 Ga0373924_0003227
644 Ga0373924_0049388
645 Ga0373931_0005582
646 Ga0373935_0001323
647 Ga0373935_0078829
648 Ga0373927_0001404
649 Ga0373927_0063716
650 Ga0373933_0009029
651 Ga0373933_0042288
652 Ga0373947_0002121
653 Ga0373937_0013085
654 Ga0373937_0104782
655 Ga0373937_0116631
656 Ga0373937_0125143
657 Ga0373937_0208268
658 Ga0373937_0212734
659 Ga0373937_0416834
660 Ga0373925_0026767
661 Ga0373925_0045153
662 Ga0436364_0050731
663 Ga0436364_0544586
664 Ga0436363_1212844
665 Ga0451577_0000034
666 Ga0451577_0005646
667 Ga0451577_0009371
668 Ga0451577_0045881
669 Ga0453683_0000023
670 Ga0453683_0000057
671 Ga0453683_0005972
672 Ga0453683_0264874
673 Ga0466963_0070801
674 Ga0453684_0000098
675 Ga0453684_0000467
676 Ga0453684_0000603
677 Ga0453684_0001278
678 Ga0453684_0004462
679 Ga0453684_0053220
680 Ga0453684_0337307
681 Ga0451576_0000036
682 Ga0451576_0000397
683 Ga0451576_0184473
684 Ga0495592_0003471
685 Ga0495603_0168617
686 Ga0495629_0015089
687 Ga0495651_0000686
688 Ga0495651_0002811
689 Ga0495651_0033599
690 Ga0495651_0047698
691 Ga0495653_0010004
692 Ga0495653_0042105
693 Ga0495580_0067926
694 Ga0495582_0007308
695 Ga0495662_0001467
696 Ga0495662_0028547
697 Ga0495664_0007296
698 Ga0495664_0028009
699 Ga0495594_0051948
700 Ga0495608_0003707
701 Ga0495608_0004123
702 Ga0495608_0042435
703 Ga0495608_0068029
704 Ga0495618_0015728
705 Ga0495618_0029732
706 Ga0495628_0044290
707 Ga0495628_0045605
708 Ga0495628_0104512
709 Ga0495630_0158085
710 Ga0495630_0207450
711 Ga0495630_0245979
712 Ga0495652_0002763
713 Ga0495652_0015426
714 Ga0495652_0113881
715 Ga0495665_0033080
716 Ga0495665_0099047
717 Ga0495665_0099868
718 Ga0495640_0029489
719 Ga0495640_0039381
720 Ga0495586_0086972
721 Ga0495587_0001849
722 Ga0495587_0002778
723 Ga0495587_0033742
724 Ga0495587_0052722
725 Ga0495587_0068988
726 Ga0495645_0044456
727 Ga0495645_0088459
728 Ga0495645_0206920
729 Ga0495667_0000303
730 Ga0495667_0006656
731 Ga0495634_0046548
732 Ga0495634_0098297
733 Ga0495634_0128916
734 Ga0495635_0001296
735 Ga0495635_0011916
736 Ga0495635_0013718
737 Ga0495635_0029400
738 Ga0495635_0039974
739 Ga0495635_0056052
740 Ga0495635_0140817
741 Ga0495588_0078539
742 Ga0495657_0001247
743 Ga0495657_0056090
744 Ga0495657_0062232
745 Ga0495599_0001196
746 Ga0495599_0023716
747 Ga0495599_0045582
748 Ga0495599_0082796
749 Ga0495623_0029620
750 Ga0495623_0111093
751 Ga0495646_0015378
752 Ga0495646_0118755
753 Ga0495658_0025611
754 Ga0495613_0017805
755 Ga0495624_0005582
756 Ga0495624_0017470
757 Ga0495600_0009497
758 Ga0495600_0042706
759 Ga0495600_0049212
760 Ga0495581_0095684
761 Ga0495604_0026113
762 Ga0495604_0103065
763 Ga0495604_0171344
764 Ga0495674_0001865
765 Ga0495674_0003668
766 Ga0495674_0055904
767 Ga0495674_0193180
768 Ga0495674_0212800
769 Ga0495676_0069163
770 Ga0495676_0075286
771 Ga0495680_0003613
772 Ga0495680_0013690
773 Ga0495680_0090281
774 Ga0495680_0093524
775 Ga0495675_0013644
776 Ga0495675_0025518
777 Ga0495675_0105508
778 Ga0495684_0001175
779 Ga0495684_0004135
780 Ga0495684_0080168
781 Ga0495684_0161244
782 Ga0495593_0005653
783 Ga0495593_0142909
784 Ga0495602_0017732
785 Ga0495602_0018538
786 Ga0495602_0077883
787 Ga0495602_0131397
788 Ga0495614_0048528
789 Ga0496100_0059938
790 Ga0496101_0023834
791 Ga0496103_0314231
792 Ga0496104_0059550
793 Ga0496104_0074670
794 Ga0496104_0249844
795 Ga0496105_0111967
796 Ga0496105_0119489
797 Ga0496105_0130882
798 Ga0496106_0086504
799 Ga0496106_0202352
800 Ga0496109_0042820
801 Ga0496110_0375154
802 Ga0496112_0193187
803 Ga0496112_0371460
804 Ga0496113_0016796
805 Ga0496114_0118964
806 nmdc:mga0n895_56088_c1
807 nmdc:mga08x19_184304_c1
808 nmdc:mga08x19_223196_c1
809 Ga0495601_0047175
810 Ga0495601_0081876
811 Ga0495612_0007692
812 Ga0495612_0033979
813 Ga0495595_0031423
814 Ga0495595_0033581
815 Ga0495619_0047427
816 Ga0495619_0083178
817 Ga0495619_0141764
818 2873315818
819 8055068286
820 8055178611

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01212

Beta_elim_lyase

Beta-eliminating lyase

45

332

0.95

PF00155

Aminotran_1_2

Aminotransferase class I and II

45

360

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yvr-assembly1.cif.gz_D crystal structure of l-threonine aldolase from neptunomonas marina 0.977 25 356
1v72-assembly1.cif.gz_A crystal structure of phenylserine aldolase from pseudomonas putida 0.9737 25 357
7w0i-assembly1.cif.gz_C crystal structure of threonine aldolase from mycobacterium vanbaalenii 0.9691 25 355
5vye-assembly1.cif.gz_A crystal structure of l-threonine aldolase from pseudomonas putida 0.9673 24 360
7w0i-assembly1.cif.gz_C crystal structure of threonine aldolase from mycobacterium vanbaalenii 0.9578 25 355
ID Description Score Start End Superfamily
5vyeD02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9694 35 268 3.40.640.10
1v72A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9683 35 269 3.40.640.10
af_A4HRH1_20_264_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9533 28 268 3.40.640.10
5vyeD02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9457 35 268 3.40.640.10
1v72A01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9455 270 357 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A2M7G2M7-F1-model_v4 Threonine aldolase 0.9902 23 357 GO:0006520
GO:0016829
AF-A0A7C8LY00-F1-model_v4 Low specificity L-threonine aldolase (EC 4.1.2.48) 0.9885 25 359 GO:0006520
GO:0016829
AF-A0A385SMI0-F1-model_v4 Low specificity L-threonine aldolase 0.9885 23 356 GO:0006520
GO:0016829
AF-A0A524M6N5-F1-model_v4 Low specificity L-threonine aldolase 0.9874 25 360 GO:0006520
GO:0016829
AF-E6SR04-F1-model_v4 L-threonine aldolase (EC 4.1.2.5) 0.987 24 356 GO:0004793
GO:0006520

Map