F437174

General Info

Members Datasets Scaffolds Average Seq Length
410 223 820 214

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100300308|Ga0070711_1003003082
Length 221
Sequence MANFGEISEVKQWGMAIGGSVLVCAALFFTYFKTQRTANETAQSALTAKMEENAKLEPYRTKLTDIDRQIANLKQQLEIERRIVPDEKEVDGFIKMLDAEAVKAGIELRRFTSKPTSNKEFYTEVPFEIELDGSYYSMINFFDQVSKLERIVTVSDLLVANTKKGSEAKAKHTYQYAPNESVVATCTATTFFSHDNASVAPAKAVGAVPAAPTAVKGRTSL

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300009828 Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E Metatranscriptome Rhizosphere
86 3300009829 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D Metatranscriptome Rhizosphere
87 3300009835 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B Metatranscriptome Rhizosphere
88 3300009850 Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C Metatranscriptome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
104 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
150 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
159 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
160 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
161 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
162 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
163 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
164 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
165 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
166 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
167 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
168 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
170 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
171 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
181 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
185 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
193 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
194 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
199 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
200 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
219 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
222 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.07
Metatranscriptomes 2.93
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.83
Rhizosphere 92.68
Stem 0
Stem Tuber 0
Unclassified 27.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_100300308 3300005439 Unclassified 1277
2 Ga0065712_10076870 3300005290 Unclassified 3588
3 Ga0065715_10095641 3300005293 Unclassified 4038
4 Ga0070658_10282496 3300005327 Bacteria 1413
5 Ga0070676_10008637 3300005328 Bacteria 5494
6 Ga0070683_100011641 3300005329 Bacteria 7615
7 Ga0070690_100006498 3300005330 Bacteria 6628
8 Ga0070677_10037841 3300005333 Bacteria 1884
9 Ga0070666_10557796 3300005335 Bacteria 833
10 Ga0070680_100181027 3300005336 Unclassified 1775
11 Ga0070682_100042686 3300005337 Bacteria 2801
12 Ga0068868_100002539 3300005338 Bacteria 12678
13 Ga0068868_100097296 3300005338 Bacteria 2378
14 Ga0070660_100003728 3300005339 Bacteria 10528
15 Ga0070689_100109074 3300005340 Bacteria 2200
16 Ga0070661_100042955 3300005344 Bacteria 3301
17 Ga0070692_10089662 3300005345 Bacteria 1669
18 Ga0070668_100021190 3300005347 Bacteria 4913
19 Ga0070669_100005493 3300005353 Bacteria 9151
20 Ga0070675_100139029 3300005354 Bacteria 2075
21 Ga0070671_100548295 3300005355 Bacteria 997
22 Ga0070674_100066075 3300005356 Unclassified 2540
23 Ga0070688_100038326 3300005365 Bacteria 2926
24 Ga0070659_100041239 3300005366 Unclassified 3607
25 Ga0070667_100080467 3300005367 Bacteria 2786
26 Ga0070709_10007607 3300005434 Bacteria 5947
27 Ga0070709_10018338 3300005434 Bacteria 4028
28 Ga0070709_10106960 3300005434 Bacteria 1874
29 Ga0070714_100009741 3300005435 Bacteria 7570
30 Ga0070714_100048520 3300005435 Unclassified 3611
31 Ga0070714_100278219 3300005435 Bacteria 1554
32 Ga0070714_100763484 3300005435 Unclassified 935
33 Ga0070714_100902392 3300005435 Bacteria 858
34 Ga0070713_100007486 3300005436 Bacteria 7667
35 Ga0070713_100019637 3300005436 Bacteria 5166
36 Ga0070713_100248266 3300005436 Bacteria 1622
37 Ga0070710_10003956 3300005437 Bacteria 7023
38 Ga0070711_100169304 3300005439 Bacteria 1664
39 Ga0070711_100376327 3300005439 Bacteria 1147
40 Ga0070711_100445682 3300005439 Unclassified 1059
41 Ga0070694_100039367 3300005444 Unclassified 3147
42 Ga0070708_100035395 3300005445 Bacteria 4350
43 Ga0070708_100094795 3300005445 Unclassified 2724
44 Ga0070708_100798045 3300005445 Bacteria 887
45 Ga0070663_100014122 3300005455 Bacteria 5119
46 Ga0070678_100019063 3300005456 Bacteria 4462
47 Ga0070662_100005170 3300005457 Bacteria 8324
48 Ga0070681_10036134 3300005458 Bacteria 4962
49 Ga0070681_10310460 3300005458 Bacteria 1486
50 Ga0070706_100001148 3300005467 Bacteria 28547
51 Ga0070706_100001446 3300005467 Bacteria 24984
52 Ga0070706_100009078 3300005467 Bacteria 9257
53 Ga0070706_100140097 3300005467 Bacteria 2258
54 Ga0070706_100156030 3300005467 Unclassified 2131
55 Ga0070706_100228493 3300005467 Unclassified 1737
56 Ga0070706_100877601 3300005467 Unclassified 829
57 Ga0070707_100001991 3300005468 Bacteria 19549
58 Ga0070707_100065141 3300005468 Unclassified 3500
59 Ga0070707_100264030 3300005468 Unclassified 1674
60 Ga0070707_100693123 3300005468 Bacteria 981
61 Ga0070698_100000015 3300005471 Bacteria 111813
62 Ga0070698_100258936 3300005471 Bacteria 1672
63 Ga0070699_100007379 3300005518 Bacteria 9575
64 Ga0070699_100044527 3300005518 Unclassified 3841
65 Ga0070699_101092823 3300005518 Unclassified 731
66 Ga0070679_100355100 3300005530 Bacteria 1413
67 Ga0070684_100025934 3300005535 Unclassified 4931
68 Ga0070697_100001537 3300005536 Bacteria 17579
69 Ga0070697_100016694 3300005536 Bacteria 5775
70 Ga0070697_100082079 3300005536 Bacteria 2656
71 Ga0070672_100282262 3300005543 Bacteria 1404
72 Ga0070686_100002339 3300005544 Bacteria 10452
73 Ga0070695_100020971 3300005545 Unclassified 3994
74 Ga0070695_100329336 3300005545 Bacteria 1138
75 Ga0070696_100191412 3300005546 Bacteria 1523
76 Ga0070693_100183854 3300005547 Bacteria 1347
77 Ga0070665_100008386 3300005548 Bacteria 10453
78 Ga0070704_100085295 3300005549 Bacteria 2337
79 Ga0068855_100306466 3300005563 Unclassified 1758
80 Ga0068855_100502629 3300005563 Bacteria 1317
81 Ga0068855_100734649 3300005563 Bacteria 1054
82 Ga0068855_100991834 3300005563 Unclassified 883
83 Ga0068857_100027196 3300005577 Bacteria 5045
84 Ga0068854_100002270 3300005578 Bacteria 11831
85 Ga0068854_100100926 3300005578 Unclassified 2163
86 Ga0068856_100017713 3300005614 Bacteria 6908
87 Ga0068856_100088934 3300005614 Bacteria 3071
88 Ga0068856_100127025 3300005614 Unclassified 2553
89 Ga0068856_100280959 3300005614 Bacteria 1681
90 Ga0068856_100664829 3300005614 Unclassified 1062
91 Ga0068852_100014407 3300005616 Bacteria 6087
92 Ga0068852_100221884 3300005616 Bacteria 1798
93 Ga0068859_100014566 3300005617 Bacteria 7898
94 Ga0068864_100046988 3300005618 Bacteria 3705
95 Ga0068866_10141718 3300005718 Bacteria 1380
96 Ga0068861_100022372 3300005719 Bacteria 4553
97 Ga0068851_10011184 3300005834 Unclassified 4203
98 Ga0068870_10036844 3300005840 Bacteria 2518
99 Ga0068863_100098246 3300005841 Bacteria 2780
100 Ga0068863_100632171 3300005841 Bacteria 1061
101 Ga0068858_100067361 3300005842 Bacteria 3316
102 Ga0068858_100657644 3300005842 Bacteria 1018
103 Ga0068860_100073577 3300005843 Bacteria 3248
104 Ga0068860_100208088 3300005843 Bacteria 1897
105 Ga0068862_100010726 3300005844 Bacteria 7566
106 Ga0081540_1016960 3300005983 Bacteria 4530
107 Ga0081540_1071733 3300005983 Unclassified 1599
108 Ga0070717_10004986 3300006028 Bacteria 9658
109 Ga0070717_10005917 3300006028 Bacteria 8956
110 Ga0070717_10261692 3300006028 Bacteria 1531
111 Ga0070717_10298550 3300006028 Unclassified 1432
112 Ga0070717_10648720 3300006028 Unclassified 958
113 Ga0070717_10980255 3300006028 Unclassified 770
114 Ga0070715_10019700 3300006163 Bacteria 2592
115 Ga0070715_10034337 3300006163 Bacteria 2079
116 Ga0070716_100006713 3300006173 Bacteria 5635
117 Ga0070716_100034848 3300006173 Bacteria 2763
118 Ga0070716_100335925 3300006173 Unclassified 1064
119 Ga0070716_100409931 3300006173 Unclassified 977
120 Ga0070712_100022005 3300006175 Bacteria 4194
121 Ga0070712_100053652 3300006175 Bacteria 2816
122 Ga0070712_100063663 3300006175 Bacteria 2612
123 Ga0070712_100097310 3300006175 Unclassified 2169
124 Ga0070712_100236628 3300006175 Bacteria 1453
125 Ga0097621_100007837 3300006237 Bacteria 7660
126 Ga0097621_100041517 3300006237 Unclassified 3703
127 Ga0097621_100168314 3300006237 Unclassified 1887
128 Ga0097621_100297915 3300006237 Bacteria 1424
129 Ga0068871_100020965 3300006358 Bacteria 5014
130 Ga0068871_100037248 3300006358 Unclassified 3878
131 Ga0068871_100296121 3300006358 Bacteria 1419
132 Ga0075434_100575745 3300006871 Unclassified 1145
133 Ga0075434_100592405 3300006871 Bacteria 1128
134 Ga0075436_100017580 3300006914 Bacteria 4894
135 Ga0075436_100280015 3300006914 Bacteria 1192
136 Ga0097620_100014566 3300006931 Bacteria 7898
137 Ga0075435_100191954 3300007076 Unclassified 1729
138 Ga0075435_100283096 3300007076 Bacteria 1416
139 Ga0105240_10017076 3300009093 Bacteria 9799
140 Ga0105240_10161903 3300009093 Bacteria 2657
141 Ga0105240_10202162 3300009093 Bacteria 2327
142 Ga0105240_10359426 3300009093 Bacteria 1650
143 Ga0105245_10440712 3300009098 Bacteria 1309
144 Ga0105245_10795735 3300009098 Bacteria 983
145 Ga0105247_10033417 3300009101 Bacteria 3129
146 Ga0105247_10044759 3300009101 Bacteria 2715
147 Ga0105247_10064724 3300009101 Bacteria 2273
148 Ga0105243_10012734 3300009148 Bacteria 6354
149 Ga0105241_10002840 3300009174 Bacteria 12944
150 Ga0105241_10004860 3300009174 Bacteria 9910
151 Ga0105241_10009342 3300009174 Bacteria 7208
152 Ga0105241_10133050 3300009174 Unclassified 2016
153 Ga0105242_10599360 3300009176 Bacteria 1064
154 Ga0105248_10041644 3300009177 Bacteria 5150
155 Ga0105248_10264438 3300009177 Bacteria 1936
156 Ga0105237_10012960 3300009545 Bacteria 8756
157 Ga0105237_10155444 3300009545 Bacteria 2284
158 Ga0105237_10176298 3300009545 Bacteria 2138
159 Ga0105237_10246728 3300009545 Bacteria 1787
160 Ga0105237_10431078 3300009545 Bacteria 1324
161 Ga0105238_10021255 3300009551 Bacteria 6613
162 Ga0105238_10041499 3300009551 Bacteria 4659
163 Ga0105238_10052075 3300009551 Unclassified 4116
164 Ga0105238_10440606 3300009551 Bacteria 1299
165 Ga0105249_10012860 3300009553 Bacteria 7385
166 Ga0130087_1014930 3300009828 Unclassified 844
167 Ga0130086_1103981 3300009829 Unclassified 844
168 Ga0130084_1034144 3300009835 Unclassified 844
169 Ga0130085_1050948 3300009850 Unclassified 844
170 Ga0105239_10317040 3300010375 Bacteria 1758
171 Ga0105246_10009778 3300011119 Bacteria 5911
172 Ga0105246_10171131 3300011119 Bacteria 1664
173 Ga0157373_10014265 3300013100 Bacteria 5829
174 Ga0157373_10030954 3300013100 Bacteria 3850
175 Ga0157373_10119765 3300013100 Unclassified 1850
176 Ga0157371_10007879 3300013102 Bacteria 8552
177 Ga0157370_10062820 3300013104 Unclassified 3521
178 Ga0157369_10024382 3300013105 Bacteria 6729
179 Ga0157369_10041998 3300013105 Bacteria 4990
180 Ga0157369_10089896 3300013105 Bacteria 3279
181 Ga0157369_10143742 3300013105 Bacteria 2523
182 Ga0157369_10260168 3300013105 Bacteria 1810
183 Ga0157374_10022531 3300013296 Bacteria 5620
184 Ga0157374_10063189 3300013296 Unclassified 3472
185 Ga0157374_10226495 3300013296 Bacteria 1836
186 Ga0157378_10050227 3300013297 Bacteria 3711
187 Ga0157378_10218690 3300013297 Bacteria 1810
188 Ga0157378_10253948 3300013297 Bacteria 1684
189 Ga0157378_10259355 3300013297 Bacteria 1667
190 Ga0163162_10015248 3300013306 Bacteria 7507
191 Ga0163162_10079099 3300013306 Bacteria 3354
192 Ga0157372_10006999 3300013307 Bacteria 12014
193 Ga0157372_10013882 3300013307 Bacteria 8605
194 Ga0157372_10030036 3300013307 Bacteria 5943
195 Ga0157372_10202495 3300013307 Bacteria 2300
196 Ga0157372_10222990 3300013307 Bacteria 2185
197 Ga0157372_10225346 3300013307 Unclassified 2173
198 Ga0157372_10269670 3300013307 Bacteria 1977
199 Ga0157375_10776573 3300013308 Bacteria 1108
200 Ga0163163_10029912 3300014325 Bacteria 5242
201 Ga0157379_10006839 3300014968 Bacteria 9857
202 Ga0157379_10014321 3300014968 Bacteria 6958
203 Ga0157379_10064918 3300014968 Unclassified 3262
204 Ga0157379_10106380 3300014968 Bacteria 2518
205 Ga0157376_10038321 3300014969 Bacteria 3899
206 Ga0157376_10060638 3300014969 Bacteria 3178
207 Ga0224571_100348 3300022734 Unclassified 2449
208 Ga0228598_1000035 3300024227 Bacteria 18835
209 Ga0228598_1006961 3300024227 Bacteria 2322
210 Ga0228598_1007005 3300024227 Bacteria 2314
211 Ga0207692_10011288 3300025898 Bacteria 3796
212 Ga0207680_10182695 3300025903 Bacteria 1419
213 Ga0207699_10006210 3300025906 Bacteria 5765
214 Ga0207699_10044969 3300025906 Bacteria 2574
215 Ga0207699_10102149 3300025906 Bacteria 1821
216 Ga0207699_10117071 3300025906 Bacteria 1717
217 Ga0207699_10138255 3300025906 Bacteria 1598
218 Ga0207645_10011754 3300025907 Bacteria 5966
219 Ga0207684_10000309 3300025910 Bacteria 69239
220 Ga0207684_10002378 3300025910 Bacteria 19035
221 Ga0207684_10054960 3300025910 Unclassified 3378
222 Ga0207684_10177061 3300025910 Unclassified 1839
223 Ga0207684_10214004 3300025910 Unclassified 1662
224 Ga0207684_10565776 3300025910 Bacteria 972
225 Ga0207654_10006063 3300025911 Bacteria 6077
226 Ga0207654_10034101 3300025911 Bacteria 2826
227 Ga0207654_10061220 3300025911 Unclassified 2202
228 Ga0207707_10084096 3300025912 Unclassified 2779
229 Ga0207707_10298936 3300025912 Bacteria 1392
230 Ga0207695_10027331 3300025913 Bacteria 6355
231 Ga0207695_10033136 3300025913 Bacteria 5642
232 Ga0207695_10169911 3300025913 Bacteria 2106
233 Ga0207695_10200833 3300025913 Bacteria 1908
234 Ga0207695_10296010 3300025913 Unclassified 1510
235 Ga0207671_10027254 3300025914 Unclassified 4272
236 Ga0207671_10112493 3300025914 Bacteria 2073
237 Ga0207671_10151763 3300025914 Unclassified 1790
238 Ga0207671_10367436 3300025914 Bacteria 1142
239 Ga0207693_10102587 3300025915 Unclassified 2243
240 Ga0207693_10335698 3300025915 Bacteria 1183
241 Ga0207663_10017486 3300025916 Bacteria 3996
242 Ga0207663_10259364 3300025916 Unclassified 1283
243 Ga0207663_10371984 3300025916 Bacteria 1087
244 Ga0207663_10392117 3300025916 Unclassified 1060
245 Ga0207660_10099791 3300025917 Unclassified 2167
246 Ga0207657_10001558 3300025919 Bacteria 24604
247 Ga0207652_10728615 3300025921 Bacteria 883
248 Ga0207646_10001918 3300025922 Bacteria 25038
249 Ga0207646_10056499 3300025922 Unclassified 3508
250 Ga0207646_10063455 3300025922 Unclassified 3298
251 Ga0207646_10211586 3300025922 Unclassified 1751
252 Ga0207694_10050429 3300025924 Bacteria 3223
253 Ga0207694_10061655 3300025924 Unclassified 2919
254 Ga0207694_10937568 3300025924 Unclassified 732
255 Ga0207659_10109511 3300025926 Bacteria 2097
256 Ga0207687_10009973 3300025927 Bacteria 6216
257 Ga0207687_10380867 3300025927 Bacteria 1156
258 Ga0207700_10002606 3300025928 Bacteria 10380
259 Ga0207700_10004688 3300025928 Bacteria 8101
260 Ga0207700_10018807 3300025928 Bacteria 4653
261 Ga0207700_10252443 3300025928 Bacteria 1507
262 Ga0207700_10379846 3300025928 Unclassified 1235
263 Ga0207664_10008483 3300025929 Bacteria 7171
264 Ga0207664_10014619 3300025929 Bacteria 5677
265 Ga0207664_10062639 3300025929 Unclassified 2971
266 Ga0207664_10103264 3300025929 Bacteria 2359
267 Ga0207664_10222063 3300025929 Unclassified 1639
268 Ga0207706_10000098 3300025933 Bacteria 91173
269 Ga0207686_10071377 3300025934 Bacteria 2234
270 Ga0207709_10057341 3300025935 Bacteria 2415
271 Ga0207670_10084694 3300025936 Bacteria 2226
272 Ga0207669_10033935 3300025937 Bacteria 2886
273 Ga0207704_10290524 3300025938 Bacteria 1247
274 Ga0207665_10044298 3300025939 Unclassified 2978
275 Ga0207665_10083544 3300025939 Bacteria 2203
276 Ga0207665_10196420 3300025939 Bacteria 1468
277 Ga0207711_10003844 3300025941 Bacteria 12918
278 Ga0207711_10473048 3300025941 Bacteria 1167
279 Ga0207661_10100297 3300025944 Bacteria 2430
280 Ga0207679_10205986 3300025945 Bacteria 1646
281 Ga0207679_10374621 3300025945 Unclassified 1247
282 Ga0207667_10009482 3300025949 Bacteria 11462
283 Ga0207667_10170719 3300025949 Unclassified 2235
284 Ga0207667_10240973 3300025949 Unclassified 1851
285 Ga0207667_10418362 3300025949 Bacteria 1364
286 Ga0207667_10821488 3300025949 Unclassified 925
287 Ga0207712_10005954 3300025961 Bacteria 7693
288 Ga0207668_10011094 3300025972 Bacteria 5465
289 Ga0207640_10401449 3300025981 Unclassified 1116
290 Ga0207677_10137119 3300026023 Bacteria 1867
291 Ga0207703_10037806 3300026035 Bacteria 3847
292 Ga0207703_10613282 3300026035 Bacteria 1030
293 Ga0207703_10634616 3300026035 Bacteria 1012
294 Ga0207639_10932413 3300026041 Unclassified 812
295 Ga0207678_10003661 3300026067 Bacteria 13811
296 Ga0207702_10013042 3300026078 Bacteria 6912
297 Ga0207702_10050864 3300026078 Bacteria 3499
298 Ga0207702_10057664 3300026078 Bacteria 3302
299 Ga0207648_10010993 3300026089 Bacteria 8547
300 Ga0207676_10052994 3300026095 Bacteria 3174
301 Ga0207674_10012005 3300026116 Bacteria 9706
302 Ga0207675_100021243 3300026118 Bacteria 6046
303 Ga0207698_10035037 3300026142 Bacteria 3668
304 Ga0207698_10419580 3300026142 Viruses 1284
305 Ga0265356_1000404 3300028017 Bacteria 7830
306 Ga0265355_1002835 3300028036 Unclassified 1240
307 Ga0268264_10059601 3300028381 Unclassified 3198
308 Ga0265338_10003977 3300028800 Bacteria 20344
309 Ga0265762_1001273 3300030760 Bacteria 4587
310 Ga0265763_1011831 3300030763 Unclassified 825
311 Ga0265770_1011354 3300030878 Bacteria 1306
312 Ga0265765_1001501 3300030879 Bacteria 2152
313 Ga0265760_10006256 3300031090 Unclassified 3407
314 Ga0265760_10006744 3300031090 Bacteria 3286
315 Ga0265760_10015518 3300031090 Bacteria 2183
316 Ga0265760_10016638 3300031090 Bacteria 2110
317 Ga0265325_10152523 3300031241 Unclassified 1092
318 Ga0265339_10061662 3300031249 Bacteria 2017
319 Ga0265316_10302646 3300031344 Unclassified 1164
320 Ga0265342_10024739 3300031712 Unclassified 3786
321 Ga0316214_1001423 3300033545 Unclassified 2784
322 Ga0373958_0001039 3300034819 Unclassified 3630
323 Ga0373938_0007448 3300034957 Bacteria 1926
324 Ga0373940_0075502 3300035088 Bacteria 988
325 Ga0373951_0047494 3300035091 Bacteria 1049
326 Ga0373932_0010053 3300035112 Bacteria 2283
327 Ga0373936_0033278 3300035113 Bacteria 2043
328 Ga0373936_0041210 3300035113 Bacteria 1852
329 Ga0373939_0002140 3300035114 Bacteria 4699
330 Ga0373941_0048409 3300035115 Bacteria 1342
331 Ga0373954_0144579 3300035118 Bacteria 1161
332 Ga0373943_0045741 3300035170 Unclassified 2134
333 Ga0373961_0003032 3300035241 Unclassified 4232
334 Ga0373931_0079783 3300035691 Bacteria 1803
335 Ga0373933_0185168 3300035724 Unclassified 1329
336 Ga0373933_0220502 3300035724 Bacteria 1217
337 Ga0373947_0063004 3300035725 Unclassified 2258
338 Ga0373937_0029584 3300036401 Unclassified 4962
339 Ga0373937_0069971 3300036401 Unclassified 3236
340 Ga0373937_0095087 3300036401 Unclassified 2763
341 Ga0373937_0407540 3300036401 Unclassified 1290
342 Ga0373925_0071812 3300037068 Bacteria 2618
343 Ga0373925_0100029 3300037068 Unclassified 2228
344 Ga0373925_0164983 3300037068 Bacteria 1746
345 Ga0373925_0261723 3300037068 Unclassified 1390
346 Ga0436363_1444454 3300039450 Bacteria 908
347 Ga0436362_0189982 3300039453 Bacteria 962
348 Ga0453683_0574021 3300044673 Bacteria 735
349 Ga0466961_0040756 3300044693 Bacteria 2977
350 Ga0466963_0015810 3300044694 Unclassified 4683
351 Ga0466964_0083709 3300044706 Unclassified 1374
352 Ga0466971_0060176 3300044719 Bacteria 1717
353 Ga0466957_0108371 3300044842 Bacteria 1759
354 Ga0466959_0038640 3300045049 Unclassified 3527
355 Ga0451576_0239925 3300045051 Bacteria 1893
356 Ga0466958_0019493 3300045836 Bacteria 3949
357 Ga0466967_0020918 3300045976 Bacteria 5301
358 Ga0495651_0287548 3300046462 Unclassified 1108
359 Ga0495580_0000223 3300046472 Bacteria 44018
360 Ga0495580_0002450 3300046472 Bacteria 16226
361 Ga0495580_0014151 3300046472 Bacteria 6063
362 Ga0495580_0015343 3300046472 Bacteria 5780
363 Ga0495580_0091168 3300046472 Bacteria 2121
364 Ga0495580_0470451 3300046472 Unclassified 842
365 Ga0495580_0474460 3300046472 Bacteria 837
366 Ga0495584_0019588 3300046491 Bacteria 3437
367 Ga0495642_0267793 3300046528 Bacteria 748
368 Ga0495665_0040470 3300046531 Bacteria 2482
369 Ga0495587_0125320 3300046536 Unclassified 1470
370 Ga0495667_0258489 3300046559 Unclassified 1108
371 Ga0495659_0033042 3300046664 Bacteria 1814
372 Ga0495623_0164480 3300046679 Unclassified 1301
373 Ga0495669_0041373 3300046684 Unclassified 2046
374 Ga0495674_0139175 3300047319 Unclassified 2041
375 Ga0495675_0054203 3300047444 Unclassified 2545
376 Ga0495602_0483337 3300048088 Bacteria 868
377 Ga0496100_0080904 3300048903 Bacteria 2193
378 Ga0496100_0458469 3300048903 Bacteria 978
379 Ga0496100_0581488 3300048903 Bacteria 868
380 Ga0496101_0087354 3300048904 Bacteria 2314
381 Ga0496102_0058142 3300048905 Bacteria 3532
382 Ga0496102_0437045 3300048905 Bacteria 1228
383 Ga0496102_0604759 3300048905 Bacteria 1019
384 Ga0496103_0035601 3300048906 Unclassified 3048
385 Ga0496103_0054198 3300048906 Bacteria 2485
386 Ga0496104_0014341 3300048907 Bacteria 7158
387 Ga0496104_0102709 3300048907 Bacteria 2738
388 Ga0496105_0139702 3300048908 Bacteria 1994
389 Ga0496106_0011733 3300048909 Bacteria 6470
390 Ga0496106_0025688 3300048909 Bacteria 4385
391 Ga0496106_0036726 3300048909 Bacteria 3665
392 Ga0496107_0021069 3300048910 Bacteria 4606
393 Ga0496107_0031580 3300048910 Bacteria 3781
394 Ga0496107_0033199 3300048910 Bacteria 3692
395 Ga0496108_0184457 3300048911 Bacteria 1807
396 Ga0496108_0308283 3300048911 Bacteria 1379
397 Ga0496109_0021545 3300048912 Bacteria 5701
398 Ga0496109_0405439 3300048912 Bacteria 1288
399 Ga0496109_0843187 3300048912 Unclassified 854
400 Ga0496110_0384458 3300048913 Bacteria 1279
401 Ga0496112_0009894 3300048915 Bacteria 8621
402 Ga0496112_0075906 3300048915 Bacteria 3324
403 Ga0496113_0148737 3300048916 Bacteria 1846
404 Ga0496114_0031151 3300048917 Bacteria 4387
405 Ga0495682_0192944 3300049460 Bacteria 723
406 Ga0501067_0071730 3300049583 Unclassified 1918
407 Ga0501083_0099234 3300049744 Unclassified 1921
408 nmdc:mga0rr50_178298_c1 3300050513 Unclassified 1736
409 nmdc:mga08x19_200729_c1 3300050514 Unclassified 1367
410 Ga0495619_0072740 3300053085 Unclassified 2303
411 Ga0070711_100300308
412 Ga0065712_10076870
413 Ga0065715_10095641
414 Ga0070658_10282496
415 Ga0070676_10008637
416 Ga0070683_100011641
417 Ga0070690_100006498
418 Ga0070677_10037841
419 Ga0070666_10557796
420 Ga0070680_100181027
421 Ga0070682_100042686
422 Ga0068868_100002539
423 Ga0068868_100097296
424 Ga0070660_100003728
425 Ga0070689_100109074
426 Ga0070661_100042955
427 Ga0070692_10089662
428 Ga0070668_100021190
429 Ga0070669_100005493
430 Ga0070675_100139029
431 Ga0070671_100548295
432 Ga0070674_100066075
433 Ga0070688_100038326
434 Ga0070659_100041239
435 Ga0070667_100080467
436 Ga0070709_10007607
437 Ga0070709_10018338
438 Ga0070709_10106960
439 Ga0070714_100009741
440 Ga0070714_100048520
441 Ga0070714_100278219
442 Ga0070714_100763484
443 Ga0070714_100902392
444 Ga0070713_100007486
445 Ga0070713_100019637
446 Ga0070713_100248266
447 Ga0070710_10003956
448 Ga0070711_100169304
449 Ga0070711_100376327
450 Ga0070711_100445682
451 Ga0070694_100039367
452 Ga0070708_100035395
453 Ga0070708_100094795
454 Ga0070708_100798045
455 Ga0070663_100014122
456 Ga0070678_100019063
457 Ga0070662_100005170
458 Ga0070681_10036134
459 Ga0070681_10310460
460 Ga0070706_100001148
461 Ga0070706_100001446
462 Ga0070706_100009078
463 Ga0070706_100140097
464 Ga0070706_100156030
465 Ga0070706_100228493
466 Ga0070706_100877601
467 Ga0070707_100001991
468 Ga0070707_100065141
469 Ga0070707_100264030
470 Ga0070707_100693123
471 Ga0070698_100000015
472 Ga0070698_100258936
473 Ga0070699_100007379
474 Ga0070699_100044527
475 Ga0070699_101092823
476 Ga0070679_100355100
477 Ga0070684_100025934
478 Ga0070697_100001537
479 Ga0070697_100016694
480 Ga0070697_100082079
481 Ga0070672_100282262
482 Ga0070686_100002339
483 Ga0070695_100020971
484 Ga0070695_100329336
485 Ga0070696_100191412
486 Ga0070693_100183854
487 Ga0070665_100008386
488 Ga0070704_100085295
489 Ga0068855_100306466
490 Ga0068855_100502629
491 Ga0068855_100734649
492 Ga0068855_100991834
493 Ga0068857_100027196
494 Ga0068854_100002270
495 Ga0068854_100100926
496 Ga0068856_100017713
497 Ga0068856_100088934
498 Ga0068856_100127025
499 Ga0068856_100280959
500 Ga0068856_100664829
501 Ga0068852_100014407
502 Ga0068852_100221884
503 Ga0068859_100014566
504 Ga0068864_100046988
505 Ga0068866_10141718
506 Ga0068861_100022372
507 Ga0068851_10011184
508 Ga0068870_10036844
509 Ga0068863_100098246
510 Ga0068863_100632171
511 Ga0068858_100067361
512 Ga0068858_100657644
513 Ga0068860_100073577
514 Ga0068860_100208088
515 Ga0068862_100010726
516 Ga0081540_1016960
517 Ga0081540_1071733
518 Ga0070717_10004986
519 Ga0070717_10005917
520 Ga0070717_10261692
521 Ga0070717_10298550
522 Ga0070717_10648720
523 Ga0070717_10980255
524 Ga0070715_10019700
525 Ga0070715_10034337
526 Ga0070716_100006713
527 Ga0070716_100034848
528 Ga0070716_100335925
529 Ga0070716_100409931
530 Ga0070712_100022005
531 Ga0070712_100053652
532 Ga0070712_100063663
533 Ga0070712_100097310
534 Ga0070712_100236628
535 Ga0097621_100007837
536 Ga0097621_100041517
537 Ga0097621_100168314
538 Ga0097621_100297915
539 Ga0068871_100020965
540 Ga0068871_100037248
541 Ga0068871_100296121
542 Ga0075434_100575745
543 Ga0075434_100592405
544 Ga0075436_100017580
545 Ga0075436_100280015
546 Ga0097620_100014566
547 Ga0075435_100191954
548 Ga0075435_100283096
549 Ga0105240_10017076
550 Ga0105240_10161903
551 Ga0105240_10202162
552 Ga0105240_10359426
553 Ga0105245_10440712
554 Ga0105245_10795735
555 Ga0105247_10033417
556 Ga0105247_10044759
557 Ga0105247_10064724
558 Ga0105243_10012734
559 Ga0105241_10002840
560 Ga0105241_10004860
561 Ga0105241_10009342
562 Ga0105241_10133050
563 Ga0105242_10599360
564 Ga0105248_10041644
565 Ga0105248_10264438
566 Ga0105237_10012960
567 Ga0105237_10155444
568 Ga0105237_10176298
569 Ga0105237_10246728
570 Ga0105237_10431078
571 Ga0105238_10021255
572 Ga0105238_10041499
573 Ga0105238_10052075
574 Ga0105238_10440606
575 Ga0105249_10012860
576 Ga0130087_1014930
577 Ga0130086_1103981
578 Ga0130084_1034144
579 Ga0130085_1050948
580 Ga0105239_10317040
581 Ga0105246_10009778
582 Ga0105246_10171131
583 Ga0157373_10014265
584 Ga0157373_10030954
585 Ga0157373_10119765
586 Ga0157371_10007879
587 Ga0157370_10062820
588 Ga0157369_10024382
589 Ga0157369_10041998
590 Ga0157369_10089896
591 Ga0157369_10143742
592 Ga0157369_10260168
593 Ga0157374_10022531
594 Ga0157374_10063189
595 Ga0157374_10226495
596 Ga0157378_10050227
597 Ga0157378_10218690
598 Ga0157378_10253948
599 Ga0157378_10259355
600 Ga0163162_10015248
601 Ga0163162_10079099
602 Ga0157372_10006999
603 Ga0157372_10013882
604 Ga0157372_10030036
605 Ga0157372_10202495
606 Ga0157372_10222990
607 Ga0157372_10225346
608 Ga0157372_10269670
609 Ga0157375_10776573
610 Ga0163163_10029912
611 Ga0157379_10006839
612 Ga0157379_10014321
613 Ga0157379_10064918
614 Ga0157379_10106380
615 Ga0157376_10038321
616 Ga0157376_10060638
617 Ga0224571_100348
618 Ga0228598_1000035
619 Ga0228598_1006961
620 Ga0228598_1007005
621 Ga0207692_10011288
622 Ga0207680_10182695
623 Ga0207699_10006210
624 Ga0207699_10044969
625 Ga0207699_10102149
626 Ga0207699_10117071
627 Ga0207699_10138255
628 Ga0207645_10011754
629 Ga0207684_10000309
630 Ga0207684_10002378
631 Ga0207684_10054960
632 Ga0207684_10177061
633 Ga0207684_10214004
634 Ga0207684_10565776
635 Ga0207654_10006063
636 Ga0207654_10034101
637 Ga0207654_10061220
638 Ga0207707_10084096
639 Ga0207707_10298936
640 Ga0207695_10027331
641 Ga0207695_10033136
642 Ga0207695_10169911
643 Ga0207695_10200833
644 Ga0207695_10296010
645 Ga0207671_10027254
646 Ga0207671_10112493
647 Ga0207671_10151763
648 Ga0207671_10367436
649 Ga0207693_10102587
650 Ga0207693_10335698
651 Ga0207663_10017486
652 Ga0207663_10259364
653 Ga0207663_10371984
654 Ga0207663_10392117
655 Ga0207660_10099791
656 Ga0207657_10001558
657 Ga0207652_10728615
658 Ga0207646_10001918
659 Ga0207646_10056499
660 Ga0207646_10063455
661 Ga0207646_10211586
662 Ga0207694_10050429
663 Ga0207694_10061655
664 Ga0207694_10937568
665 Ga0207659_10109511
666 Ga0207687_10009973
667 Ga0207687_10380867
668 Ga0207700_10002606
669 Ga0207700_10004688
670 Ga0207700_10018807
671 Ga0207700_10252443
672 Ga0207700_10379846
673 Ga0207664_10008483
674 Ga0207664_10014619
675 Ga0207664_10062639
676 Ga0207664_10103264
677 Ga0207664_10222063
678 Ga0207706_10000098
679 Ga0207686_10071377
680 Ga0207709_10057341
681 Ga0207670_10084694
682 Ga0207669_10033935
683 Ga0207704_10290524
684 Ga0207665_10044298
685 Ga0207665_10083544
686 Ga0207665_10196420
687 Ga0207711_10003844
688 Ga0207711_10473048
689 Ga0207661_10100297
690 Ga0207679_10205986
691 Ga0207679_10374621
692 Ga0207667_10009482
693 Ga0207667_10170719
694 Ga0207667_10240973
695 Ga0207667_10418362
696 Ga0207667_10821488
697 Ga0207712_10005954
698 Ga0207668_10011094
699 Ga0207640_10401449
700 Ga0207677_10137119
701 Ga0207703_10037806
702 Ga0207703_10613282
703 Ga0207703_10634616
704 Ga0207639_10932413
705 Ga0207678_10003661
706 Ga0207702_10013042
707 Ga0207702_10050864
708 Ga0207702_10057664
709 Ga0207648_10010993
710 Ga0207676_10052994
711 Ga0207674_10012005
712 Ga0207675_100021243
713 Ga0207698_10035037
714 Ga0207698_10419580
715 Ga0265356_1000404
716 Ga0265355_1002835
717 Ga0268264_10059601
718 Ga0265338_10003977
719 Ga0265762_1001273
720 Ga0265763_1011831
721 Ga0265770_1011354
722 Ga0265765_1001501
723 Ga0265760_10006256
724 Ga0265760_10006744
725 Ga0265760_10015518
726 Ga0265760_10016638
727 Ga0265325_10152523
728 Ga0265339_10061662
729 Ga0265316_10302646
730 Ga0265342_10024739
731 Ga0316214_1001423
732 Ga0373958_0001039
733 Ga0373938_0007448
734 Ga0373940_0075502
735 Ga0373951_0047494
736 Ga0373932_0010053
737 Ga0373936_0033278
738 Ga0373936_0041210
739 Ga0373939_0002140
740 Ga0373941_0048409
741 Ga0373954_0144579
742 Ga0373943_0045741
743 Ga0373961_0003032
744 Ga0373931_0079783
745 Ga0373933_0185168
746 Ga0373933_0220502
747 Ga0373947_0063004
748 Ga0373937_0029584
749 Ga0373937_0069971
750 Ga0373937_0095087
751 Ga0373937_0407540
752 Ga0373925_0071812
753 Ga0373925_0100029
754 Ga0373925_0164983
755 Ga0373925_0261723
756 Ga0436363_1444454
757 Ga0436362_0189982
758 Ga0453683_0574021
759 Ga0466961_0040756
760 Ga0466963_0015810
761 Ga0466964_0083709
762 Ga0466971_0060176
763 Ga0466957_0108371
764 Ga0466959_0038640
765 Ga0451576_0239925
766 Ga0466958_0019493
767 Ga0466967_0020918
768 Ga0495651_0287548
769 Ga0495580_0000223
770 Ga0495580_0002450
771 Ga0495580_0014151
772 Ga0495580_0015343
773 Ga0495580_0091168
774 Ga0495580_0470451
775 Ga0495580_0474460
776 Ga0495584_0019588
777 Ga0495642_0267793
778 Ga0495665_0040470
779 Ga0495587_0125320
780 Ga0495667_0258489
781 Ga0495659_0033042
782 Ga0495623_0164480
783 Ga0495669_0041373
784 Ga0495674_0139175
785 Ga0495675_0054203
786 Ga0495602_0483337
787 Ga0496100_0080904
788 Ga0496100_0458469
789 Ga0496100_0581488
790 Ga0496101_0087354
791 Ga0496102_0058142
792 Ga0496102_0437045
793 Ga0496102_0604759
794 Ga0496103_0035601
795 Ga0496103_0054198
796 Ga0496104_0014341
797 Ga0496104_0102709
798 Ga0496105_0139702
799 Ga0496106_0011733
800 Ga0496106_0025688
801 Ga0496106_0036726
802 Ga0496107_0021069
803 Ga0496107_0031580
804 Ga0496107_0033199
805 Ga0496108_0184457
806 Ga0496108_0308283
807 Ga0496109_0021545
808 Ga0496109_0405439
809 Ga0496109_0843187
810 Ga0496110_0384458
811 Ga0496112_0009894
812 Ga0496112_0075906
813 Ga0496113_0148737
814 Ga0496114_0031151
815 Ga0495682_0192944
816 Ga0501067_0071730
817 Ga0501083_0099234
818 nmdc:mga0rr50_178298_c1
819 nmdc:mga08x19_200729_c1
820 Ga0495619_0072740

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04350

PilO

Pilus assembly protein, PilO

32

192

0.87

Map