F437171

General Info

Members Datasets Scaffolds Average Seq Length
410 220 820 199

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100041215|Ga0070713_1000412153
Length 225
Sequence MMKAIRGEDMKLRWKAAMAALMLISSLVLAQDTPPPQDATPVPANAASNKAPYEKPAAIASPTQAGAEYVIGPEDVLHVAVWKEADLTATLPVRPDGKISLPLLNDVQASGLTPQQLAASLTEKLKKYIADPRVTVVVTTINSKRIYLMGEVLHSGATPLSPNMTVLQALSSAGLNQFANTKGIYVLRTVNGKQQKLPVNYRKLVKGERIEQNYLLQPGDTIVVP

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
95 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
96 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
97 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
164 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
165 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
166 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
167 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
168 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
169 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
170 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
171 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
172 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
175 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
176 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
190 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
193 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.78
Metatranscriptomes 1.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.63
Rhizosphere 94.63
Stem 0
Stem Tuber 0
Unclassified 29.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100041215 3300005436 Unclassified 3760
2 JGI24752J21851_1000765 3300001976 Bacteria 4316
3 JGI24750J21931_1017900 3300002070 Unclassified 972
4 JGI24748J21848_1002768 3300002074 Bacteria 1995
5 JGI24033J26618_1004573 3300002155 Unclassified 1498
6 JGI24034J26672_10001012 3300002239 Bacteria 3670
7 JGI24751J29686_10002377 3300002459 Bacteria 3796
8 Ga0065712_10017784 3300005290 Bacteria 2096
9 Ga0070658_10161496 3300005327 Bacteria 1880
10 Ga0070676_10002865 3300005328 Bacteria 8911
11 Ga0070683_100215179 3300005329 Bacteria 1826
12 Ga0070683_100295690 3300005329 Unclassified 1540
13 Ga0070690_100003245 3300005330 Bacteria 8877
14 Ga0070670_100015937 3300005331 Bacteria 6449
15 Ga0068869_100199946 3300005334 Unclassified 1575
16 Ga0070666_10026365 3300005335 Bacteria 3796
17 Ga0070682_100064313 3300005337 Unclassified 2328
18 Ga0068868_100059750 3300005338 Bacteria 3016
19 Ga0068868_100076436 3300005338 Unclassified 2677
20 Ga0068868_100175481 3300005338 Unclassified 1776
21 Ga0070660_100205654 3300005339 Unclassified 1597
22 Ga0070689_100005917 3300005340 Bacteria 8412
23 Ga0070687_100099440 3300005343 Unclassified 1626
24 Ga0070661_100019848 3300005344 Bacteria 4791
25 Ga0070661_100079472 3300005344 Bacteria 2420
26 Ga0070669_100034197 3300005353 Bacteria 3680
27 Ga0070671_100136080 3300005355 Unclassified 2071
28 Ga0070674_100024498 3300005356 Bacteria 3917
29 Ga0070673_100001892 3300005364 Bacteria 12558
30 Ga0070673_100284554 3300005364 Bacteria 1451
31 Ga0070688_100000291 3300005365 Bacteria 25754
32 Ga0070667_100143964 3300005367 Bacteria 2089
33 Ga0070667_100368368 3300005367 Bacteria 1303
34 Ga0070709_10000469 3300005434 Bacteria 23952
35 Ga0070709_10002157 3300005434 Bacteria 10654
36 Ga0070709_10129477 3300005434 Bacteria 1721
37 Ga0070709_10203982 3300005434 Unclassified 1402
38 Ga0070714_100135432 3300005435 Unclassified 2205
39 Ga0070714_100170766 3300005435 Bacteria 1973
40 Ga0070713_100003137 3300005436 Bacteria 10878
41 Ga0070713_100005775 3300005436 Bacteria 8503
42 Ga0070713_100025799 3300005436 Unclassified 4602
43 Ga0070713_100063881 3300005436 Bacteria 3088
44 Ga0070713_100091331 3300005436 Unclassified 2619
45 Ga0070710_10000281 3300005437 Bacteria 24081
46 Ga0070710_10021483 3300005437 Bacteria 3365
47 Ga0070710_10115763 3300005437 Unclassified 1616
48 Ga0070710_10135923 3300005437 Unclassified 1503
49 Ga0070710_10209835 3300005437 Bacteria 1234
50 Ga0070710_10298193 3300005437 Bacteria 1051
51 Ga0070710_10394333 3300005437 Unclassified 926
52 Ga0070711_100009447 3300005439 Bacteria 6010
53 Ga0070711_100014150 3300005439 Bacteria 5021
54 Ga0070711_100029770 3300005439 Unclassified 3607
55 Ga0070711_100103514 3300005439 Unclassified 2075
56 Ga0070711_100168251 3300005439 Bacteria 1668
57 Ga0070711_100237022 3300005439 Unclassified 1425
58 Ga0070708_100007263 3300005445 Bacteria 8857
59 Ga0070708_100300469 3300005445 Unclassified 1512
60 Ga0070708_101072282 3300005445 Unclassified 755
61 Ga0070663_100022702 3300005455 Bacteria 4198
62 Ga0070663_100252187 3300005455 Bacteria 1397
63 Ga0070663_100294501 3300005455 Bacteria 1297
64 Ga0070678_100019373 3300005456 Bacteria 4433
65 Ga0070681_10004231 3300005458 Bacteria 13602
66 Ga0068867_100001551 3300005459 Bacteria 15964
67 Ga0070685_10003740 3300005466 Bacteria 7705
68 Ga0070706_100053348 3300005467 Bacteria 3731
69 Ga0070706_100056960 3300005467 Unclassified 3606
70 Ga0070706_100498322 3300005467 Bacteria 1133
71 Ga0070707_100029640 3300005468 Bacteria 5210
72 Ga0070707_100040309 3300005468 Bacteria 4468
73 Ga0070707_100078884 3300005468 Bacteria 3178
74 Ga0070707_100822794 3300005468 Unclassified 893
75 Ga0070699_100045068 3300005518 Unclassified 3817
76 Ga0070699_100569469 3300005518 Bacteria 1032
77 Ga0070679_100149854 3300005530 Bacteria 2310
78 Ga0070684_100003101 3300005535 Bacteria 12409
79 Ga0070697_100121462 3300005536 Unclassified 2185
80 Ga0070697_100238333 3300005536 Bacteria 1553
81 Ga0068853_100004183 3300005539 Bacteria 11128
82 Ga0068853_100015151 3300005539 Bacteria 6338
83 Ga0070672_100000501 3300005543 Bacteria 22813
84 Ga0070686_100038424 3300005544 Bacteria 2975
85 Ga0068855_100014203 3300005563 Bacteria 9593
86 Ga0068855_100073482 3300005563 Unclassified 3972
87 Ga0070664_100009974 3300005564 Bacteria 7698
88 Ga0070664_100043551 3300005564 Unclassified 3787
89 Ga0068857_100007891 3300005577 Bacteria 9180
90 Ga0068854_100002665 3300005578 Bacteria 11070
91 Ga0068856_100048241 3300005614 Unclassified 4196
92 Ga0068856_100231801 3300005614 Bacteria 1862
93 Ga0068856_100280719 3300005614 Unclassified 1682
94 Ga0068856_100429390 3300005614 Bacteria 1341
95 Ga0070702_100004343 3300005615 Bacteria 6466
96 Ga0068852_100012748 3300005616 Bacteria 6400
97 Ga0068866_10009670 3300005718 Bacteria 4104
98 Ga0068861_100076675 3300005719 Bacteria 2606
99 Ga0068851_10000317 3300005834 Bacteria 21816
100 Ga0068851_10003745 3300005834 Bacteria 6797
101 Ga0068863_100025741 3300005841 Bacteria 5612
102 Ga0068863_100098516 3300005841 Unclassified 2777
103 Ga0068862_100151670 3300005844 Bacteria 2063
104 Ga0070717_10000142 3300006028 Bacteria 53568
105 Ga0070717_10002532 3300006028 Bacteria 12872
106 Ga0070717_10019431 3300006028 Bacteria 5327
107 Ga0070717_10044263 3300006028 Bacteria 3634
108 Ga0070717_10073693 3300006028 Bacteria 2854
109 Ga0070717_10133258 3300006028 Unclassified 2138
110 Ga0070717_10160320 3300006028 Bacteria 1951
111 Ga0070717_10194238 3300006028 Bacteria 1775
112 Ga0070717_10624510 3300006028 Bacteria 978
113 Ga0070717_10699565 3300006028 Unclassified 921
114 Ga0070717_10924546 3300006028 Unclassified 794
115 Ga0070715_10005771 3300006163 Bacteria 4159
116 Ga0070716_100000043 3300006173 Bacteria 50574
117 Ga0070716_100000602 3300006173 Bacteria 15165
118 Ga0070716_100010868 3300006173 Bacteria 4578
119 Ga0070716_100047314 3300006173 Unclassified 2425
120 Ga0070716_100127414 3300006173 Bacteria 1604
121 Ga0070716_100344125 3300006173 Unclassified 1053
122 Ga0070716_100382833 3300006173 Bacteria 1006
123 Ga0070712_100000915 3300006175 Bacteria 17691
124 Ga0070712_100000974 3300006175 Bacteria 17236
125 Ga0070712_100002324 3300006175 Bacteria 11710
126 Ga0070712_100002359 3300006175 Bacteria 11629
127 Ga0070712_100216652 3300006175 Unclassified 1513
128 Ga0097621_100177941 3300006237 Bacteria 1837
129 Ga0068871_100114915 3300006358 Bacteria 2268
130 Ga0068871_100272873 3300006358 Bacteria 1478
131 Ga0068871_100576820 3300006358 Bacteria 1021
132 Ga0075434_100000963 3300006871 Bacteria 23184
133 Ga0075434_100003131 3300006871 Bacteria 14741
134 Ga0075434_100029410 3300006871 Bacteria 5406
135 Ga0075434_100794927 3300006871 Unclassified 962
136 Ga0075436_100001638 3300006914 Bacteria 15295
137 Ga0075436_100004870 3300006914 Bacteria 9225
138 Ga0075435_100000232 3300007076 Bacteria 34094
139 Ga0075435_100021108 3300007076 Bacteria 5003
140 Ga0075435_100086773 3300007076 Bacteria 2578
141 Ga0075435_100623910 3300007076 Unclassified 935
142 Ga0099795_10014069 3300007788 Bacteria 2471
143 Ga0105251_10059423 3300009011 Unclassified 1803
144 Ga0105250_10081055 3300009092 Bacteria 1315
145 Ga0105240_10000002 3300009093 Bacteria 1924170
146 Ga0105240_10016271 3300009093 Bacteria 10075
147 Ga0105240_10024373 3300009093 Bacteria 7976
148 Ga0105247_10001660 3300009101 Bacteria 15704
149 Ga0105241_10028902 3300009174 Bacteria 4131
150 Ga0105241_10029642 3300009174 Bacteria 4085
151 Ga0105242_10002704 3300009176 Bacteria 13874
152 Ga0105248_10909397 3300009177 Bacteria 994
153 Ga0105237_10116595 3300009545 Bacteria 2664
154 Ga0105237_10301675 3300009545 Unclassified 1605
155 Ga0105237_10715368 3300009545 Unclassified 1008
156 Ga0105238_10103340 3300009551 Unclassified 2831
157 Ga0105249_10012598 3300009553 Bacteria 7456
158 Ga0105239_10010384 3300010375 Bacteria 10422
159 Ga0105239_10017449 3300010375 Bacteria 7938
160 Ga0105246_10003366 3300011119 Bacteria 9679
161 Ga0157373_10063959 3300013100 Bacteria 2604
162 Ga0157373_10354572 3300013100 Unclassified 1047
163 Ga0157371_10003096 3300013102 Bacteria 15415
164 Ga0157370_10301832 3300013104 Unclassified 1478
165 Ga0157369_10113873 3300013105 Unclassified 2873
166 Ga0157369_10204880 3300013105 Bacteria 2069
167 Ga0157378_10010136 3300013297 Bacteria 8218
168 Ga0157378_10096399 3300013297 Bacteria 2695
169 Ga0157372_10003104 3300013307 Bacteria 17899
170 Ga0157372_10039130 3300013307 Bacteria 5235
171 Ga0157372_10188549 3300013307 Unclassified 2388
172 Ga0157372_11663854 3300013307 Unclassified 734
173 Ga0163163_10071559 3300014325 Unclassified 3456
174 Ga0157380_10006198 3300014326 Bacteria 8392
175 Ga0182008_10002439 3300014497 Bacteria 11660
176 Ga0182008_10006573 3300014497 Bacteria 6488
177 Ga0157376_10469025 3300014969 Bacteria 1232
178 Ga0182007_10003833 3300015262 Bacteria 6995
179 Ga0182007_10031408 3300015262 Bacteria 1809
180 Ga0182005_1018082 3300015265 Bacteria 1949
181 Ga0163161_10002149 3300017792 Bacteria 14219
182 Ga0213873_10019331 3300021358 Bacteria 1579
183 Ga0224572_1034171 3300024225 Bacteria 966
184 Ga0228598_1001830 3300024227 Bacteria 4628
185 Ga0228598_1002277 3300024227 Bacteria 4202
186 Ga0207673_1009865 3300025290 Unclassified 1224
187 Ga0207697_10053904 3300025315 Bacteria 1666
188 Ga0207656_10002425 3300025321 Bacteria 6282
189 Ga0207656_10084465 3300025321 Bacteria 1432
190 Ga0207692_10001563 3300025898 Bacteria 8612
191 Ga0207692_10002132 3300025898 Bacteria 7553
192 Ga0207692_10156294 3300025898 Unclassified 1310
193 Ga0207642_10041297 3300025899 Bacteria 2018
194 Ga0207710_10025331 3300025900 Bacteria 2560
195 Ga0207688_10000432 3300025901 Bacteria 19791
196 Ga0207680_10059350 3300025903 Bacteria 2323
197 Ga0207647_10001819 3300025904 Bacteria 16370
198 Ga0207699_10029208 3300025906 Unclassified 3073
199 Ga0207699_10041905 3300025906 Bacteria 2648
200 Ga0207699_10062796 3300025906 Bacteria 2241
201 Ga0207699_10190783 3300025906 Bacteria 1383
202 Ga0207645_10000054 3300025907 Bacteria 83043
203 Ga0207643_10000357 3300025908 Bacteria 30643
204 Ga0207684_10048524 3300025910 Unclassified 3601
205 Ga0207654_10167285 3300025911 Bacteria 1425
206 Ga0207654_10285279 3300025911 Bacteria 1118
207 Ga0207707_10002366 3300025912 Bacteria 16996
208 Ga0207695_10000002 3300025913 Bacteria 2188391
209 Ga0207695_10063538 3300025913 Bacteria 3805
210 Ga0207695_10232820 3300025913 Bacteria 1746
211 Ga0207671_10079310 3300025914 Unclassified 2460
212 Ga0207671_10105199 3300025914 Bacteria 2141
213 Ga0207671_10309555 3300025914 Unclassified 1249
214 Ga0207693_10000453 3300025915 Bacteria 37587
215 Ga0207693_10001276 3300025915 Bacteria 22423
216 Ga0207693_10008765 3300025915 Bacteria 8268
217 Ga0207693_10039816 3300025915 Unclassified 3701
218 Ga0207693_10040309 3300025915 Unclassified 3678
219 Ga0207693_10098358 3300025915 Bacteria 2294
220 Ga0207663_10007561 3300025916 Bacteria 5640
221 Ga0207663_10017673 3300025916 Bacteria 3980
222 Ga0207663_10029206 3300025916 Unclassified 3236
223 Ga0207663_10152939 3300025916 Bacteria 1620
224 Ga0207662_10005889 3300025918 Bacteria 6576
225 Ga0207657_10000255 3300025919 Bacteria 56523
226 Ga0207657_10001691 3300025919 Bacteria 23788
227 Ga0207649_10000754 3300025920 Bacteria 21137
228 Ga0207649_10881108 3300025920 Unclassified 701
229 Ga0207652_10438717 3300025921 Bacteria 1177
230 Ga0207646_10048090 3300025922 Bacteria 3824
231 Ga0207646_10073773 3300025922 Bacteria 3048
232 Ga0207646_10159196 3300025922 Unclassified 2037
233 Ga0207646_10171370 3300025922 Bacteria 1960
234 Ga0207681_10038825 3300025923 Bacteria 3157
235 Ga0207694_10045825 3300025924 Unclassified 3378
236 Ga0207650_10000042 3300025925 Bacteria 191592
237 Ga0207659_10017863 3300025926 Bacteria 4641
238 Ga0207687_10037173 3300025927 Unclassified 3320
239 Ga0207700_10000823 3300025928 Bacteria 17936
240 Ga0207700_10003196 3300025928 Bacteria 9456
241 Ga0207700_10024112 3300025928 Bacteria 4206
242 Ga0207700_10040200 3300025928 Unclassified 3411
243 Ga0207700_10049015 3300025928 Unclassified 3139
244 Ga0207700_10114385 3300025928 Unclassified 2177
245 Ga0207700_10187020 3300025928 Bacteria 1738
246 Ga0207664_10000116 3300025929 Bacteria 70438
247 Ga0207664_10099538 3300025929 Unclassified 2399
248 Ga0207664_10311741 3300025929 Unclassified 1386
249 Ga0207664_10764996 3300025929 Unclassified 869
250 Ga0207644_10005781 3300025931 Bacteria 8049
251 Ga0207690_10106986 3300025932 Bacteria 2008
252 Ga0207690_10445340 3300025932 Bacteria 1040
253 Ga0207706_10000945 3300025933 Bacteria 29679
254 Ga0207706_10103925 3300025933 Unclassified 2499
255 Ga0207670_10034643 3300025936 Bacteria 3265
256 Ga0207669_10109659 3300025937 Bacteria 1846
257 Ga0207704_10022893 3300025938 Bacteria 3357
258 Ga0207665_10000209 3300025939 Bacteria 39512
259 Ga0207665_10001110 3300025939 Bacteria 18101
260 Ga0207665_10001892 3300025939 Bacteria 14103
261 Ga0207665_10014949 3300025939 Bacteria 5099
262 Ga0207691_10000051 3300025940 Bacteria 94390
263 Ga0207689_10000288 3300025942 Bacteria 45755
264 Ga0207689_10311322 3300025942 Unclassified 1306
265 Ga0207661_10000084 3300025944 Bacteria 65203
266 Ga0207679_10000050 3300025945 Bacteria 112411
267 Ga0207667_10259175 3300025949 Bacteria 1778
268 Ga0207667_10372438 3300025949 Unclassified 1455
269 Ga0207651_10063103 3300025960 Bacteria 2585
270 Ga0207712_10028420 3300025961 Bacteria 3741
271 Ga0207640_10259429 3300025981 Bacteria 1353
272 Ga0207658_10079811 3300025986 Bacteria 2504
273 Ga0207677_10061596 3300026023 Unclassified 2599
274 Ga0207677_10089357 3300026023 Bacteria 2236
275 Ga0207703_10042858 3300026035 Bacteria 3630
276 Ga0207678_10000023 3300026067 Bacteria 126241
277 Ga0207678_10218453 3300026067 Bacteria 1631
278 Ga0207708_10102426 3300026075 Bacteria 2216
279 Ga0207641_10000059 3300026088 Bacteria 164728
280 Ga0207648_10000041 3300026089 Bacteria 115866
281 Ga0207676_10000080 3300026095 Bacteria 94513
282 Ga0207674_10000047 3300026116 Bacteria 120929
283 Ga0207674_10179723 3300026116 Unclassified 2067
284 Ga0207675_100006899 3300026118 Bacteria 10754
285 Ga0207683_10000017 3300026121 Bacteria 123119
286 Ga0207698_10088444 3300026142 Bacteria 2526
287 Ga0268266_10003183 3300028379 Bacteria 16640
288 Ga0268265_10067233 3300028380 Bacteria 2773
289 Ga0268264_10040841 3300028381 Bacteria 3833
290 Ga0265338_10042120 3300028800 Bacteria 4258
291 Ga0265338_10184482 3300028800 Bacteria 1587
292 Ga0265762_1002394 3300030760 Bacteria 3398
293 Ga0265762_1059618 3300030760 Unclassified 782
294 Ga0265770_1036918 3300030878 Bacteria 841
295 Ga0265761_104021 3300030889 Unclassified 739
296 Ga0265760_10000414 3300031090 Bacteria 12005
297 Ga0265325_10076113 3300031241 Unclassified 1675
298 Ga0265339_10014300 3300031249 Bacteria 4786
299 Ga0265339_10022698 3300031249 Bacteria 3632
300 Ga0265339_10100679 3300031249 Unclassified 1504
301 Ga0265316_10007396 3300031344 Bacteria 10351
302 Ga0265314_10001786 3300031711 Bacteria 23210
303 Ga0265314_10204001 3300031711 Bacteria 1166
304 Ga0265342_10068552 3300031712 Bacteria 2073
305 Ga0316214_1000477 3300033545 Bacteria 4085
306 Ga0373926_0018080 3300035083 Unclassified 2423
307 Ga0373926_0042399 3300035083 Unclassified 1627
308 Ga0373934_0062700 3300035086 Unclassified 1482
309 Ga0373944_0019305 3300035089 Unclassified 1955
310 Ga0373944_0024876 3300035089 Bacteria 1759
311 Ga0373923_0002277 3300035111 Bacteria 5854
312 Ga0373936_0000582 3300035113 Bacteria 12595
313 Ga0373936_0225919 3300035113 Unclassified 831
314 Ga0373945_0017451 3300035116 Unclassified 2431
315 Ga0373956_0456327 3300035119 Unclassified 610
316 Ga0373957_0048605 3300035120 Unclassified 1617
317 Ga0373943_0010410 3300035170 Unclassified 4167
318 Ga0373943_0027523 3300035170 Unclassified 2672
319 Ga0373943_0128960 3300035170 Unclassified 1352
320 Ga0373946_0257625 3300035171 Bacteria 853
321 Ga0373955_0005195 3300035172 Bacteria 5829
322 Ga0373955_0452450 3300035172 Unclassified 783
323 Ga0373924_0022282 3300035410 Unclassified 2476
324 Ga0373924_0053378 3300035410 Unclassified 1679
325 Ga0373935_0002156 3300035692 Bacteria 11170
326 Ga0373935_0002847 3300035692 Bacteria 9956
327 Ga0373935_0168918 3300035692 Unclassified 1495
328 Ga0373935_0633701 3300035692 Unclassified 783
329 Ga0373927_0000031 3300035695 Bacteria 105518
330 Ga0373927_0035586 3300035695 Unclassified 3238
331 Ga0373927_0109170 3300035695 Unclassified 1802
332 Ga0373927_0161465 3300035695 Bacteria 1468
333 Ga0373933_0013889 3300035724 Bacteria 4469
334 Ga0373933_0014596 3300035724 Unclassified 4372
335 Ga0373947_0000153 3300035725 Bacteria 36232
336 Ga0373947_0035589 3300035725 Unclassified 2948
337 Ga0373947_0044045 3300035725 Unclassified 2667
338 Ga0373947_0197022 3300035725 Bacteria 1317
339 Ga0373947_0262032 3300035725 Unclassified 1146
340 Ga0373937_0126556 3300036401 Unclassified 2384
341 Ga0373937_0182320 3300036401 Bacteria 1972
342 Ga0373937_0371001 3300036401 Bacteria 1357
343 Ga0373925_0000214 3300037068 Bacteria 62910
344 Ga0373925_0001230 3300037068 Bacteria 22647
345 Ga0373925_0112308 3300037068 Bacteria 2106
346 Ga0373925_0116064 3300037068 Unclassified 2073
347 Ga0373925_0372235 3300037068 Unclassified 1162
348 Ga0436364_0221065 3300037853 Unclassified 3967
349 Ga0436363_0028409 3300039450 Bacteria 2708
350 Ga0436362_0907255 3300039453 Bacteria 5185
351 Ga0466968_0170376 3300044735 Bacteria 1009
352 Ga0495580_0001532 3300046472 Bacteria 20331
353 Ga0495580_0002918 3300046472 Bacteria 14688
354 Ga0495580_0003486 3300046472 Bacteria 13390
355 Ga0495580_0003913 3300046472 Bacteria 12579
356 Ga0495580_0013662 3300046472 Bacteria 6189
357 Ga0495580_0024205 3300046472 Bacteria 4449
358 Ga0495580_0075584 3300046472 Unclassified 2350
359 Ga0495580_0138309 3300046472 Bacteria 1689
360 Ga0495580_0141312 3300046472 Unclassified 1669
361 Ga0495580_0192405 3300046472 Bacteria 1407
362 Ga0495580_0363964 3300046472 Unclassified 978
363 Ga0495582_0000571 3300046473 Bacteria 20379
364 Ga0495664_0143041 3300046477 Unclassified 1450
365 Ga0495630_0118334 3300046517 Unclassified 2009
366 Ga0495665_0002493 3300046531 Bacteria 9936
367 Ga0495665_0060929 3300046531 Bacteria 1993
368 Ga0495665_0064450 3300046531 Unclassified 1934
369 Ga0495665_0067552 3300046531 Unclassified 1886
370 Ga0495659_0064293 3300046664 Bacteria 1362
371 Ga0495658_0030859 3300046683 Unclassified 2914
372 Ga0495669_0069236 3300046684 Bacteria 1606
373 Ga0495669_0110315 3300046684 Bacteria 1284
374 Ga0495600_0450613 3300046809 Unclassified 796
375 Ga0495581_0005459 3300047315 Bacteria 7356
376 Ga0495674_0001152 3300047319 Bacteria 25477
377 Ga0495674_0144412 3300047319 Unclassified 1998
378 Ga0495674_0789579 3300047319 Unclassified 739
379 Ga0495676_0059204 3300047321 Unclassified 3010
380 Ga0495680_0093497 3300047322 Unclassified 2251
381 Ga0495602_0248677 3300048088 Bacteria 1326
382 Ga0496100_0236256 3300048903 Bacteria 1347
383 Ga0496101_0166800 3300048904 Bacteria 1691
384 Ga0496102_0056232 3300048905 Bacteria 3588
385 Ga0496103_0121894 3300048906 Bacteria 1661
386 Ga0496104_0225453 3300048907 Unclassified 1786
387 Ga0496106_0039066 3300048909 Bacteria 3554
388 Ga0496108_0000557 3300048911 Bacteria 29188
389 Ga0496109_0000059 3300048912 Bacteria 118169
390 Ga0496109_0100594 3300048912 Bacteria 2682
391 Ga0496110_0000974 3300048913 Bacteria 20065
392 Ga0496110_0247798 3300048913 Bacteria 1621
393 Ga0496111_0005139 3300048914 Bacteria 8341
394 Ga0496111_0157639 3300048914 Bacteria 1684
395 Ga0496112_0000027 3300048915 Bacteria 139514
396 Ga0496112_0083003 3300048915 Bacteria 3168
397 Ga0496112_0191029 3300048915 Bacteria 2010
398 Ga0496112_0725573 3300048915 Unclassified 921
399 Ga0496113_0000115 3300048916 Bacteria 34616
400 Ga0496113_0091446 3300048916 Bacteria 2345
401 nmdc:mga0n895_17106_c1 3300050512 Bacteria 6678
402 nmdc:mga0n895_23549_c1 3300050512 Bacteria 5789
403 nmdc:mga0n895_400_c1 3300050512 Bacteria 29183
404 nmdc:mga0n895_594627_c1 3300050512 Unclassified 1109
405 nmdc:mga0rr50_15793_c1 3300050513 Unclassified 4994
406 nmdc:mga0rr50_179495_c1 3300050513 Bacteria 1730
407 nmdc:mga0rr50_4487_c1 3300050513 Bacteria 8221
408 nmdc:mga08x19_5071_c1 3300050514 Bacteria 7789
409 nmdc:mga08x19_676_c1 3300050514 Bacteria 21865
410 nmdc:mga0a205_3582_c1 3300050515 Bacteria 13900
411 Ga0070713_100041215
412 JGI24752J21851_1000765
413 JGI24750J21931_1017900
414 JGI24748J21848_1002768
415 JGI24033J26618_1004573
416 JGI24034J26672_10001012
417 JGI24751J29686_10002377
418 Ga0065712_10017784
419 Ga0070658_10161496
420 Ga0070676_10002865
421 Ga0070683_100215179
422 Ga0070683_100295690
423 Ga0070690_100003245
424 Ga0070670_100015937
425 Ga0068869_100199946
426 Ga0070666_10026365
427 Ga0070682_100064313
428 Ga0068868_100059750
429 Ga0068868_100076436
430 Ga0068868_100175481
431 Ga0070660_100205654
432 Ga0070689_100005917
433 Ga0070687_100099440
434 Ga0070661_100019848
435 Ga0070661_100079472
436 Ga0070669_100034197
437 Ga0070671_100136080
438 Ga0070674_100024498
439 Ga0070673_100001892
440 Ga0070673_100284554
441 Ga0070688_100000291
442 Ga0070667_100143964
443 Ga0070667_100368368
444 Ga0070709_10000469
445 Ga0070709_10002157
446 Ga0070709_10129477
447 Ga0070709_10203982
448 Ga0070714_100135432
449 Ga0070714_100170766
450 Ga0070713_100003137
451 Ga0070713_100005775
452 Ga0070713_100025799
453 Ga0070713_100063881
454 Ga0070713_100091331
455 Ga0070710_10000281
456 Ga0070710_10021483
457 Ga0070710_10115763
458 Ga0070710_10135923
459 Ga0070710_10209835
460 Ga0070710_10298193
461 Ga0070710_10394333
462 Ga0070711_100009447
463 Ga0070711_100014150
464 Ga0070711_100029770
465 Ga0070711_100103514
466 Ga0070711_100168251
467 Ga0070711_100237022
468 Ga0070708_100007263
469 Ga0070708_100300469
470 Ga0070708_101072282
471 Ga0070663_100022702
472 Ga0070663_100252187
473 Ga0070663_100294501
474 Ga0070678_100019373
475 Ga0070681_10004231
476 Ga0068867_100001551
477 Ga0070685_10003740
478 Ga0070706_100053348
479 Ga0070706_100056960
480 Ga0070706_100498322
481 Ga0070707_100029640
482 Ga0070707_100040309
483 Ga0070707_100078884
484 Ga0070707_100822794
485 Ga0070699_100045068
486 Ga0070699_100569469
487 Ga0070679_100149854
488 Ga0070684_100003101
489 Ga0070697_100121462
490 Ga0070697_100238333
491 Ga0068853_100004183
492 Ga0068853_100015151
493 Ga0070672_100000501
494 Ga0070686_100038424
495 Ga0068855_100014203
496 Ga0068855_100073482
497 Ga0070664_100009974
498 Ga0070664_100043551
499 Ga0068857_100007891
500 Ga0068854_100002665
501 Ga0068856_100048241
502 Ga0068856_100231801
503 Ga0068856_100280719
504 Ga0068856_100429390
505 Ga0070702_100004343
506 Ga0068852_100012748
507 Ga0068866_10009670
508 Ga0068861_100076675
509 Ga0068851_10000317
510 Ga0068851_10003745
511 Ga0068863_100025741
512 Ga0068863_100098516
513 Ga0068862_100151670
514 Ga0070717_10000142
515 Ga0070717_10002532
516 Ga0070717_10019431
517 Ga0070717_10044263
518 Ga0070717_10073693
519 Ga0070717_10133258
520 Ga0070717_10160320
521 Ga0070717_10194238
522 Ga0070717_10624510
523 Ga0070717_10699565
524 Ga0070717_10924546
525 Ga0070715_10005771
526 Ga0070716_100000043
527 Ga0070716_100000602
528 Ga0070716_100010868
529 Ga0070716_100047314
530 Ga0070716_100127414
531 Ga0070716_100344125
532 Ga0070716_100382833
533 Ga0070712_100000915
534 Ga0070712_100000974
535 Ga0070712_100002324
536 Ga0070712_100002359
537 Ga0070712_100216652
538 Ga0097621_100177941
539 Ga0068871_100114915
540 Ga0068871_100272873
541 Ga0068871_100576820
542 Ga0075434_100000963
543 Ga0075434_100003131
544 Ga0075434_100029410
545 Ga0075434_100794927
546 Ga0075436_100001638
547 Ga0075436_100004870
548 Ga0075435_100000232
549 Ga0075435_100021108
550 Ga0075435_100086773
551 Ga0075435_100623910
552 Ga0099795_10014069
553 Ga0105251_10059423
554 Ga0105250_10081055
555 Ga0105240_10000002
556 Ga0105240_10016271
557 Ga0105240_10024373
558 Ga0105247_10001660
559 Ga0105241_10028902
560 Ga0105241_10029642
561 Ga0105242_10002704
562 Ga0105248_10909397
563 Ga0105237_10116595
564 Ga0105237_10301675
565 Ga0105237_10715368
566 Ga0105238_10103340
567 Ga0105249_10012598
568 Ga0105239_10010384
569 Ga0105239_10017449
570 Ga0105246_10003366
571 Ga0157373_10063959
572 Ga0157373_10354572
573 Ga0157371_10003096
574 Ga0157370_10301832
575 Ga0157369_10113873
576 Ga0157369_10204880
577 Ga0157378_10010136
578 Ga0157378_10096399
579 Ga0157372_10003104
580 Ga0157372_10039130
581 Ga0157372_10188549
582 Ga0157372_11663854
583 Ga0163163_10071559
584 Ga0157380_10006198
585 Ga0182008_10002439
586 Ga0182008_10006573
587 Ga0157376_10469025
588 Ga0182007_10003833
589 Ga0182007_10031408
590 Ga0182005_1018082
591 Ga0163161_10002149
592 Ga0213873_10019331
593 Ga0224572_1034171
594 Ga0228598_1001830
595 Ga0228598_1002277
596 Ga0207673_1009865
597 Ga0207697_10053904
598 Ga0207656_10002425
599 Ga0207656_10084465
600 Ga0207692_10001563
601 Ga0207692_10002132
602 Ga0207692_10156294
603 Ga0207642_10041297
604 Ga0207710_10025331
605 Ga0207688_10000432
606 Ga0207680_10059350
607 Ga0207647_10001819
608 Ga0207699_10029208
609 Ga0207699_10041905
610 Ga0207699_10062796
611 Ga0207699_10190783
612 Ga0207645_10000054
613 Ga0207643_10000357
614 Ga0207684_10048524
615 Ga0207654_10167285
616 Ga0207654_10285279
617 Ga0207707_10002366
618 Ga0207695_10000002
619 Ga0207695_10063538
620 Ga0207695_10232820
621 Ga0207671_10079310
622 Ga0207671_10105199
623 Ga0207671_10309555
624 Ga0207693_10000453
625 Ga0207693_10001276
626 Ga0207693_10008765
627 Ga0207693_10039816
628 Ga0207693_10040309
629 Ga0207693_10098358
630 Ga0207663_10007561
631 Ga0207663_10017673
632 Ga0207663_10029206
633 Ga0207663_10152939
634 Ga0207662_10005889
635 Ga0207657_10000255
636 Ga0207657_10001691
637 Ga0207649_10000754
638 Ga0207649_10881108
639 Ga0207652_10438717
640 Ga0207646_10048090
641 Ga0207646_10073773
642 Ga0207646_10159196
643 Ga0207646_10171370
644 Ga0207681_10038825
645 Ga0207694_10045825
646 Ga0207650_10000042
647 Ga0207659_10017863
648 Ga0207687_10037173
649 Ga0207700_10000823
650 Ga0207700_10003196
651 Ga0207700_10024112
652 Ga0207700_10040200
653 Ga0207700_10049015
654 Ga0207700_10114385
655 Ga0207700_10187020
656 Ga0207664_10000116
657 Ga0207664_10099538
658 Ga0207664_10311741
659 Ga0207664_10764996
660 Ga0207644_10005781
661 Ga0207690_10106986
662 Ga0207690_10445340
663 Ga0207706_10000945
664 Ga0207706_10103925
665 Ga0207670_10034643
666 Ga0207669_10109659
667 Ga0207704_10022893
668 Ga0207665_10000209
669 Ga0207665_10001110
670 Ga0207665_10001892
671 Ga0207665_10014949
672 Ga0207691_10000051
673 Ga0207689_10000288
674 Ga0207689_10311322
675 Ga0207661_10000084
676 Ga0207679_10000050
677 Ga0207667_10259175
678 Ga0207667_10372438
679 Ga0207651_10063103
680 Ga0207712_10028420
681 Ga0207640_10259429
682 Ga0207658_10079811
683 Ga0207677_10061596
684 Ga0207677_10089357
685 Ga0207703_10042858
686 Ga0207678_10000023
687 Ga0207678_10218453
688 Ga0207708_10102426
689 Ga0207641_10000059
690 Ga0207648_10000041
691 Ga0207676_10000080
692 Ga0207674_10000047
693 Ga0207674_10179723
694 Ga0207675_100006899
695 Ga0207683_10000017
696 Ga0207698_10088444
697 Ga0268266_10003183
698 Ga0268265_10067233
699 Ga0268264_10040841
700 Ga0265338_10042120
701 Ga0265338_10184482
702 Ga0265762_1002394
703 Ga0265762_1059618
704 Ga0265770_1036918
705 Ga0265761_104021
706 Ga0265760_10000414
707 Ga0265325_10076113
708 Ga0265339_10014300
709 Ga0265339_10022698
710 Ga0265339_10100679
711 Ga0265316_10007396
712 Ga0265314_10001786
713 Ga0265314_10204001
714 Ga0265342_10068552
715 Ga0316214_1000477
716 Ga0373926_0018080
717 Ga0373926_0042399
718 Ga0373934_0062700
719 Ga0373944_0019305
720 Ga0373944_0024876
721 Ga0373923_0002277
722 Ga0373936_0000582
723 Ga0373936_0225919
724 Ga0373945_0017451
725 Ga0373956_0456327
726 Ga0373957_0048605
727 Ga0373943_0010410
728 Ga0373943_0027523
729 Ga0373943_0128960
730 Ga0373946_0257625
731 Ga0373955_0005195
732 Ga0373955_0452450
733 Ga0373924_0022282
734 Ga0373924_0053378
735 Ga0373935_0002156
736 Ga0373935_0002847
737 Ga0373935_0168918
738 Ga0373935_0633701
739 Ga0373927_0000031
740 Ga0373927_0035586
741 Ga0373927_0109170
742 Ga0373927_0161465
743 Ga0373933_0013889
744 Ga0373933_0014596
745 Ga0373947_0000153
746 Ga0373947_0035589
747 Ga0373947_0044045
748 Ga0373947_0197022
749 Ga0373947_0262032
750 Ga0373937_0126556
751 Ga0373937_0182320
752 Ga0373937_0371001
753 Ga0373925_0000214
754 Ga0373925_0001230
755 Ga0373925_0112308
756 Ga0373925_0116064
757 Ga0373925_0372235
758 Ga0436364_0221065
759 Ga0436363_0028409
760 Ga0436362_0907255
761 Ga0466968_0170376
762 Ga0495580_0001532
763 Ga0495580_0002918
764 Ga0495580_0003486
765 Ga0495580_0003913
766 Ga0495580_0013662
767 Ga0495580_0024205
768 Ga0495580_0075584
769 Ga0495580_0138309
770 Ga0495580_0141312
771 Ga0495580_0192405
772 Ga0495580_0363964
773 Ga0495582_0000571
774 Ga0495664_0143041
775 Ga0495630_0118334
776 Ga0495665_0002493
777 Ga0495665_0060929
778 Ga0495665_0064450
779 Ga0495665_0067552
780 Ga0495659_0064293
781 Ga0495658_0030859
782 Ga0495669_0069236
783 Ga0495669_0110315
784 Ga0495600_0450613
785 Ga0495581_0005459
786 Ga0495674_0001152
787 Ga0495674_0144412
788 Ga0495674_0789579
789 Ga0495676_0059204
790 Ga0495680_0093497
791 Ga0495602_0248677
792 Ga0496100_0236256
793 Ga0496101_0166800
794 Ga0496102_0056232
795 Ga0496103_0121894
796 Ga0496104_0225453
797 Ga0496106_0039066
798 Ga0496108_0000557
799 Ga0496109_0000059
800 Ga0496109_0100594
801 Ga0496110_0000974
802 Ga0496110_0247798
803 Ga0496111_0005139
804 Ga0496111_0157639
805 Ga0496112_0000027
806 Ga0496112_0083003
807 Ga0496112_0191029
808 Ga0496112_0725573
809 Ga0496113_0000115
810 Ga0496113_0091446
811 nmdc:mga0n895_17106_c1
812 nmdc:mga0n895_23549_c1
813 nmdc:mga0n895_400_c1
814 nmdc:mga0n895_594627_c1
815 nmdc:mga0rr50_15793_c1
816 nmdc:mga0rr50_179495_c1
817 nmdc:mga0rr50_4487_c1
818 nmdc:mga08x19_5071_c1
819 nmdc:mga08x19_676_c1
820 nmdc:mga0a205_3582_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02563

Poly_export

Polysaccharide biosynthesis/export protein

63

139

0.96

PF22461

SLBB_2

SLBB domain

144

224

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dfk-assembly2.cif.gz_C x-ray crystal structure of bacillus subtilis comea 0.7844 109 190
8dss-assembly1.cif.gz_A x-ray crystal structure of geobacillus stearothermophilus comea 0.7468 109 145
8dfk-assembly2.cif.gz_C x-ray crystal structure of bacillus subtilis comea 0.6981 109 190
2w8h-assembly1.cif.gz_C crystal structure of spin labeled wza24-345. 0.6534 33 190
2j58-assembly1.cif.gz_H the structure of wza 0.6516 33 190
ID Description Score Start End Superfamily
2w8hA03 Alpha Beta;2-Layer Sandwich;wza like fold;wza like domain 0.957 37 104 3.30.1950.10
2w8hA02 Alpha Beta;Roll;Outer membrane lipoprotein wza fold like;Outer membrane lipoprotein wza domain like 0.7922 108 190 3.10.560.10
2w8hA03 Alpha Beta;2-Layer Sandwich;wza like fold;wza like domain 0.7894 37 104 3.30.1950.10
2j58D01 Alpha Beta;Roll;Outer membrane lipoprotein wza fold like;Outer membrane lipoprotein wza domain like 0.7676 109 189 3.10.560.10
af_Q93518_12_136_2.60.120.290 Mainly Beta;Sandwich;Jelly Rolls;Spermadhesin, CUB domain 0.7595 149 164 2.60.120.290
ID Description Score Start End GO Terms
AF-A0A2V7VZ60-F1-model_v4 Soluble ligand binding domain-containing protein 0.8573 22 190 GO:0009279
GO:0015159
AF-A0A511TAQ3-F1-model_v4 Capsular polysaccharide biosynthesis protein 0.8316 34 190 GO:0015159
AF-A0A7T9B9T4-F1-model_v4 deleted 0.8301 34 190
AF-A0A6P0YL94-F1-model_v4 Polysaccharide export protein 0.7945 32 190 GO:0006811
GO:0009279
GO:0015159
GO:0015288
GO:0046930
AF-A0A6M0FFS4-F1-model_v4 Polysaccharide export protein 0.7808 34 190 GO:0006811
GO:0009279
GO:0015159
GO:0015288
GO:0046930

Map