F436952

General Info

Members Datasets Scaffolds Average Seq Length
409 274 818 141

Family's Representative Sequence

Representative Sequence 3300006177|Ga0075362_10153688|Ga0075362_101536882
Length 142
Sequence MSVRDFTEISVGQELPEETVPLTRSDLVQYAGVSGDPNPIHWDDATAQKLGLPCAVAHGMLTMGIGAGYVTSWLGDPGAVTEYSVRFTSPVVVPNDGKGAVIVLTGKVKSVDEETRSAVVAIVAKVDDKKIFGRATATVRFG

Samples

Sample ID Description Type Environment
1 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
110 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
111 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
120 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
127 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
133 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
134 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
135 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
136 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
137 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
138 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
139 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
140 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
154 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
155 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
158 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
161 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
162 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
240 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
244 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
254 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
257 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
260 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
261 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
262 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
263 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
264 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
265 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
266 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
267 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
268 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
269 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
270 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
271 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
272 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
273 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
274 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 91.69
Metatranscriptomes 4.89
Isolates 3.42

Biome Distribution

Category Percentage (%)
Aerial Root 0.24
Bulb 0
Endosphere 6.85
Nodule 0
Rhizoplane 5.87
Rhizosphere 82.64
Stem 0
Stem Tuber 0
Unclassified 11.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075362_10153688 3300006177 Bacteria 1105
2 Ga0058863_11578438 3300004799 Bacteria 860
3 Ga0058861_11298209 3300004800 Bacteria 688
4 Ga0058862_12732099 3300004803 Bacteria 1024
5 Ga0070683_100395524 3300005329 Bacteria 1318
6 Ga0068869_100937370 3300005334 Bacteria 751
7 Ga0070687_100956647 3300005343 Bacteria 618
8 Ga0070661_100611360 3300005344 Bacteria 882
9 Ga0070692_10720512 3300005345 Bacteria 673
10 Ga0070668_101721161 3300005347 Bacteria 576
11 Ga0070675_102100904 3300005354 Bacteria 521
12 Ga0070674_101425612 3300005356 Bacteria 621
13 Ga0070673_101675567 3300005364 Bacteria 601
14 Ga0070659_100350652 3300005366 Bacteria 1238
15 Ga0070659_101940051 3300005366 Unclassified 528
16 Ga0070667_100983797 3300005367 Unclassified 787
17 Ga0070709_10855499 3300005434 Bacteria 717
18 Ga0070714_101195370 3300005435 Bacteria 742
19 Ga0070701_10504217 3300005438 Bacteria 786
20 Ga0070705_100810032 3300005440 Bacteria 746
21 Ga0070708_100192083 3300005445 Bacteria 1910
22 Ga0070678_100481686 3300005456 Unclassified 1092
23 Ga0070681_10031624 3300005458 Bacteria 5313
24 Ga0070681_10068444 3300005458 Bacteria 3516
25 Ga0070706_100029591 3300005467 Bacteria 5046
26 Ga0070707_100176111 3300005468 Bacteria 2085
27 Ga0070698_100425503 3300005471 Bacteria 1262
28 Ga0070699_100907822 3300005518 Bacteria 807
29 Ga0070697_101731839 3300005536 Bacteria 559
30 Ga0070693_100212102 3300005547 Bacteria 1264
31 Ga0070665_100557586 3300005548 Bacteria 1158
32 Ga0070704_100140002 3300005549 Bacteria 1888
33 Ga0068856_100098391 3300005614 Bacteria 2915
34 Ga0068864_100612245 3300005618 Bacteria 1058
35 Ga0068870_10581779 3300005840 Bacteria 758
36 Ga0068858_101387951 3300005842 Archaea 692
37 Ga0081455_10073233 3300005937 Bacteria 2833
38 Ga0075365_10381980 3300006038 Bacteria 994
39 Ga0075368_10351169 3300006042 Bacteria 642
40 Ga0075363_100012532 3300006048 Bacteria 4092
41 Ga0075363_100074596 3300006048 Bacteria 1847
42 Ga0075364_10004433 3300006051 Bacteria 8076
43 Ga0075364_10212777 3300006051 Unclassified 1311
44 Ga0075362_10095080 3300006177 Bacteria 1387
45 Ga0075367_10043814 3300006178 Bacteria 2621
46 Ga0075367_10066242 3300006178 Unclassified 2164
47 Ga0075367_10233904 3300006178 Bacteria 1151
48 Ga0075370_10030601 3300006353 Bacteria 3004
49 Ga0075370_10521201 3300006353 Bacteria 718
50 Ga0075428_101140503 3300006844 Bacteria 823
51 Ga0075430_100683891 3300006846 Bacteria 846
52 Ga0075430_100686678 3300006846 Bacteria 844
53 Ga0075433_10048764 3300006852 Bacteria 3683
54 Ga0075434_100351756 3300006871 Bacteria 1494
55 Ga0075434_101509719 3300006871 Bacteria 681
56 Ga0075436_100204604 3300006914 Bacteria 1398
57 Ga0075435_100027758 3300007076 Bacteria 4432
58 Ga0075435_100367313 3300007076 Bacteria 1235
59 Ga0105240_10233448 3300009093 Bacteria 2136
60 Ga0105240_11563343 3300009093 Unclassified 691
61 Ga0111539_12171115 3300009094 Bacteria 644
62 Ga0105245_10182387 3300009098 Bacteria 2006
63 Ga0105245_10332084 3300009098 Bacteria 1501
64 Ga0105245_10414341 3300009098 Bacteria 1349
65 Ga0105245_11297970 3300009098 Bacteria 777
66 Ga0105247_11376987 3300009101 Bacteria 570
67 Ga0105247_11517112 3300009101 Unclassified 547
68 Ga0114129_10127635 3300009147 Bacteria 3496
69 Ga0114129_12523576 3300009147 Bacteria 614
70 Ga0114129_12793840 3300009147 Bacteria 580
71 Ga0105243_10001021 3300009148 Bacteria 25864
72 Ga0105243_10243080 3300009148 Bacteria 1603
73 Ga0105241_11335662 3300009174 Bacteria 684
74 Ga0105242_10110983 3300009176 Unclassified 2338
75 Ga0105242_11086101 3300009176 Bacteria 813
76 Ga0105242_11956629 3300009176 Bacteria 628
77 Ga0105242_12453096 3300009176 Bacteria 569
78 Ga0105238_10917096 3300009551 Bacteria 895
79 Ga0105249_11695553 3300009553 Bacteria 704
80 Ga0105239_11878244 3300010375 Bacteria 694
81 Ga0105246_10736741 3300011119 Bacteria 868
82 Ga0157374_11027170 3300013296 Bacteria 844
83 Ga0157378_10206902 3300013297 Unclassified 1859
84 Ga0157378_10210461 3300013297 Bacteria 1844
85 Ga0157378_11481220 3300013297 Bacteria 723
86 Ga0163162_10828316 3300013306 Bacteria 1041
87 Ga0157372_11412784 3300013307 Bacteria 802
88 Ga0157372_11991807 3300013307 Bacteria 667
89 Ga0157375_10239619 3300013308 Bacteria 1973
90 Ga0157375_10337983 3300013308 Bacteria 1671
91 Ga0157375_10653175 3300013308 Bacteria 1208
92 Ga0163163_10318784 3300014325 Unclassified 1608
93 Ga0163163_11215710 3300014325 Bacteria 816
94 Ga0157380_10340258 3300014326 Bacteria 1399
95 Ga0157380_12603736 3300014326 Bacteria 572
96 Ga0157380_13366400 3300014326 Unclassified 511
97 Ga0157377_11330631 3300014745 Bacteria 563
98 Ga0157379_10719350 3300014968 Unclassified 938
99 Ga0157376_11175003 3300014969 Unclassified 795
100 Ga0197907_10876372 3300020069 Bacteria 791
101 Ga0206356_11268605 3300020070 Bacteria 845
102 Ga0206351_10357656 3300020077 Bacteria 541
103 Ga0213873_10019624 3300021358 Bacteria 1570
104 Ga0213873_10033169 3300021358 Bacteria 1294
105 Ga0213876_10009909 3300021384 Bacteria 5123
106 Ga0213871_10077725 3300021441 Bacteria 947
107 Ga0207699_10610663 3300025906 Bacteria 795
108 Ga0207643_10906774 3300025908 Bacteria 571
109 Ga0207684_10043579 3300025910 Bacteria 3805
110 Ga0207654_10917066 3300025911 Bacteria 635
111 Ga0207707_10454876 3300025912 Bacteria 1095
112 Ga0207707_10950645 3300025912 Bacteria 708
113 Ga0207662_10371098 3300025918 Bacteria 965
114 Ga0207657_10307790 3300025919 Bacteria 1254
115 Ga0207649_10262393 3300025920 Bacteria 1249
116 Ga0207652_10677025 3300025921 Bacteria 921
117 Ga0207646_10372923 3300025922 Bacteria 1289
118 Ga0207646_10407020 3300025922 Bacteria 1228
119 Ga0207694_10711400 3300025924 Unclassified 847
120 Ga0207687_10255243 3300025927 Unclassified 1396
121 Ga0207687_10280243 3300025927 Bacteria 1336
122 Ga0207700_10201449 3300025928 Bacteria 1678
123 Ga0207664_10611885 3300025929 Bacteria 979
124 Ga0207664_10952170 3300025929 Bacteria 770
125 Ga0207690_10438343 3300025932 Bacteria 1048
126 Ga0207690_11242561 3300025932 Unclassified 622
127 Ga0207686_10161051 3300025934 Bacteria 1573
128 Ga0207686_11110748 3300025934 Bacteria 645
129 Ga0207709_10004533 3300025935 Bacteria 8014
130 Ga0207709_10187472 3300025935 Bacteria 1466
131 Ga0207669_10930967 3300025937 Bacteria 727
132 Ga0207665_10798869 3300025939 Bacteria 745
133 Ga0207691_10957229 3300025940 Bacteria 715
134 Ga0207712_11650373 3300025961 Bacteria 574
135 Ga0207677_10668338 3300026023 Bacteria 919
136 Ga0207703_10144374 3300026035 Bacteria 2069
137 Ga0207678_10159868 3300026067 Bacteria 1924
138 Ga0207708_10293799 3300026075 Bacteria 1320
139 Ga0207708_11109900 3300026075 Bacteria 690
140 Ga0207708_11515699 3300026075 Bacteria 589
141 Ga0207702_10036173 3300026078 Bacteria 4129
142 Ga0207641_10702954 3300026088 Bacteria 996
143 Ga0207641_11378635 3300026088 Bacteria 706
144 Ga0207648_10676761 3300026089 Bacteria 955
145 Ga0207675_101014738 3300026118 Bacteria 848
146 Ga0207683_10312783 3300026121 Unclassified 1438
147 Ga0268265_11756207 3300028380 Bacteria 627
148 Ga0265334_10036861 3300028573 Bacteria 1930
149 Ga0265338_10000152 3300028800 Bacteria 126250
150 Ga0265338_10188266 3300028800 Bacteria 1567
151 Ga0265338_10389670 3300028800 Archaea 995
152 Ga0265325_10003864 3300031241 Bacteria 9612
153 Ga0265340_10121301 3300031247 Unclassified 1203
154 Ga0265339_10024080 3300031249 Bacteria 3512
155 Ga0265339_10601553 3300031249 Bacteria 504
156 Ga0265327_10000002 3300031251 Bacteria 856593
157 Ga0265327_10014884 3300031251 Bacteria 5063
158 Ga0265327_10028827 3300031251 Bacteria 3167
159 Ga0265327_10081003 3300031251 Bacteria 1604
160 Ga0307408_100721758 3300031548 Bacteria 898
161 Ga0265313_10004732 3300031595 Bacteria 10269
162 Ga0265314_10060379 3300031711 Bacteria 2588
163 Ga0265314_10106941 3300031711 Bacteria 1786
164 Ga0265314_10408927 3300031711 Unclassified 732
165 Ga0307407_11014950 3300031903 Unclassified 642
166 Ga0307409_100544915 3300031995 Bacteria 1138
167 Ga0307416_102267056 3300032002 Bacteria 644
168 Ga0307416_102785290 3300032002 Bacteria 585
169 Ga0307416_103314382 3300032002 Bacteria 539
170 Ga0373926_0215340 3300035083 Bacteria 741
171 Ga0373923_0700220 3300035111 Bacteria 503
172 Ga0373936_0512380 3300035113 Bacteria 558
173 Ga0373960_0355209 3300035121 Unclassified 557
174 Ga0373943_0081597 3300035170 Bacteria 1659
175 Ga0373943_0379436 3300035170 Bacteria 814
176 Ga0373955_0402014 3300035172 Bacteria 832
177 Ga0373924_0114880 3300035410 Bacteria 1166
178 Ga0373935_0051456 3300035692 Bacteria 2616
179 Ga0373927_0687674 3300035695 Bacteria 676
180 Ga0373947_0115646 3300035725 Bacteria 1700
181 Ga0373947_0888682 3300035725 Bacteria 608
182 Ga0373937_0111986 3300036401 Bacteria 2539
183 Ga0373937_0638098 3300036401 Bacteria 1010
184 Ga0373925_0221526 3300037068 Bacteria 1510
185 Ga0373925_0965113 3300037068 Bacteria 702
186 Ga0436365_0529345 3300039437 Bacteria 33749
187 Ga0436365_0556156 3300039437 Bacteria 9328
188 Ga0436365_1112120 3300039437 Bacteria 1143
189 Ga0436365_1331325 3300039437 Bacteria 2257
190 Ga0436365_1919244 3300039437 Bacteria 2022
191 Ga0436365_1920334 3300039437 Bacteria 3598
192 Ga0436360_0305687 3300039438 Bacteria 2645
193 Ga0436361_0211735 3300039447 Bacteria 3400
194 Ga0436363_0894620 3300039450 Bacteria 1209
195 Ga0436363_1357321 3300039450 Unclassified 682
196 Ga0436362_0036147 3300039453 Bacteria 1794
197 Ga0436362_0128541 3300039453 Bacteria 1392
198 Ga0436362_0894920 3300039453 Bacteria 1328
199 Ga0436362_0906280 3300039453 Bacteria 1709
200 Ga0451789_1262008 3300041443 Bacteria 574
201 Ga0451807_0708585 3300041486 Bacteria 597
202 Ga0451851_1137982 3300041507 Bacteria 547
203 Ga0451853_2422763 3300041512 Bacteria 615
204 Ga0466972_0161404 3300044658 Bacteria 1053
205 Ga0466966_0020402 3300044684 Bacteria 4357
206 Ga0466968_0267821 3300044735 Bacteria 815
207 Ga0466959_0982854 3300045049 Unclassified 562
208 Ga0466967_0113902 3300045976 Bacteria 2489
209 Ga0466967_0262109 3300045976 Bacteria 1654
210 Ga0466967_1057272 3300045976 Bacteria 809
211 Ga0466967_2414855 3300045976 Bacteria 521
212 Ga0495592_0131920 3300046454 Bacteria 1747
213 Ga0495592_0778377 3300046454 Unclassified 570
214 Ga0495603_0644511 3300046455 Bacteria 606
215 Ga0495629_0103875 3300046459 Unclassified 1982
216 Ga0495629_0123361 3300046459 Bacteria 1805
217 Ga0495641_0493918 3300046461 Bacteria 558
218 Ga0495651_0390312 3300046462 Bacteria 911
219 Ga0495651_0861770 3300046462 Bacteria 556
220 Ga0495653_0248759 3300046463 Bacteria 1181
221 Ga0495653_0363661 3300046463 Bacteria 928
222 Ga0495653_0564224 3300046463 Bacteria 703
223 Ga0495580_0636903 3300046472 Bacteria 702
224 Ga0495580_0829573 3300046472 Bacteria 598
225 Ga0495582_0304024 3300046473 Bacteria 917
226 Ga0495639_0360718 3300046475 Bacteria 730
227 Ga0495662_0210366 3300046476 Bacteria 959
228 Ga0495584_0487388 3300046491 Bacteria 628
229 Ga0495608_0070105 3300046511 Bacteria 2288
230 Ga0495618_0643780 3300046514 Unclassified 627
231 Ga0495628_1202604 3300046516 Unclassified 514
232 Ga0495630_0016588 3300046517 Bacteria 5387
233 Ga0495630_0109653 3300046517 Bacteria 2091
234 Ga0495630_0697571 3300046517 Bacteria 777
235 Ga0495663_0131008 3300046525 Bacteria 846
236 Ga0495666_0108640 3300046526 Bacteria 1304
237 Ga0495666_0392624 3300046526 Bacteria 624
238 Ga0495642_0431866 3300046528 Bacteria 582
239 Ga0495652_0237154 3300046529 Bacteria 1360
240 Ga0495665_0003149 3300046531 Bacteria 8928
241 Ga0495640_0345086 3300046533 Bacteria 920
242 Ga0495586_0006261 3300046535 Bacteria 6360
243 Ga0495621_0046639 3300046539 Bacteria 1538
244 Ga0495667_0100347 3300046559 Bacteria 1873
245 Ga0495667_0508366 3300046559 Bacteria 754
246 Ga0495634_0003272 3300046642 Bacteria 13071
247 Ga0495634_0374152 3300046642 Bacteria 850
248 Ga0495635_0223536 3300046663 Bacteria 1273
249 Ga0495635_0324113 3300046663 Bacteria 1030
250 Ga0495635_0728230 3300046663 Bacteria 642
251 Ga0495588_0192570 3300046674 Bacteria 1077
252 Ga0495657_0133749 3300046675 Bacteria 1551
253 Ga0495599_0692719 3300046678 Unclassified 588
254 Ga0495647_0366253 3300046681 Bacteria 658
255 Ga0495658_0047569 3300046683 Bacteria 2416
256 Ga0495658_0126773 3300046683 Bacteria 1550
257 Ga0495658_0605524 3300046683 Bacteria 702
258 Ga0495658_0755749 3300046683 Bacteria 623
259 Ga0495613_0001826 3300046689 Bacteria 16174
260 Ga0495613_0528723 3300046689 Bacteria 791
261 Ga0495624_0255311 3300046690 Unclassified 1060
262 Ga0495624_0528348 3300046690 Unclassified 705
263 Ga0495600_0401211 3300046809 Bacteria 853
264 Ga0495581_0082719 3300047315 Bacteria 1859
265 Ga0495581_0315329 3300047315 Bacteria 914
266 Ga0495604_0333304 3300047317 Bacteria 1012
267 Ga0495674_0337513 3300047319 Unclassified 1225
268 Ga0495674_0525508 3300047319 Bacteria 944
269 Ga0495672_0000863 3300047320 Bacteria 31977
270 Ga0495676_0088751 3300047321 Bacteria 2318
271 Ga0495676_0166400 3300047321 Unclassified 1555
272 Ga0495680_0074412 3300047322 Bacteria 2580
273 Ga0495680_0496984 3300047322 Bacteria 828
274 Ga0495680_0630927 3300047322 Bacteria 714
275 Ga0495684_0460424 3300047471 Unclassified 882
276 Ga0495614_0087345 3300048089 Bacteria 1354
277 Ga0496101_1306795 3300048904 Unclassified 567
278 Ga0496104_0327825 3300048907 Bacteria 1444
279 Ga0496104_1620496 3300048907 Bacteria 550
280 Ga0496105_0095205 3300048908 Bacteria 2460
281 Ga0496108_0014542 3300048911 Bacteria 6426
282 Ga0496108_0376746 3300048911 Bacteria 1239
283 Ga0496108_1429783 3300048911 Bacteria 578
284 Ga0496109_0103618 3300048912 Bacteria 2641
285 Ga0496109_0206328 3300048912 Bacteria 1848
286 Ga0496109_1351522 3300048912 Bacteria 648
287 Ga0496110_0529081 3300048913 Bacteria 1072
288 Ga0496110_1096876 3300048913 Bacteria 704
289 Ga0496110_1234986 3300048913 Unclassified 656
290 Ga0496110_1781216 3300048913 Bacteria 526
291 Ga0496111_0590025 3300048914 Bacteria 814
292 Ga0496112_0002519 3300048915 Bacteria 14786
293 Ga0496112_0138847 3300048915 Bacteria 2400
294 Ga0496112_0827676 3300048915 Bacteria 850
295 Ga0496112_1068001 3300048915 Bacteria 726
296 Ga0496114_0875297 3300048917 Unclassified 779
297 Ga0496115_0607588 3300048918 Unclassified 869
298 Ga0496115_1078908 3300048918 Bacteria 610
299 Ga0501306_001049 3300049127 Bacteria 2455
300 Ga0501308_011685 3300049128 Bacteria 993
301 Ga0501310_003371 3300049130 Bacteria 1558
302 Ga0501305_007206 3300049161 Bacteria 1405
303 Ga0501311_014324 3300049527 Bacteria 1011
304 Ga0501316_003325 3300049532 Bacteria 1553
305 Ga0501319_000435 3300049535 Bacteria 1978
306 Ga0501320_000344 3300049536 Bacteria 2580
307 Ga0501321_001547 3300049537 Bacteria 1855
308 Ga0501322_002713 3300049538 Bacteria 1104
309 Ga0501323_000700 3300049539 Bacteria 2624
310 Ga0501324_001597 3300049540 Bacteria 1534
311 Ga0501325_000545 3300049541 Bacteria 1862
312 Ga0501329_03298 3300049545 Bacteria 815
313 Ga0501032_0240028 3300049569 Bacteria 1177
314 Ga0501033_0461842 3300049570 Bacteria 881
315 Ga0501033_0600219 3300049570 Unclassified 755
316 Ga0501034_0013210 3300049571 Bacteria 8508
317 Ga0501034_0749408 3300049571 Bacteria 872
318 Ga0501036_0647855 3300049572 Bacteria 875
319 Ga0501037_0002771 3300049573 Bacteria 12680
320 Ga0501038_0321711 3300049574 Bacteria 1210
321 Ga0501039_0326468 3300049575 Unclassified 1206
322 Ga0501040_0067447 3300049576 Bacteria 2466
323 Ga0501041_0556284 3300049577 Bacteria 731
324 Ga0501042_0681741 3300049578 Bacteria 747
325 Ga0501042_0756376 3300049578 Bacteria 707
326 Ga0501043_0319226 3300049579 Unclassified 1184
327 Ga0501043_0751823 3300049579 Bacteria 709
328 Ga0501046_0175236 3300049580 Bacteria 1607
329 Ga0501047_0660618 3300049581 Bacteria 864
330 Ga0501048_0773064 3300049582 Bacteria 690
331 Ga0501067_0669417 3300049583 Bacteria 583
332 Ga0501068_0001476 3300049584 Bacteria 12515
333 Ga0501068_0058321 3300049584 Bacteria 2342
334 Ga0501068_0195224 3300049584 Unclassified 1283
335 Ga0501071_0200683 3300049587 Bacteria 1498
336 Ga0501071_0373237 3300049587 Bacteria 1087
337 Ga0501072_0089504 3300049588 Bacteria 2443
338 Ga0501072_0152233 3300049588 Unclassified 1844
339 Ga0501072_0653135 3300049588 Bacteria 828
340 Ga0501073_0739655 3300049589 Bacteria 678
341 Ga0501074_0298610 3300049590 Bacteria 1144
342 Ga0501075_0105863 3300049591 Bacteria 2138
343 Ga0501076_0435179 3300049592 Bacteria 1080
344 Ga0501076_0464363 3300049592 Bacteria 1042
345 Ga0501076_1428903 3300049592 Bacteria 568
346 Ga0501077_0654991 3300049593 Bacteria 675
347 Ga0501080_0016590 3300049742 Bacteria 6804
348 Ga0501081_0357983 3300049743 Bacteria 1076
349 Ga0501081_1147900 3300049743 Bacteria 588
350 Ga0501083_0399045 3300049744 Bacteria 895
351 Ga0501083_0436013 3300049744 Bacteria 853
352 Ga0501083_0446496 3300049744 Bacteria 842
353 Ga0501035_0104092 3300049822 Bacteria 2489
354 Ga0501035_0965460 3300049822 Bacteria 672
355 Ga0501044_0045897 3300049823 Bacteria 4525
356 nmdc:mga03683_38346_c2 3300050489 Bacteria 1100
357 nmdc:mga03n38_148918_c1 3300050490 Bacteria 1176
358 nmdc:mga03n38_4842_c1 3300050490 Bacteria 4511
359 nmdc:mga00v17_180346_c1 3300050491 Bacteria 1363
360 nmdc:mga00v17_337129_c1 3300050491 Bacteria 980
361 nmdc:mga0yw44_1075107_c1 3300050492 Unclassified 544
362 nmdc:mga0yw44_300548_c1 3300050492 Bacteria 1075
363 nmdc:mga0yw44_599460_c1 3300050492 Bacteria 748
364 nmdc:mga06z11_141316_c1 3300050494 Bacteria 1361
365 nmdc:mga06z11_39392_c1 3300050494 Unclassified 2351
366 nmdc:mga06z11_506191_c1 3300050494 Bacteria 732
367 nmdc:mga04h51_248212_c1 3300050495 Bacteria 712
368 nmdc:mga04h51_432399_c1 3300050495 Bacteria 555
369 nmdc:mga05p37_118939_c1 3300050507 Bacteria 3246
370 nmdc:mga05p37_96532_c1 3300050507 Bacteria 3642
371 nmdc:mga0qj67_676570_c1 3300050509 Bacteria 822
372 nmdc:mga06r32_208379_c1 3300050510 Bacteria 1943
373 nmdc:mga06r32_234283_c1 3300050510 Bacteria 1824
374 nmdc:mga08y16_581625_c1 3300050511 Bacteria 1130
375 nmdc:mga0n895_144218_c1 3300050512 Bacteria 2410
376 nmdc:mga0n895_69759_c1 3300050512 Bacteria 3483
377 nmdc:mga0rr50_438891_c1 3300050513 Bacteria 1106
378 nmdc:mga08x19_965233_c1 3300050514 Bacteria 605
379 nmdc:mga0a205_139068_c1 3300050515 Bacteria 2329
380 Ga0495601_0217250 3300053077 Bacteria 1249
381 Ga0495601_0515055 3300053077 Bacteria 771
382 Ga0495601_0616189 3300053077 Unclassified 696
383 Ga0495595_0285665 3300053084 Unclassified 829
384 Ga0495619_0035995 3300053085 Bacteria 3222
385 Ga0495619_0040155 3300053085 Bacteria 3058
386 Ga0495619_0043723 3300053085 Bacteria 2938
387 Ga0495619_0205999 3300053085 Bacteria 1362
388 Ga0500566_0434225 3300053094 Bacteria 579
389 Ga0500616_0009951 3300053153 Bacteria 5720
390 Ga0501084_0002330 3300054114 Bacteria 15255
391 Ga0501082_0091343 3300060353 Bacteria 2629
392 Ga0501082_0365742 3300060353 Unclassified 1258
393 Ga0530510_0014621 3300061734 Bacteria 5540
394 Ga0530510_0618282 3300061734 Bacteria 824
395 Ga0530510_0760929 3300061734 Bacteria 739
396 2739202687 2738543005 Bacteria 5278128
397 2739236717 2738543011 Bacteria 5731169
398 2739366602 2738543034 Bacteria 6084756
399 2842890679 2842888712 Bacteria 4279094
400 2889305610 2889300758 Bacteria 5690814
401 2904767516 2904765812 Bacteria 5369154
402 2904774861 2904770941 Bacteria 5580202
403 2908813159 2908811453 Bacteria 5478616
404 2919423864 2919420072 Bacteria 5390363
405 2919436684 2919432681 Bacteria 5390474
406 2928143094 2928142448 Bacteria 5288925
407 2939743745 2939743619 Bacteria 5762299
408 2974316071 2974315732 Bacteria 4602776
409 2984524233 2984523437 Bacteria 4508481
410 Ga0075362_10153688
411 Ga0058863_11578438
412 Ga0058861_11298209
413 Ga0058862_12732099
414 Ga0070683_100395524
415 Ga0068869_100937370
416 Ga0070687_100956647
417 Ga0070661_100611360
418 Ga0070692_10720512
419 Ga0070668_101721161
420 Ga0070675_102100904
421 Ga0070674_101425612
422 Ga0070673_101675567
423 Ga0070659_100350652
424 Ga0070659_101940051
425 Ga0070667_100983797
426 Ga0070709_10855499
427 Ga0070714_101195370
428 Ga0070701_10504217
429 Ga0070705_100810032
430 Ga0070708_100192083
431 Ga0070678_100481686
432 Ga0070681_10031624
433 Ga0070681_10068444
434 Ga0070706_100029591
435 Ga0070707_100176111
436 Ga0070698_100425503
437 Ga0070699_100907822
438 Ga0070697_101731839
439 Ga0070693_100212102
440 Ga0070665_100557586
441 Ga0070704_100140002
442 Ga0068856_100098391
443 Ga0068864_100612245
444 Ga0068870_10581779
445 Ga0068858_101387951
446 Ga0081455_10073233
447 Ga0075365_10381980
448 Ga0075368_10351169
449 Ga0075363_100012532
450 Ga0075363_100074596
451 Ga0075364_10004433
452 Ga0075364_10212777
453 Ga0075362_10095080
454 Ga0075367_10043814
455 Ga0075367_10066242
456 Ga0075367_10233904
457 Ga0075370_10030601
458 Ga0075370_10521201
459 Ga0075428_101140503
460 Ga0075430_100683891
461 Ga0075430_100686678
462 Ga0075433_10048764
463 Ga0075434_100351756
464 Ga0075434_101509719
465 Ga0075436_100204604
466 Ga0075435_100027758
467 Ga0075435_100367313
468 Ga0105240_10233448
469 Ga0105240_11563343
470 Ga0111539_12171115
471 Ga0105245_10182387
472 Ga0105245_10332084
473 Ga0105245_10414341
474 Ga0105245_11297970
475 Ga0105247_11376987
476 Ga0105247_11517112
477 Ga0114129_10127635
478 Ga0114129_12523576
479 Ga0114129_12793840
480 Ga0105243_10001021
481 Ga0105243_10243080
482 Ga0105241_11335662
483 Ga0105242_10110983
484 Ga0105242_11086101
485 Ga0105242_11956629
486 Ga0105242_12453096
487 Ga0105238_10917096
488 Ga0105249_11695553
489 Ga0105239_11878244
490 Ga0105246_10736741
491 Ga0157374_11027170
492 Ga0157378_10206902
493 Ga0157378_10210461
494 Ga0157378_11481220
495 Ga0163162_10828316
496 Ga0157372_11412784
497 Ga0157372_11991807
498 Ga0157375_10239619
499 Ga0157375_10337983
500 Ga0157375_10653175
501 Ga0163163_10318784
502 Ga0163163_11215710
503 Ga0157380_10340258
504 Ga0157380_12603736
505 Ga0157380_13366400
506 Ga0157377_11330631
507 Ga0157379_10719350
508 Ga0157376_11175003
509 Ga0197907_10876372
510 Ga0206356_11268605
511 Ga0206351_10357656
512 Ga0213873_10019624
513 Ga0213873_10033169
514 Ga0213876_10009909
515 Ga0213871_10077725
516 Ga0207699_10610663
517 Ga0207643_10906774
518 Ga0207684_10043579
519 Ga0207654_10917066
520 Ga0207707_10454876
521 Ga0207707_10950645
522 Ga0207662_10371098
523 Ga0207657_10307790
524 Ga0207649_10262393
525 Ga0207652_10677025
526 Ga0207646_10372923
527 Ga0207646_10407020
528 Ga0207694_10711400
529 Ga0207687_10255243
530 Ga0207687_10280243
531 Ga0207700_10201449
532 Ga0207664_10611885
533 Ga0207664_10952170
534 Ga0207690_10438343
535 Ga0207690_11242561
536 Ga0207686_10161051
537 Ga0207686_11110748
538 Ga0207709_10004533
539 Ga0207709_10187472
540 Ga0207669_10930967
541 Ga0207665_10798869
542 Ga0207691_10957229
543 Ga0207712_11650373
544 Ga0207677_10668338
545 Ga0207703_10144374
546 Ga0207678_10159868
547 Ga0207708_10293799
548 Ga0207708_11109900
549 Ga0207708_11515699
550 Ga0207702_10036173
551 Ga0207641_10702954
552 Ga0207641_11378635
553 Ga0207648_10676761
554 Ga0207675_101014738
555 Ga0207683_10312783
556 Ga0268265_11756207
557 Ga0265334_10036861
558 Ga0265338_10000152
559 Ga0265338_10188266
560 Ga0265338_10389670
561 Ga0265325_10003864
562 Ga0265340_10121301
563 Ga0265339_10024080
564 Ga0265339_10601553
565 Ga0265327_10000002
566 Ga0265327_10014884
567 Ga0265327_10028827
568 Ga0265327_10081003
569 Ga0307408_100721758
570 Ga0265313_10004732
571 Ga0265314_10060379
572 Ga0265314_10106941
573 Ga0265314_10408927
574 Ga0307407_11014950
575 Ga0307409_100544915
576 Ga0307416_102267056
577 Ga0307416_102785290
578 Ga0307416_103314382
579 Ga0373926_0215340
580 Ga0373923_0700220
581 Ga0373936_0512380
582 Ga0373960_0355209
583 Ga0373943_0081597
584 Ga0373943_0379436
585 Ga0373955_0402014
586 Ga0373924_0114880
587 Ga0373935_0051456
588 Ga0373927_0687674
589 Ga0373947_0115646
590 Ga0373947_0888682
591 Ga0373937_0111986
592 Ga0373937_0638098
593 Ga0373925_0221526
594 Ga0373925_0965113
595 Ga0436365_0529345
596 Ga0436365_0556156
597 Ga0436365_1112120
598 Ga0436365_1331325
599 Ga0436365_1919244
600 Ga0436365_1920334
601 Ga0436360_0305687
602 Ga0436361_0211735
603 Ga0436363_0894620
604 Ga0436363_1357321
605 Ga0436362_0036147
606 Ga0436362_0128541
607 Ga0436362_0894920
608 Ga0436362_0906280
609 Ga0451789_1262008
610 Ga0451807_0708585
611 Ga0451851_1137982
612 Ga0451853_2422763
613 Ga0466972_0161404
614 Ga0466966_0020402
615 Ga0466968_0267821
616 Ga0466959_0982854
617 Ga0466967_0113902
618 Ga0466967_0262109
619 Ga0466967_1057272
620 Ga0466967_2414855
621 Ga0495592_0131920
622 Ga0495592_0778377
623 Ga0495603_0644511
624 Ga0495629_0103875
625 Ga0495629_0123361
626 Ga0495641_0493918
627 Ga0495651_0390312
628 Ga0495651_0861770
629 Ga0495653_0248759
630 Ga0495653_0363661
631 Ga0495653_0564224
632 Ga0495580_0636903
633 Ga0495580_0829573
634 Ga0495582_0304024
635 Ga0495639_0360718
636 Ga0495662_0210366
637 Ga0495584_0487388
638 Ga0495608_0070105
639 Ga0495618_0643780
640 Ga0495628_1202604
641 Ga0495630_0016588
642 Ga0495630_0109653
643 Ga0495630_0697571
644 Ga0495663_0131008
645 Ga0495666_0108640
646 Ga0495666_0392624
647 Ga0495642_0431866
648 Ga0495652_0237154
649 Ga0495665_0003149
650 Ga0495640_0345086
651 Ga0495586_0006261
652 Ga0495621_0046639
653 Ga0495667_0100347
654 Ga0495667_0508366
655 Ga0495634_0003272
656 Ga0495634_0374152
657 Ga0495635_0223536
658 Ga0495635_0324113
659 Ga0495635_0728230
660 Ga0495588_0192570
661 Ga0495657_0133749
662 Ga0495599_0692719
663 Ga0495647_0366253
664 Ga0495658_0047569
665 Ga0495658_0126773
666 Ga0495658_0605524
667 Ga0495658_0755749
668 Ga0495613_0001826
669 Ga0495613_0528723
670 Ga0495624_0255311
671 Ga0495624_0528348
672 Ga0495600_0401211
673 Ga0495581_0082719
674 Ga0495581_0315329
675 Ga0495604_0333304
676 Ga0495674_0337513
677 Ga0495674_0525508
678 Ga0495672_0000863
679 Ga0495676_0088751
680 Ga0495676_0166400
681 Ga0495680_0074412
682 Ga0495680_0496984
683 Ga0495680_0630927
684 Ga0495684_0460424
685 Ga0495614_0087345
686 Ga0496101_1306795
687 Ga0496104_0327825
688 Ga0496104_1620496
689 Ga0496105_0095205
690 Ga0496108_0014542
691 Ga0496108_0376746
692 Ga0496108_1429783
693 Ga0496109_0103618
694 Ga0496109_0206328
695 Ga0496109_1351522
696 Ga0496110_0529081
697 Ga0496110_1096876
698 Ga0496110_1234986
699 Ga0496110_1781216
700 Ga0496111_0590025
701 Ga0496112_0002519
702 Ga0496112_0138847
703 Ga0496112_0827676
704 Ga0496112_1068001
705 Ga0496114_0875297
706 Ga0496115_0607588
707 Ga0496115_1078908
708 Ga0501306_001049
709 Ga0501308_011685
710 Ga0501310_003371
711 Ga0501305_007206
712 Ga0501311_014324
713 Ga0501316_003325
714 Ga0501319_000435
715 Ga0501320_000344
716 Ga0501321_001547
717 Ga0501322_002713
718 Ga0501323_000700
719 Ga0501324_001597
720 Ga0501325_000545
721 Ga0501329_03298
722 Ga0501032_0240028
723 Ga0501033_0461842
724 Ga0501033_0600219
725 Ga0501034_0013210
726 Ga0501034_0749408
727 Ga0501036_0647855
728 Ga0501037_0002771
729 Ga0501038_0321711
730 Ga0501039_0326468
731 Ga0501040_0067447
732 Ga0501041_0556284
733 Ga0501042_0681741
734 Ga0501042_0756376
735 Ga0501043_0319226
736 Ga0501043_0751823
737 Ga0501046_0175236
738 Ga0501047_0660618
739 Ga0501048_0773064
740 Ga0501067_0669417
741 Ga0501068_0001476
742 Ga0501068_0058321
743 Ga0501068_0195224
744 Ga0501071_0200683
745 Ga0501071_0373237
746 Ga0501072_0089504
747 Ga0501072_0152233
748 Ga0501072_0653135
749 Ga0501073_0739655
750 Ga0501074_0298610
751 Ga0501075_0105863
752 Ga0501076_0435179
753 Ga0501076_0464363
754 Ga0501076_1428903
755 Ga0501077_0654991
756 Ga0501080_0016590
757 Ga0501081_0357983
758 Ga0501081_1147900
759 Ga0501083_0399045
760 Ga0501083_0436013
761 Ga0501083_0446496
762 Ga0501035_0104092
763 Ga0501035_0965460
764 Ga0501044_0045897
765 nmdc:mga03683_38346_c2
766 nmdc:mga03n38_148918_c1
767 nmdc:mga03n38_4842_c1
768 nmdc:mga00v17_180346_c1
769 nmdc:mga00v17_337129_c1
770 nmdc:mga0yw44_1075107_c1
771 nmdc:mga0yw44_300548_c1
772 nmdc:mga0yw44_599460_c1
773 nmdc:mga06z11_141316_c1
774 nmdc:mga06z11_39392_c1
775 nmdc:mga06z11_506191_c1
776 nmdc:mga04h51_248212_c1
777 nmdc:mga04h51_432399_c1
778 nmdc:mga05p37_118939_c1
779 nmdc:mga05p37_96532_c1
780 nmdc:mga0qj67_676570_c1
781 nmdc:mga06r32_208379_c1
782 nmdc:mga06r32_234283_c1
783 nmdc:mga08y16_581625_c1
784 nmdc:mga0n895_144218_c1
785 nmdc:mga0n895_69759_c1
786 nmdc:mga0rr50_438891_c1
787 nmdc:mga08x19_965233_c1
788 nmdc:mga0a205_139068_c1
789 Ga0495601_0217250
790 Ga0495601_0515055
791 Ga0495601_0616189
792 Ga0495595_0285665
793 Ga0495619_0035995
794 Ga0495619_0040155
795 Ga0495619_0043723
796 Ga0495619_0205999
797 Ga0500566_0434225
798 Ga0500616_0009951
799 Ga0501084_0002330
800 Ga0501082_0091343
801 Ga0501082_0365742
802 Ga0530510_0014621
803 Ga0530510_0618282
804 Ga0530510_0760929
805 2739202687
806 2739236717
807 2739366602
808 2842890679
809 2889305610
810 2904767516
811 2904774861
812 2908813159
813 2919423864
814 2919436684
815 2928143094
816 2939743745
817 2974316071
818 2984524233

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

7

128

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cpg-assembly1.cif.gz_B r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form 0.8829 5 142
1iq6-assembly1.cif.gz_A (r)-hydratase from a. caviae involved in pha biosynthesis 0.8626 10 140
4w78-assembly1.cif.gz_F crystal structure of the chsh1-chsh2 complex from mycobacterium tuberculosis 0.8467 11 139
1iq6-assembly1.cif.gz_A (r)-hydratase from a. caviae involved in pha biosynthesis 0.845 10 140
5cpg-assembly1.cif.gz_B r-hydratase phaj1 from pseudomonas aeruginosa in the unliganded form 0.843 5 142
ID Description Score Start End Superfamily
5cpgB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8829 5 142 3.10.129.10
3cjyA00 Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain 0.8711 86 138 2.40.160.210
1iq6A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8626 10 140 3.10.129.10
af_Q54LF5_180_274_2.60.40.290 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8553 98 123 2.60.40.290
4w78F00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8467 11 139 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A3A4Q1C9-F1-model_v4 Dihydroxy-acid dehydratase 0.948 1 142
AF-A0A351ENF3-F1-model_v4 Acyl dehydratase 0.9443 38 139
AF-A0A3A4Q1C9-F1-model_v4 Dihydroxy-acid dehydratase 0.9416 1 142
AF-A0A1V5GX27-F1-model_v4 Bifunctional enoyl-CoA hydratase/phosphate acetyltransferase 0.9409 4 142 GO:0016740
AF-A0A1Q3T7S8-F1-model_v4 Dehydratase 0.9406 1 142

Map