F436788

General Info

Members Datasets Scaffolds Average Seq Length
408 209 408 183

Family's Representative Sequence

Representative Sequence 3300041451|Ga0451791_0388950|Ga0451791_0388950_275_883
Length 202
Sequence MRAAVGAELSKYLIRLRSLMPDPSNMSAPSSQDEKTEVLPETAVQLVEMERLKTELAGAEERAKNHWEQYLRALADVDNVRKRAAKDLESARQFAVEKFAQELVGVKDSLELGIQNSSKADVASLIEGQQATLRLLAKAFEKAQIEEINPEGQAFNPELHEAMMAQPSDAAPNTVLTVIQRGYQLNGRLLRPARVVVSAARN

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
150 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
151 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
152 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
153 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
154 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
155 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
156 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
157 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
158 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
159 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
162 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
163 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
164 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
165 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
166 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
167 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
168 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
169 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
170 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
171 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
174 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
193 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
194 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
195 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
196 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
197 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
198 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
199 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
200 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
201 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
202 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
203 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
204 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
205 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
206 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
207 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.62
Nodule 0
Rhizoplane 4.17
Rhizosphere 85.29
Stem 0
Stem Tuber 0
Unclassified 3.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10004078 3300003203 Bacteria 6830
2 rootL2_10022271 3300003322 Bacteria 2135
3 rootL2_10136634 3300003322 Bacteria 3025
4 JGI25405J52794_10098329 3300003911 Bacteria 651
5 Ga0070658_10779035 3300005327 Bacteria 831
6 Ga0070676_10457414 3300005328 Bacteria 899
7 Ga0070676_10655095 3300005328 Bacteria 763
8 Ga0070683_100739023 3300005329 Bacteria 943
9 Ga0070690_100017084 3300005330 Bacteria 4356
10 Ga0070690_100421095 3300005330 Bacteria 985
11 Ga0070670_100061049 3300005331 Bacteria 3236
12 Ga0070677_10004338 3300005333 Bacteria 4621
13 Ga0068869_100186805 3300005334 Bacteria 1627
14 Ga0068869_100276285 3300005334 Bacteria 1350
15 Ga0070666_10046057 3300005335 Bacteria 2925
16 Ga0070682_100060571 3300005337 Bacteria 2394
17 Ga0070682_100122889 3300005337 Bacteria 1745
18 Ga0070682_100150702 3300005337 Bacteria 1595
19 Ga0070682_100238366 3300005337 Bacteria 1304
20 Ga0070682_100419164 3300005337 Bacteria 1017
21 Ga0070682_100450179 3300005337 Bacteria 986
22 Ga0068868_100797699 3300005338 Bacteria 852
23 Ga0068868_100828005 3300005338 Bacteria 837
24 Ga0070660_100924318 3300005339 Unclassified 736
25 Ga0070689_100135884 3300005340 Bacteria 1974
26 Ga0070689_100216778 3300005340 Bacteria 1569
27 Ga0070692_10542772 3300005345 Unclassified 760
28 Ga0070668_100150202 3300005347 Bacteria 1883
29 Ga0070668_100890178 3300005347 Bacteria 795
30 Ga0070669_100154153 3300005353 Bacteria 1780
31 Ga0070675_100008631 3300005354 Bacteria 7914
32 Ga0070675_100097832 3300005354 Bacteria 2467
33 Ga0070675_100230743 3300005354 Bacteria 1615
34 Ga0070671_100224262 3300005355 Bacteria 1595
35 Ga0070671_100589116 3300005355 Bacteria 961
36 Ga0070671_100700185 3300005355 Bacteria 879
37 Ga0070674_100027458 3300005356 Bacteria 3730
38 Ga0070674_100294500 3300005356 Bacteria 1291
39 Ga0070674_100487257 3300005356 Bacteria 1024
40 Ga0070674_101082166 3300005356 Bacteria 707
41 Ga0070673_100056936 3300005364 Bacteria 3087
42 Ga0070673_100296814 3300005364 Bacteria 1422
43 Ga0070688_100061524 3300005365 Bacteria 2374
44 Ga0070688_100113865 3300005365 Bacteria 1803
45 Ga0070688_100237685 3300005365 Bacteria 1291
46 Ga0070688_100245150 3300005365 Bacteria 1274
47 Ga0070659_100661819 3300005366 Bacteria 901
48 Ga0070667_100000176 3300005367 Bacteria 79346
49 Ga0070667_100556185 3300005367 Bacteria 1055
50 Ga0070701_10007542 3300005438 Bacteria 4655
51 Ga0070701_10104632 3300005438 Bacteria 1573
52 Ga0070701_10747688 3300005438 Unclassified 662
53 Ga0070705_100258337 3300005440 Bacteria 1227
54 Ga0070700_100066679 3300005441 Bacteria 2285
55 Ga0070700_100096534 3300005441 Bacteria 1939
56 Ga0070700_100097691 3300005441 Bacteria 1929
57 Ga0070700_100476109 3300005441 Bacteria 956
58 Ga0070694_100259986 3300005444 Bacteria 1316
59 Ga0070663_100107374 3300005455 Bacteria 2092
60 Ga0070663_100731022 3300005455 Bacteria 844
61 Ga0070678_100038470 3300005456 Bacteria 3368
62 Ga0070662_100267720 3300005457 Bacteria 1379
63 Ga0070681_10028459 3300005458 Bacteria 5619
64 Ga0068867_100082564 3300005459 Bacteria 2424
65 Ga0068867_100294371 3300005459 Bacteria 1336
66 Ga0068867_100415254 3300005459 Bacteria 1138
67 Ga0070685_10117258 3300005466 Bacteria 1649
68 Ga0070685_10448206 3300005466 Bacteria 904
69 Ga0070685_10518801 3300005466 Bacteria 846
70 Ga0070679_100017664 3300005530 Bacteria 6906
71 Ga0070679_100107875 3300005530 Bacteria 2770
72 Ga0070679_100188625 3300005530 Bacteria 2031
73 Ga0068853_100235854 3300005539 Bacteria 1675
74 Ga0068853_100288012 3300005539 Bacteria 1516
75 Ga0070672_100009398 3300005543 Bacteria 6739
76 Ga0070672_100050470 3300005543 Bacteria 3240
77 Ga0070672_100131242 3300005543 Bacteria 2059
78 Ga0070672_100223884 3300005543 Bacteria 1578
79 Ga0070672_100244305 3300005543 Bacteria 1511
80 Ga0070672_100911650 3300005543 Unclassified 777
81 Ga0070672_100989170 3300005543 Bacteria 745
82 Ga0070686_100077514 3300005544 Bacteria 2192
83 Ga0070686_100126445 3300005544 Bacteria 1762
84 Ga0070686_100345963 3300005544 Bacteria 1115
85 Ga0070695_100084847 3300005545 Bacteria 2102
86 Ga0070695_100348949 3300005545 Bacteria 1108
87 Ga0070696_100206770 3300005546 Bacteria 1468
88 Ga0070693_100205852 3300005547 Bacteria 1281
89 Ga0070693_100211155 3300005547 Bacteria 1266
90 Ga0070693_101052624 3300005547 Unclassified 618
91 Ga0070665_100009043 3300005548 Bacteria 10091
92 Ga0070665_100016294 3300005548 Bacteria 7454
93 Ga0070665_100626509 3300005548 Bacteria 1089
94 Ga0070665_100645966 3300005548 Bacteria 1071
95 Ga0068855_100002113 3300005563 Bacteria 24577
96 Ga0068855_100965140 3300005563 Bacteria 897
97 Ga0070664_100068541 3300005564 Bacteria 3033
98 Ga0070664_100143272 3300005564 Bacteria 2106
99 Ga0070664_100250555 3300005564 Bacteria 1592
100 Ga0068857_100272860 3300005577 Bacteria 1555
101 Ga0068857_100576410 3300005577 Bacteria 1062
102 Ga0068857_100824575 3300005577 Bacteria 887
103 Ga0068854_100342863 3300005578 Bacteria 1221
104 Ga0068856_100385738 3300005614 Bacteria 1421
105 Ga0070702_100082365 3300005615 Bacteria 1930
106 Ga0070702_100161604 3300005615 Bacteria 1448
107 Ga0068859_100055139 3300005617 Bacteria 4000
108 Ga0068864_100077449 3300005618 Bacteria 2907
109 Ga0068864_100398899 3300005618 Bacteria 1307
110 Ga0068864_100841570 3300005618 Bacteria 904
111 Ga0068864_101870477 3300005618 Bacteria 606
112 Ga0068866_10477033 3300005718 Bacteria 821
113 Ga0068861_100041772 3300005719 Bacteria 3435
114 Ga0068861_100109577 3300005719 Bacteria 2210
115 Ga0068861_100232065 3300005719 Bacteria 1566
116 Ga0068861_100248209 3300005719 Bacteria 1517
117 Ga0068861_100610368 3300005719 Bacteria 1003
118 Ga0068861_101005583 3300005719 Bacteria 796
119 Ga0068870_10003318 3300005840 Bacteria 6802
120 Ga0068870_10090833 3300005840 Bacteria 1707
121 Ga0068863_100042140 3300005841 Bacteria 4337
122 Ga0068863_100538141 3300005841 Bacteria 1152
123 Ga0068858_100126003 3300005842 Bacteria 2398
124 Ga0068858_101296285 3300005842 Bacteria 717
125 Ga0068860_100064276 3300005843 Bacteria 3486
126 Ga0068860_100547029 3300005843 Bacteria 1160
127 Ga0068860_100894818 3300005843 Unclassified 903
128 Ga0068862_100022839 3300005844 Bacteria 5237
129 Ga0068862_100052442 3300005844 Bacteria 3490
130 Ga0068862_100177438 3300005844 Bacteria 1910
131 Ga0068862_100539362 3300005844 Bacteria 1113
132 Ga0068862_100579694 3300005844 Bacteria 1074
133 Ga0068862_100587506 3300005844 Bacteria 1068
134 Ga0068862_100985805 3300005844 Unclassified 833
135 Ga0081455_10000043 3300005937 Bacteria 132283
136 Ga0081539_10000046 3300005985 Bacteria 275677
137 Ga0075364_10368643 3300006051 Bacteria 979
138 Ga0075366_10272255 3300006195 Bacteria 1034
139 Ga0075366_10594007 3300006195 Unclassified 686
140 Ga0097621_100136360 3300006237 Bacteria 2093
141 Ga0097621_100956915 3300006237 Bacteria 800
142 Ga0068871_100163527 3300006358 Bacteria 1904
143 Ga0068871_100690489 3300006358 Bacteria 934
144 Ga0068871_100809597 3300006358 Bacteria 864
145 Ga0075430_100703452 3300006846 Bacteria 833
146 Ga0075430_100832018 3300006846 Unclassified 761
147 Ga0097620_100055139 3300006931 Bacteria 4000
148 Ga0105240_10087755 3300009093 Bacteria 3808
149 Ga0105240_10220678 3300009093 Bacteria 2209
150 Ga0105240_10224903 3300009093 Bacteria 2184
151 Ga0111539_11292271 3300009094 Bacteria 847
152 Ga0111539_11316361 3300009094 Bacteria 838
153 Ga0105247_10053717 3300009101 Bacteria 2486
154 Ga0105241_10090338 3300009174 Bacteria 2415
155 Ga0105241_10318402 3300009174 Bacteria 1340
156 Ga0105242_10081784 3300009176 Bacteria 2701
157 Ga0105248_10021656 3300009177 Bacteria 7120
158 Ga0105249_10396992 3300009553 Bacteria 1409
159 Ga0105249_10481686 3300009553 Bacteria 1284
160 Ga0105249_11479225 3300009553 Bacteria 751
161 Ga0157370_10563248 3300013104 Bacteria 1044
162 Ga0157370_10601993 3300013104 Bacteria 1006
163 Ga0157369_10195482 3300013105 Bacteria 2124
164 Ga0157369_10502190 3300013105 Bacteria 1255
165 Ga0157374_10162161 3300013296 Bacteria 2177
166 Ga0157378_10350234 3300013297 Bacteria 1442
167 Ga0157378_10735128 3300013297 Bacteria 1008
168 Ga0163162_10236403 3300013306 Bacteria 1957
169 Ga0157375_10090106 3300013308 Bacteria 3125
170 Ga0157375_10164058 3300013308 Bacteria 2365
171 Ga0163163_10105747 3300014325 Bacteria 2840
172 Ga0163163_10210142 3300014325 Bacteria 1995
173 Ga0163163_10747095 3300014325 Bacteria 1042
174 Ga0157380_10039703 3300014326 Bacteria 3662
175 Ga0157380_10110967 3300014326 Bacteria 2305
176 Ga0157380_10228342 3300014326 Bacteria 1670
177 Ga0157380_10254413 3300014326 Bacteria 1592
178 Ga0157380_10319309 3300014326 Bacteria 1439
179 Ga0157380_10660759 3300014326 Bacteria 1044
180 Ga0157380_10672488 3300014326 Bacteria 1036
181 Ga0157380_10824981 3300014326 Bacteria 947
182 Ga0157379_10073673 3300014968 Bacteria 3057
183 Ga0157379_10288761 3300014968 Bacteria 1493
184 Ga0157376_10114432 3300014969 Bacteria 2380
185 Ga0163161_10183874 3300017792 Bacteria 1604
186 Ga0163161_11000430 3300017792 Unclassified 714
187 Ga0206353_11631158 3300020082 Bacteria 713
188 Ga0224712_10234086 3300022467 Bacteria 844
189 Ga0207682_10002366 3300025893 Bacteria 8494
190 Ga0207682_10013765 3300025893 Bacteria 3149
191 Ga0207642_10211627 3300025899 Bacteria 1078
192 Ga0207642_10325873 3300025899 Bacteria 898
193 Ga0207710_10066273 3300025900 Bacteria 1647
194 Ga0207680_10040110 3300025903 Bacteria 2722
195 Ga0207645_10077546 3300025907 Bacteria 2129
196 Ga0207645_10374648 3300025907 Bacteria 955
197 Ga0207643_10093669 3300025908 Bacteria 1754
198 Ga0207643_10116469 3300025908 Bacteria 1578
199 Ga0207643_10203468 3300025908 Bacteria 1206
200 Ga0207654_10360528 3300025911 Bacteria 1003
201 Ga0207707_10000045 3300025912 Bacteria 122598
202 Ga0207707_10042089 3300025912 Bacteria 3988
203 Ga0207695_10012566 3300025913 Bacteria 10147
204 Ga0207695_10102911 3300025913 Bacteria 2848
205 Ga0207660_10000958 3300025917 Bacteria 19113
206 Ga0207662_10145603 3300025918 Bacteria 1503
207 Ga0207649_10471042 3300025920 Bacteria 951
208 Ga0207649_10544310 3300025920 Bacteria 887
209 Ga0207652_10005918 3300025921 Bacteria 9893
210 Ga0207652_10038374 3300025921 Bacteria 4061
211 Ga0207652_10150658 3300025921 Bacteria 2083
212 Ga0207652_10582934 3300025921 Bacteria 1004
213 Ga0207681_10136591 3300025923 Bacteria 1820
214 Ga0207694_10088383 3300025924 Bacteria 2443
215 Ga0207659_10162525 3300025926 Bacteria 1755
216 Ga0207659_10215956 3300025926 Bacteria 1539
217 Ga0207659_10312457 3300025926 Bacteria 1294
218 Ga0207644_10673207 3300025931 Bacteria 862
219 Ga0207706_10294841 3300025933 Bacteria 1414
220 Ga0207706_10506445 3300025933 Bacteria 1042
221 Ga0207686_10092712 3300025934 Bacteria 1998
222 Ga0207670_10190796 3300025936 Bacteria 1550
223 Ga0207670_10278011 3300025936 Bacteria 1304
224 Ga0207669_10054280 3300025937 Bacteria 2419
225 Ga0207704_10423923 3300025938 Bacteria 1055
226 Ga0207691_10007146 3300025940 Bacteria 10773
227 Ga0207691_10009176 3300025940 Bacteria 9493
228 Ga0207691_10022186 3300025940 Bacteria 5988
229 Ga0207691_10211420 3300025940 Bacteria 1685
230 Ga0207711_10262616 3300025941 Bacteria 1587
231 Ga0207689_10036574 3300025942 Bacteria 4075
232 Ga0207689_10104309 3300025942 Bacteria 2329
233 Ga0207689_10149889 3300025942 Bacteria 1922
234 Ga0207661_10860707 3300025944 Bacteria 835
235 Ga0207679_10061578 3300025945 Bacteria 2793
236 Ga0207679_10597979 3300025945 Bacteria 994
237 Ga0207679_10799447 3300025945 Bacteria 860
238 Ga0207667_10000887 3300025949 Bacteria 38097
239 Ga0207667_10864694 3300025949 Bacteria 898
240 Ga0207712_10761307 3300025961 Bacteria 849
241 Ga0207668_10184514 3300025972 Bacteria 1648
242 Ga0207668_10460776 3300025972 Bacteria 1087
243 Ga0207668_10817278 3300025972 Unclassified 826
244 Ga0207658_10000236 3300025986 Bacteria 58435
245 Ga0207658_10898505 3300025986 Unclassified 806
246 Ga0207677_11050741 3300026023 Unclassified 740
247 Ga0207703_10889327 3300026035 Bacteria 853
248 Ga0207639_10361519 3300026041 Bacteria 1299
249 Ga0207639_10400199 3300026041 Bacteria 1237
250 Ga0207639_10546565 3300026041 Bacteria 1063
251 Ga0207678_10228677 3300026067 Bacteria 1592
252 Ga0207708_10028376 3300026075 Bacteria 4239
253 Ga0207708_10126314 3300026075 Unclassified 1996
254 Ga0207708_10210144 3300026075 Bacteria 1555
255 Ga0207708_10423637 3300026075 Bacteria 1104
256 Ga0207708_10604302 3300026075 Bacteria 929
257 Ga0207702_10598521 3300026078 Bacteria 1082
258 Ga0207641_10013278 3300026088 Bacteria 6757
259 Ga0207641_10272479 3300026088 Bacteria 1588
260 Ga0207641_10865592 3300026088 Bacteria 896
261 Ga0207648_10018003 3300026089 Bacteria 6404
262 Ga0207648_10181872 3300026089 Bacteria 1861
263 Ga0207676_10071814 3300026095 Bacteria 2780
264 Ga0207676_10491475 3300026095 Bacteria 1164
265 Ga0207676_10760646 3300026095 Bacteria 943
266 Ga0207674_10294709 3300026116 Bacteria 1571
267 Ga0207674_10366087 3300026116 Bacteria 1393
268 Ga0207675_100012250 3300026118 Bacteria 8010
269 Ga0207675_100015078 3300026118 Bacteria 7210
270 Ga0207675_100275016 3300026118 Bacteria 1635
271 Ga0207675_100436965 3300026118 Bacteria 1295
272 Ga0207675_100519905 3300026118 Bacteria 1186
273 Ga0207675_100774143 3300026118 Bacteria 972
274 Ga0207683_10406031 3300026121 Bacteria 1254
275 Ga0207683_10406628 3300026121 Bacteria 1253
276 Ga0268266_10131761 3300028379 Bacteria 2236
277 Ga0268266_10683100 3300028379 Bacteria 989
278 Ga0268265_10020321 3300028380 Bacteria 4634
279 Ga0268265_10184547 3300028380 Bacteria 1796
280 Ga0268265_10605335 3300028380 Bacteria 1048
281 Ga0268265_10663932 3300028380 Bacteria 1003
282 Ga0268265_10803455 3300028380 Bacteria 917
283 Ga0268264_11081588 3300028381 Unclassified 810
284 Ga0307515_10012639 3300028794 Bacteria 15860
285 Ga0307515_10269418 3300028794 Bacteria 1426
286 Ga0307515_10386588 3300028794 Bacteria 1030
287 Ga0307513_10037044 3300031456 Bacteria 5432
288 Ga0307513_10071890 3300031456 Bacteria 3608
289 Ga0307513_10085124 3300031456 Bacteria 3245
290 Ga0307513_10105536 3300031456 Bacteria 2826
291 Ga0307509_10009871 3300031507 Bacteria 11810
292 Ga0307509_10088983 3300031507 Bacteria 3168
293 Ga0307509_10500715 3300031507 Bacteria 899
294 Ga0307509_10533882 3300031507 Unclassified 853
295 Ga0307408_100031000 3300031548 Bacteria 3719
296 Ga0307408_100371345 3300031548 Bacteria 1220
297 Ga0307408_100578587 3300031548 Bacteria 995
298 Ga0307408_101495561 3300031548 Unclassified 638
299 Ga0307405_10029249 3300031731 Bacteria 3219
300 Ga0307413_10004180 3300031824 Bacteria 6236
301 Ga0307413_10210307 3300031824 Bacteria 1412
302 Ga0307410_10007402 3300031852 Bacteria 6006
303 Ga0307410_10012046 3300031852 Bacteria 4977
304 Ga0307406_10060544 3300031901 Bacteria 2442
305 Ga0307406_11057890 3300031901 Unclassified 699
306 Ga0307407_10002873 3300031903 Bacteria 6882
307 Ga0307407_10298936 3300031903 Bacteria 1122
308 Ga0307407_10705328 3300031903 Bacteria 760
309 Ga0307412_10294425 3300031911 Bacteria 1280
310 Ga0307409_100007401 3300031995 Bacteria 6565
311 Ga0307409_100008601 3300031995 Bacteria 6209
312 Ga0307409_100047806 3300031995 Bacteria 3251
313 Ga0307416_100325860 3300032002 Bacteria 1541
314 Ga0307416_100346711 3300032002 Bacteria 1501
315 Ga0307416_100365278 3300032002 Bacteria 1467
316 Ga0307411_10013209 3300032005 Bacteria 4545
317 Ga0307415_100175323 3300032126 Bacteria 1676
318 Ga0307415_100326378 3300032126 Bacteria 1282
319 Ga0307415_100352120 3300032126 Bacteria 1240
320 Ga0373954_0074319 3300035118 Bacteria 1618
321 Ga0373955_0116405 3300035172 Bacteria 1550
322 Ga0451787_048931 3300041441 Bacteria 2706
323 Ga0451789_1140445 3300041443 Bacteria 1393
324 Ga0451791_0388950 3300041451 Bacteria 1497
325 Ga0451793_1259970 3300041452 Bacteria 862
326 Ga0451793_1369791 3300041452 Bacteria 1566
327 Ga0451793_1523224 3300041452 Bacteria 2325
328 Ga0451797_0747851 3300041453 Bacteria 1305
329 Ga0451797_0956248 3300041453 Bacteria 1205
330 Ga0451800_0426383 3300041459 Bacteria 2175
331 Ga0451802_0367945 3300041460 Bacteria 4799
332 Ga0451802_2139266 3300041460 Bacteria 1130
333 Ga0451804_0961374 3300041463 Bacteria 878
334 Ga0451807_0235429 3300041486 Bacteria 5584
335 Ga0451807_0309231 3300041486 Unclassified 745
336 Ga0451807_0349479 3300041486 Bacteria 883
337 Ga0451807_2134497 3300041486 Bacteria 821
338 Ga0451833_0264962 3300041491 Bacteria 1209
339 Ga0451837_1285619 3300041494 Bacteria 917
340 Ga0451853_3282110 3300041512 Bacteria 1308
341 Ga0439454_010856 3300042011 Bacteria 1207
342 Ga0450911_030735 3300042115 Bacteria 696
343 Ga0466972_0048879 3300044658 Bacteria 2043
344 Ga0466960_0672965 3300044901 Bacteria 619
345 Ga0495590_0000646 3300046457 Bacteria 16170
346 Ga0495590_0191326 3300046457 Unclassified 750
347 Ga0495638_0007531 3300046460 Bacteria 7792
348 Ga0495638_0035624 3300046460 Bacteria 3172
349 Ga0495596_0134681 3300046500 Bacteria 959
350 Ga0495596_0328786 3300046500 Unclassified 595
351 Ga0495583_0268684 3300046506 Unclassified 681
352 Ga0495616_0001194 3300046513 Bacteria 18313
353 Ga0495632_0016452 3300046519 Bacteria 4114
354 Ga0495598_0234068 3300046537 Unclassified 675
355 Ga0495668_0147499 3300046616 Bacteria 1288
356 Ga0495625_0065605 3300046660 Bacteria 2559
357 Ga0495625_0182579 3300046660 Bacteria 1394
358 Ga0495625_0216356 3300046660 Bacteria 1257
359 Ga0495625_0322814 3300046660 Bacteria 983
360 Ga0495649_0141765 3300046694 Bacteria 1265
361 Ga0495686_0029418 3300047472 Bacteria 3574
362 Ga0495626_0206113 3300048091 Bacteria 804
363 Ga0496114_1071311 3300048917 Bacteria 690
364 Ga0501039_0451852 3300049575 Bacteria 1009
365 Ga0501042_0126150 3300049578 Bacteria 1843
366 Ga0501068_0000333 3300049584 Bacteria 23681
367 Ga0501070_0030361 3300049586 Bacteria 4529
368 Ga0501071_0002373 3300049587 Bacteria 11404
369 Ga0501071_0197291 3300049587 Bacteria 1511
370 Ga0501071_0693202 3300049587 Bacteria 784
371 Ga0501073_0453108 3300049589 Bacteria 887
372 Ga0501074_0005826 3300049590 Bacteria 8886
373 Ga0501075_0806231 3300049591 Unclassified 714
374 Ga0501076_0026391 3300049592 Bacteria 4500
375 Ga0501077_0009480 3300049593 Bacteria 6052
376 Ga0501079_0001264 3300049741 Bacteria 17746
377 Ga0501080_0002029 3300049742 Bacteria 17504
378 Ga0501080_0229364 3300049742 Bacteria 1698
379 Ga0501083_0133347 3300049744 Bacteria 1628
380 Ga0501083_0632893 3300049744 Bacteria 696
381 nmdc:mga08y16_425045_c1 3300050511 Bacteria 1357
382 nmdc:mga08y16_440293_c1 3300050511 Bacteria 1330
383 Ga0500643_067457 3300053087 Bacteria 996
384 Ga0500646_0023732 3300053090 Bacteria 1647
385 Ga0500646_0089478 3300053090 Bacteria 951
386 Ga0500583_0039283 3300053092 Bacteria 2136
387 Ga0500641_0023639 3300053096 Bacteria 2366
388 Ga0500641_0172366 3300053096 Bacteria 931
389 Ga0500556_0049332 3300053104 Bacteria 1517
390 Ga0500562_084783 3300053108 Bacteria 858
391 Ga0500617_139742 3300053124 Bacteria 973
392 Ga0500642_0008051 3300053130 Bacteria 3582
393 Ga0500642_0060500 3300053130 Bacteria 1699
394 Ga0500658_0060132 3300053134 Bacteria 1578
395 Ga0500568_0135211 3300053139 Bacteria 915
396 Ga0500568_0244002 3300053139 Bacteria 654
397 Ga0500588_0030465 3300053146 Bacteria 1548
398 Ga0500588_0167037 3300053146 Bacteria 803
399 Ga0500589_097059 3300053147 Bacteria 1287
400 Ga0500616_0000569 3300053153 Bacteria 45203
401 Ga0500616_0038781 3300053153 Bacteria 2571
402 Ga0500622_0001101 3300053156 Bacteria 22477
403 Ga0500622_0005155 3300053156 Bacteria 7921
404 Ga0500622_0007124 3300053156 Bacteria 6382
405 Ga0500611_109377 3300053727 Bacteria 725
406 Ga0500656_002022 3300053732 Bacteria 1805
407 Ga0501084_0004825 3300054114 Bacteria 11019
408 Ga0501082_0039668 3300060353 Bacteria 4062

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049587 Ga0501071_0693202 Ga0501071_0693202_277_756 153
2 3300032002 Ga0307416_100346711 Ga0307416_1003467111 154
3 3300053139 Ga0500568_0135211 Ga0500568_0135211_257_778 157
4 3300053156 Ga0500622_0005155 Ga0500622_0005155_819_1340 157
5 3300028794 Ga0307515_10012639 Ga0307515_1001263912 159
6 3300005544 Ga0070686_100077514 Ga0070686_1000775142 164
7 3300035118 Ga0373954_0074319 Ga0373954_0074319_243_803 164
8 3300035172 Ga0373955_0116405 Ga0373955_0116405_818_1378 164
9 3300005466 Ga0070685_10518801 Ga0070685_105188011 165
10 3300041453 Ga0451797_0956248 Ga0451797_0956248_387_935 165
11 3300049744 Ga0501083_0632893 Ga0501083_0632893_14_511 165
12 3300053124 Ga0500617_139742 Ga0500617_139742_466_963 165
13 3300053147 Ga0500589_097059 Ga0500589_097059_26_523 165
14 3300005548 Ga0070665_100626509 Ga0070665_1006265092 167
15 3300028379 Ga0268266_10683100 Ga0268266_106831001 167
16 3300046660 Ga0495625_0322814 Ga0495625_0322814_281_799 167
17 3300053087 Ga0500643_067457 Ga0500643_067457_42_560 167
18 3300053108 Ga0500562_084783 Ga0500562_084783_106_624 167
19 3300053139 Ga0500568_0244002 Ga0500568_0244002_34_552 167
20 3300053156 Ga0500622_0001101 Ga0500622_0001101_7554_8072 167
21 3300053156 Ga0500622_0007124 Ga0500622_0007124_2068_2595 167
22 3300005330 Ga0070690_100421095 Ga0070690_1004210951 168
23 3300005333 Ga0070677_10004338 Ga0070677_100043383 168
24 3300005334 Ga0068869_100186805 Ga0068869_1001868052 168
25 3300005337 Ga0070682_100060571 Ga0070682_1000605711 168
26 3300005337 Ga0070682_100238366 Ga0070682_1002383662 168
27 3300005338 Ga0068868_100828005 Ga0068868_1008280051 168
28 3300005353 Ga0070669_100154153 Ga0070669_1001541532 168
29 3300005354 Ga0070675_100008631 Ga0070675_1000086317 168
30 3300005365 Ga0070688_100245150 Ga0070688_1002451501 168
31 3300005441 Ga0070700_100097691 Ga0070700_1000976912 168
32 3300005455 Ga0070663_100731022 Ga0070663_1007310221 168
33 3300005539 Ga0068853_100235854 Ga0068853_1002358542 168
34 3300005543 Ga0070672_100050470 Ga0070672_1000504702 168
35 3300005543 Ga0070672_100911650 Ga0070672_1009116501 168
36 3300005618 Ga0068864_100398899 Ga0068864_1003988992 168
37 3300005840 Ga0068870_10003318 Ga0068870_100033188 168
38 3300005841 Ga0068863_100538141 Ga0068863_1005381412 168
39 3300006358 Ga0068871_100163527 Ga0068871_1001635272 168
40 3300006358 Ga0068871_100690489 Ga0068871_1006904892 168
41 3300009176 Ga0105242_10081784 Ga0105242_100817843 168
42 3300009177 Ga0105248_10021656 Ga0105248_100216567 168
43 3300009553 Ga0105249_10396992 Ga0105249_103969922 168
44 3300013296 Ga0157374_10162161 Ga0157374_101621612 168
45 3300013297 Ga0157378_10350234 Ga0157378_103502342 168
46 3300013306 Ga0163162_10236403 Ga0163162_102364032 168
47 3300013308 Ga0157375_10090106 Ga0157375_100901062 168
48 3300014325 Ga0163163_10210142 Ga0163163_102101422 168
49 3300014968 Ga0157379_10288761 Ga0157379_102887612 168
50 3300014969 Ga0157376_10114432 Ga0157376_101144322 168
51 3300017792 Ga0163161_10183874 Ga0163161_101838742 168
52 3300025893 Ga0207682_10013765 Ga0207682_100137652 168
53 3300025908 Ga0207643_10116469 Ga0207643_101164692 168
54 3300025923 Ga0207681_10136591 Ga0207681_101365912 168
55 3300025933 Ga0207706_10506445 Ga0207706_105064451 168
56 3300025934 Ga0207686_10092712 Ga0207686_100927122 168
57 3300025937 Ga0207669_10054280 Ga0207669_100542802 168
58 3300025938 Ga0207704_10423923 Ga0207704_104239232 168
59 3300025940 Ga0207691_10007146 Ga0207691_100071464 168
60 3300025941 Ga0207711_10262616 Ga0207711_102626162 168
61 3300025942 Ga0207689_10036574 Ga0207689_100365742 168
62 3300025972 Ga0207668_10184514 Ga0207668_101845142 168
63 3300026023 Ga0207677_11050741 Ga0207677_110507411 168
64 3300026041 Ga0207639_10546565 Ga0207639_105465652 168
65 3300026067 Ga0207678_10228677 Ga0207678_102286772 168
66 3300026075 Ga0207708_10210144 Ga0207708_102101442 168
67 3300026088 Ga0207641_10272479 Ga0207641_102724792 168
68 3300026089 Ga0207648_10018003 Ga0207648_100180032 168
69 3300026095 Ga0207676_10491475 Ga0207676_104914752 168
70 3300026118 Ga0207675_100436965 Ga0207675_1004369652 168
71 3300026118 Ga0207675_100519905 Ga0207675_1005199051 168
72 3300026121 Ga0207683_10406031 Ga0207683_104060312 168
73 3300041443 Ga0451789_1140445 Ga0451789_1140445_506_1072 168
74 3300046460 Ga0495638_0007531 Ga0495638_0007531_4432_4983 168
75 3300046500 Ga0495596_0134681 Ga0495596_0134681_279_845 168
76 3300047472 Ga0495686_0029418 Ga0495686_0029418_1229_1777 168
77 3300014326 Ga0157380_10660759 Ga0157380_106607592 171
78 3300041452 Ga0451793_1523224 Ga0451793_1523224_618_1166 171
79 3300041486 Ga0451807_2134497 Ga0451807_2134497_243_791 171
80 3300006846 Ga0075430_100703452 Ga0075430_1007034522 172
81 3300046500 Ga0495596_0328786 Ga0495596_0328786_41_580 172
82 3300005335 Ga0070666_10046057 Ga0070666_100460572 173
83 3300005367 Ga0070667_100000176 Ga0070667_10000017681 173
84 3300009101 Ga0105247_10053717 Ga0105247_100537173 173
85 3300014325 Ga0163163_10105747 Ga0163163_101057472 173
86 3300014968 Ga0157379_10073673 Ga0157379_100736732 173
87 3300025900 Ga0207710_10066273 Ga0207710_100662732 173
88 3300025903 Ga0207680_10040110 Ga0207680_100401102 173
89 3300025986 Ga0207658_10000236 Ga0207658_1000023615 173
90 3300053090 Ga0500646_0023732 Ga0500646_0023732_109_633 173
91 3300005347 Ga0070668_100890178 Ga0070668_1008901781 174
92 3300041452 Ga0451793_1259970 Ga0451793_1259970_252_800 174
93 3300046506 Ga0495583_0268684 Ga0495583_0268684_85_612 174
94 3300042115 Ga0450911_030735 Ga0450911_030735_124_669 175
95 3300049578 Ga0501042_0126150 Ga0501042_0126150_599_1150 175
96 3300005843 Ga0068860_100064276 Ga0068860_1000642762 177
97 3300031456 Ga0307513_10037044 Ga0307513_100370444 177
98 3300003322 rootL2_10022271 rootL2_100222711 178
99 3300003322 rootL2_10136634 rootL2_101366343 178
100 3300005328 Ga0070676_10457414 Ga0070676_104574141 178
101 3300005328 Ga0070676_10655095 Ga0070676_106550951 178
102 3300005329 Ga0070683_100739023 Ga0070683_1007390232 178
103 3300005330 Ga0070690_100017084 Ga0070690_1000170845 178
104 3300005331 Ga0070670_100061049 Ga0070670_1000610494 178
105 3300005334 Ga0068869_100276285 Ga0068869_1002762852 178
106 3300005337 Ga0070682_100122889 Ga0070682_1001228892 178
107 3300005337 Ga0070682_100150702 Ga0070682_1001507022 178
108 3300005337 Ga0070682_100419164 Ga0070682_1004191641 178
109 3300005338 Ga0068868_100797699 Ga0068868_1007976991 178
110 3300005339 Ga0070660_100924318 Ga0070660_1009243181 178
111 3300005340 Ga0070689_100135884 Ga0070689_1001358843 178
112 3300005340 Ga0070689_100216778 Ga0070689_1002167782 178
113 3300005345 Ga0070692_10542772 Ga0070692_105427721 178
114 3300005347 Ga0070668_100150202 Ga0070668_1001502022 178
115 3300005354 Ga0070675_100097832 Ga0070675_1000978322 178
116 3300005354 Ga0070675_100230743 Ga0070675_1002307432 178
117 3300005355 Ga0070671_100224262 Ga0070671_1002242622 178
118 3300005355 Ga0070671_100589116 Ga0070671_1005891161 178
119 3300005355 Ga0070671_100700185 Ga0070671_1007001852 178
120 3300005356 Ga0070674_100027458 Ga0070674_1000274582 178
121 3300005356 Ga0070674_100294500 Ga0070674_1002945002 178
122 3300005356 Ga0070674_100487257 Ga0070674_1004872572 178
123 3300005364 Ga0070673_100056936 Ga0070673_1000569362 178
124 3300005364 Ga0070673_100296814 Ga0070673_1002968142 178
125 3300005365 Ga0070688_100061524 Ga0070688_1000615243 178
126 3300005365 Ga0070688_100113865 Ga0070688_1001138652 178
127 3300005365 Ga0070688_100237685 Ga0070688_1002376851 178
128 3300005366 Ga0070659_100661819 Ga0070659_1006618191 178
129 3300005367 Ga0070667_100556185 Ga0070667_1005561852 178
130 3300005438 Ga0070701_10007542 Ga0070701_100075422 178
131 3300005438 Ga0070701_10104632 Ga0070701_101046322 178
132 3300005438 Ga0070701_10747688 Ga0070701_107476881 178
133 3300005440 Ga0070705_100258337 Ga0070705_1002583372 178
134 3300005441 Ga0070700_100066679 Ga0070700_1000666791 178
135 3300005441 Ga0070700_100096534 Ga0070700_1000965342 178
136 3300005441 Ga0070700_100476109 Ga0070700_1004761091 178
137 3300005444 Ga0070694_100259986 Ga0070694_1002599862 178
138 3300005455 Ga0070663_100107374 Ga0070663_1001073742 178
139 3300005456 Ga0070678_100038470 Ga0070678_1000384704 178
140 3300005457 Ga0070662_100267720 Ga0070662_1002677202 178
141 3300005459 Ga0068867_100082564 Ga0068867_1000825642 178
142 3300005459 Ga0068867_100294371 Ga0068867_1002943711 178
143 3300005459 Ga0068867_100415254 Ga0068867_1004152542 178
144 3300005466 Ga0070685_10117258 Ga0070685_101172582 178
145 3300005466 Ga0070685_10448206 Ga0070685_104482062 178
146 3300005539 Ga0068853_100288012 Ga0068853_1002880122 178
147 3300005543 Ga0070672_100009398 Ga0070672_1000093983 178
148 3300005543 Ga0070672_100131242 Ga0070672_1001312422 178
149 3300005543 Ga0070672_100223884 Ga0070672_1002238842 178
150 3300005543 Ga0070672_100244305 Ga0070672_1002443052 178
151 3300005544 Ga0070686_100126445 Ga0070686_1001264452 178
152 3300005544 Ga0070686_100345963 Ga0070686_1003459632 178
153 3300005545 Ga0070695_100084847 Ga0070695_1000848472 178
154 3300005546 Ga0070696_100206770 Ga0070696_1002067702 178
155 3300005547 Ga0070693_100211155 Ga0070693_1002111552 178
156 3300005547 Ga0070693_101052624 Ga0070693_1010526241 178
157 3300005548 Ga0070665_100016294 Ga0070665_1000162942 178
158 3300005564 Ga0070664_100068541 Ga0070664_1000685414 178
159 3300005564 Ga0070664_100143272 Ga0070664_1001432721 178
160 3300005564 Ga0070664_100250555 Ga0070664_1002505552 178
161 3300005577 Ga0068857_100272860 Ga0068857_1002728602 178
162 3300005577 Ga0068857_100576410 Ga0068857_1005764102 178
163 3300005577 Ga0068857_100824575 Ga0068857_1008245752 178
164 3300005578 Ga0068854_100342863 Ga0068854_1003428632 178
165 3300005615 Ga0070702_100082365 Ga0070702_1000823652 178
166 3300005615 Ga0070702_100161604 Ga0070702_1001616042 178
167 3300005617 Ga0068859_100055139 Ga0068859_1000551394 178
168 3300005618 Ga0068864_100077449 Ga0068864_1000774492 178
169 3300005618 Ga0068864_100841570 Ga0068864_1008415702 178
170 3300005718 Ga0068866_10477033 Ga0068866_104770331 178
171 3300005719 Ga0068861_100041772 Ga0068861_1000417724 178
172 3300005719 Ga0068861_100109577 Ga0068861_1001095772 178
173 3300005719 Ga0068861_100232065 Ga0068861_1002320652 178
174 3300005719 Ga0068861_100248209 Ga0068861_1002482092 178
175 3300005719 Ga0068861_100610368 Ga0068861_1006103682 178
176 3300005840 Ga0068870_10090833 Ga0068870_100908332 178
177 3300005841 Ga0068863_100042140 Ga0068863_1000421404 178
178 3300005842 Ga0068858_100126003 Ga0068858_1001260032 178
179 3300005843 Ga0068860_100894818 Ga0068860_1008948182 178
180 3300005844 Ga0068862_100052442 Ga0068862_1000524422 178
181 3300005844 Ga0068862_100177438 Ga0068862_1001774383 178
182 3300005844 Ga0068862_100539362 Ga0068862_1005393621 178
183 3300005844 Ga0068862_100587506 Ga0068862_1005875062 178
184 3300005844 Ga0068862_100985805 Ga0068862_1009858052 178
185 3300006051 Ga0075364_10368643 Ga0075364_103686432 178
186 3300006195 Ga0075366_10594007 Ga0075366_105940071 178
187 3300006237 Ga0097621_100136360 Ga0097621_1001363603 178
188 3300006237 Ga0097621_100956915 Ga0097621_1009569151 178
189 3300006846 Ga0075430_100832018 Ga0075430_1008320181 178
190 3300006931 Ga0097620_100055139 Ga0097620_1000551392 178
191 3300009094 Ga0111539_11292271 Ga0111539_112922711 178
192 3300009094 Ga0111539_11316361 Ga0111539_113163611 178
193 3300009553 Ga0105249_11479225 Ga0105249_114792252 178
194 3300013308 Ga0157375_10164058 Ga0157375_101640583 178
195 3300014325 Ga0163163_10747095 Ga0163163_107470952 178
196 3300014326 Ga0157380_10039703 Ga0157380_100397034 178
197 3300014326 Ga0157380_10110967 Ga0157380_101109673 178
198 3300014326 Ga0157380_10228342 Ga0157380_102283422 178
199 3300014326 Ga0157380_10254413 Ga0157380_102544132 178
200 3300014326 Ga0157380_10319309 Ga0157380_103193091 178
201 3300014326 Ga0157380_10672488 Ga0157380_106724881 178
202 3300014326 Ga0157380_10824981 Ga0157380_108249812 178
203 3300017792 Ga0163161_11000430 Ga0163161_110004301 178
204 3300025893 Ga0207682_10002366 Ga0207682_100023662 178
205 3300025899 Ga0207642_10211627 Ga0207642_102116271 178
206 3300025899 Ga0207642_10325873 Ga0207642_103258732 178
207 3300025907 Ga0207645_10077546 Ga0207645_100775462 178
208 3300025907 Ga0207645_10374648 Ga0207645_103746482 178
209 3300025908 Ga0207643_10093669 Ga0207643_100936692 178
210 3300025908 Ga0207643_10203468 Ga0207643_102034682 178
211 3300025918 Ga0207662_10145603 Ga0207662_101456032 178
212 3300025920 Ga0207649_10471042 Ga0207649_104710421 178
213 3300025926 Ga0207659_10162525 Ga0207659_101625252 178
214 3300025926 Ga0207659_10215956 Ga0207659_102159562 178
215 3300025926 Ga0207659_10312457 Ga0207659_103124572 178
216 3300025931 Ga0207644_10673207 Ga0207644_106732072 178
217 3300025933 Ga0207706_10294841 Ga0207706_102948412 178
218 3300025936 Ga0207670_10190796 Ga0207670_101907962 178
219 3300025936 Ga0207670_10278011 Ga0207670_102780111 178
220 3300025940 Ga0207691_10009176 Ga0207691_1000917610 178
221 3300025940 Ga0207691_10022186 Ga0207691_100221862 178
222 3300025940 Ga0207691_10211420 Ga0207691_102114202 178
223 3300025942 Ga0207689_10104309 Ga0207689_101043093 178
224 3300025944 Ga0207661_10860707 Ga0207661_108607072 178
225 3300025945 Ga0207679_10061578 Ga0207679_100615783 178
226 3300025945 Ga0207679_10597979 Ga0207679_105979792 178
227 3300025945 Ga0207679_10799447 Ga0207679_107994472 178
228 3300025972 Ga0207668_10817278 Ga0207668_108172781 178
229 3300025986 Ga0207658_10898505 Ga0207658_108985051 178
230 3300026041 Ga0207639_10400199 Ga0207639_104001992 178
231 3300026075 Ga0207708_10028376 Ga0207708_100283764 178
232 3300026075 Ga0207708_10126314 Ga0207708_101263142 178
233 3300026075 Ga0207708_10423637 Ga0207708_104236372 178
234 3300026075 Ga0207708_10604302 Ga0207708_106043022 178
235 3300026088 Ga0207641_10013278 Ga0207641_100132784 178
236 3300026088 Ga0207641_10865592 Ga0207641_108655922 178
237 3300026089 Ga0207648_10181872 Ga0207648_101818722 178
238 3300026095 Ga0207676_10071814 Ga0207676_100718142 178
239 3300026095 Ga0207676_10760646 Ga0207676_107606462 178
240 3300026116 Ga0207674_10294709 Ga0207674_102947092 178
241 3300026116 Ga0207674_10366087 Ga0207674_103660872 178
242 3300026118 Ga0207675_100012250 Ga0207675_1000122509 178
243 3300026118 Ga0207675_100015078 Ga0207675_1000150789 178
244 3300026118 Ga0207675_100774143 Ga0207675_1007741432 178
245 3300026121 Ga0207683_10406628 Ga0207683_104066282 178
246 3300028379 Ga0268266_10131761 Ga0268266_101317612 178
247 3300028380 Ga0268265_10020321 Ga0268265_100203214 178
248 3300028380 Ga0268265_10605335 Ga0268265_106053352 178
249 3300028380 Ga0268265_10663932 Ga0268265_106639322 178
250 3300028380 Ga0268265_10803455 Ga0268265_108034552 178
251 3300028381 Ga0268264_11081588 Ga0268264_110815881 178
252 3300028794 Ga0307515_10269418 Ga0307515_102694181 178
253 3300031456 Ga0307513_10071890 Ga0307513_100718902 178
254 3300031456 Ga0307513_10085124 Ga0307513_100851242 178
255 3300031456 Ga0307513_10105536 Ga0307513_101055362 178
256 3300031507 Ga0307509_10009871 Ga0307509_100098719 178
257 3300031507 Ga0307509_10500715 Ga0307509_105007152 178
258 3300031548 Ga0307408_100031000 Ga0307408_1000310002 178
259 3300031548 Ga0307408_100371345 Ga0307408_1003713452 178
260 3300031548 Ga0307408_100578587 Ga0307408_1005785872 178
261 3300031548 Ga0307408_101495561 Ga0307408_1014955611 178
262 3300031731 Ga0307405_10029249 Ga0307405_100292493 178
263 3300031824 Ga0307413_10004180 Ga0307413_100041802 178
264 3300031852 Ga0307410_10007402 Ga0307410_100074025 178
265 3300031901 Ga0307406_10060544 Ga0307406_100605442 178
266 3300031903 Ga0307407_10002873 Ga0307407_100028736 178
267 3300031903 Ga0307407_10298936 Ga0307407_102989362 178
268 3300031911 Ga0307412_10294425 Ga0307412_102944252 178
269 3300031995 Ga0307409_100008601 Ga0307409_1000086012 178
270 3300032002 Ga0307416_100325860 Ga0307416_1003258602 178
271 3300032002 Ga0307416_100365278 Ga0307416_1003652782 178
272 3300032005 Ga0307411_10013209 Ga0307411_100132093 178
273 3300032126 Ga0307415_100175323 Ga0307415_1001753232 178
274 3300032126 Ga0307415_100326378 Ga0307415_1003263782 178
275 3300032126 Ga0307415_100352120 Ga0307415_1003521201 178
276 3300041441 Ga0451787_048931 Ga0451787_048931_1973_2524 178
277 3300041451 Ga0451791_0388950 Ga0451791_0388950_275_883 178
278 3300041452 Ga0451793_1369791 Ga0451793_1369791_643_1194 178
279 3300041453 Ga0451797_0747851 Ga0451797_0747851_532_1140 178
280 3300041459 Ga0451800_0426383 Ga0451800_0426383_1049_1600 178
281 3300041460 Ga0451802_0367945 Ga0451802_0367945_430_981 178
282 3300041460 Ga0451802_2139266 Ga0451802_2139266_79_630 178
283 3300041463 Ga0451804_0961374 Ga0451804_0961374_225_833 178
284 3300041486 Ga0451807_0235429 Ga0451807_0235429_4225_4833 178
285 3300041486 Ga0451807_0349479 Ga0451807_0349479_255_806 178
286 3300041494 Ga0451837_1285619 Ga0451837_1285619_142_750 178
287 3300041512 Ga0451853_3282110 Ga0451853_3282110_697_1248 178
288 3300046457 Ga0495590_0000646 Ga0495590_0000646_6877_7425 178
289 3300046457 Ga0495590_0191326 Ga0495590_0191326_123_674 178
290 3300046460 Ga0495638_0035624 Ga0495638_0035624_2081_2632 178
291 3300046513 Ga0495616_0001194 Ga0495616_0001194_7894_8445 178
292 3300046519 Ga0495632_0016452 Ga0495632_0016452_3226_3774 178
293 3300046537 Ga0495598_0234068 Ga0495598_0234068_98_664 178
294 3300046616 Ga0495668_0147499 Ga0495668_0147499_354_902 178
295 3300046660 Ga0495625_0065605 Ga0495625_0065605_683_1234 178
296 3300046660 Ga0495625_0182579 Ga0495625_0182579_329_877 178
297 3300046660 Ga0495625_0216356 Ga0495625_0216356_439_990 178
298 3300046694 Ga0495649_0141765 Ga0495649_0141765_352_900 178
299 3300048091 Ga0495626_0206113 Ga0495626_0206113_35_598 178
300 3300048917 Ga0496114_1071311 Ga0496114_1071311_112_663 178
301 3300049575 Ga0501039_0451852 Ga0501039_0451852_300_854 178
302 3300049584 Ga0501068_0000333 Ga0501068_0000333_3287_3841 178
303 3300049586 Ga0501070_0030361 Ga0501070_0030361_2919_3473 178
304 3300049587 Ga0501071_0002373 Ga0501071_0002373_3250_3804 178
305 3300049587 Ga0501071_0197291 Ga0501071_0197291_607_1173 178
306 3300049589 Ga0501073_0453108 Ga0501073_0453108_39_605 178
307 3300049590 Ga0501074_0005826 Ga0501074_0005826_2434_2988 178
308 3300049591 Ga0501075_0806231 Ga0501075_0806231_140_694 178
309 3300049592 Ga0501076_0026391 Ga0501076_0026391_1832_2386 178
310 3300049593 Ga0501077_0009480 Ga0501077_0009480_1019_1573 178
311 3300049741 Ga0501079_0001264 Ga0501079_0001264_13924_14478 178
312 3300049742 Ga0501080_0002029 Ga0501080_0002029_3282_3836 178
313 3300049742 Ga0501080_0229364 Ga0501080_0229364_754_1305 178
314 3300049744 Ga0501083_0133347 Ga0501083_0133347_362_916 178
315 3300050511 nmdc:mga08y16_425045_c1 nmdc:mga08y16_425045_c1_500_1066 178
316 3300050511 nmdc:mga08y16_440293_c1 nmdc:mga08y16_440293_c1_42_593 178
317 3300053727 Ga0500611_109377 Ga0500611_109377_129_680 178
318 3300054114 Ga0501084_0004825 Ga0501084_0004825_1331_1885 178
319 3300060353 Ga0501082_0039668 Ga0501082_0039668_2675_3229 178
320 3300031852 Ga0307410_10012046 Ga0307410_100120462 179
321 3300031903 Ga0307407_10705328 Ga0307407_107053281 179
322 3300031995 Ga0307409_100007401 Ga0307409_1000074013 179
323 3300041491 Ga0451833_0264962 Ga0451833_0264962_447_1013 179
324 3300005356 Ga0070674_101082166 Ga0070674_1010821661 180
325 3300005543 Ga0070672_100989170 Ga0070672_1009891701 180
326 3300009174 Ga0105241_10318402 Ga0105241_103184022 180
327 3300005618 Ga0068864_101870477 Ga0068864_1018704771 181
328 3300005327 Ga0070658_10779035 Ga0070658_107790351 182
329 3300005458 Ga0070681_10028459 Ga0070681_100284595 182
330 3300005530 Ga0070679_100017664 Ga0070679_1000176646 182
331 3300005530 Ga0070679_100107875 Ga0070679_1001078752 182
332 3300005530 Ga0070679_100188625 Ga0070679_1001886251 182
333 3300005563 Ga0068855_100002113 Ga0068855_10000211320 182
334 3300005614 Ga0068856_100385738 Ga0068856_1003857381 182
335 3300009093 Ga0105240_10220678 Ga0105240_102206782 182
336 3300009093 Ga0105240_10224903 Ga0105240_102249032 182
337 3300013104 Ga0157370_10563248 Ga0157370_105632482 182
338 3300013104 Ga0157370_10601993 Ga0157370_106019932 182
339 3300013105 Ga0157369_10195482 Ga0157369_101954821 182
340 3300013105 Ga0157369_10502190 Ga0157369_105021902 182
341 3300020082 Ga0206353_11631158 Ga0206353_116311581 182
342 3300022467 Ga0224712_10234086 Ga0224712_102340861 182
343 3300025912 Ga0207707_10000045 Ga0207707_1000004516 182
344 3300025912 Ga0207707_10042089 Ga0207707_100420893 182
345 3300025913 Ga0207695_10012566 Ga0207695_100125665 182
346 3300025917 Ga0207660_10000958 Ga0207660_100009582 182
347 3300025920 Ga0207649_10544310 Ga0207649_105443101 182
348 3300025921 Ga0207652_10005918 Ga0207652_1000591810 182
349 3300025921 Ga0207652_10038374 Ga0207652_100383744 182
350 3300025921 Ga0207652_10150658 Ga0207652_101506582 182
351 3300025921 Ga0207652_10582934 Ga0207652_105829342 182
352 3300025924 Ga0207694_10088383 Ga0207694_100883832 182
353 3300025949 Ga0207667_10000887 Ga0207667_100008873 182
354 3300025949 Ga0207667_10864694 Ga0207667_108646942 182
355 3300026041 Ga0207639_10361519 Ga0207639_103615191 182
356 3300026078 Ga0207702_10598521 Ga0207702_105985211 182
357 3300005548 Ga0070665_100009043 Ga0070665_1000090439 183
358 3300005719 Ga0068861_101005583 Ga0068861_1010055832 183
359 3300005842 Ga0068858_101296285 Ga0068858_1012962851 183
360 3300005843 Ga0068860_100547029 Ga0068860_1005470292 183
361 3300005844 Ga0068862_100579694 Ga0068862_1005796941 183
362 3300006195 Ga0075366_10272255 Ga0075366_102722552 183
363 3300025942 Ga0207689_10149889 Ga0207689_101498892 183
364 3300025972 Ga0207668_10460776 Ga0207668_104607762 183
365 3300026035 Ga0207703_10889327 Ga0207703_108893272 183
366 3300026118 Ga0207675_100275016 Ga0207675_1002750162 183
367 3300028794 Ga0307515_10386588 Ga0307515_103865882 183
368 3300031507 Ga0307509_10533882 Ga0307509_105338821 183
369 3300031824 Ga0307413_10210307 Ga0307413_102103071 183
370 3300031901 Ga0307406_11057890 Ga0307406_110578901 183
371 3300031995 Ga0307409_100047806 Ga0307409_1000478063 183
372 3300041486 Ga0451807_0309231 Ga0451807_0309231_110_667 183
373 3300053096 Ga0500641_0023639 Ga0500641_0023639_1225_1782 183
374 3300053096 Ga0500641_0172366 Ga0500641_0172366_332_889 183
375 3300053130 Ga0500642_0008051 Ga0500642_0008051_1787_2344 183
376 3300053146 Ga0500588_0030465 Ga0500588_0030465_416_973 183
377 3300053153 Ga0500616_0000569 Ga0500616_0000569_40451_41008 183
378 3300053153 Ga0500616_0038781 Ga0500616_0038781_686_1243 183
379 3300005545 Ga0070695_100348949 Ga0070695_1003489491 184
380 3300042011 Ga0439454_010856 Ga0439454_010856_160_726 184
381 3300005563 Ga0068855_100965140 Ga0068855_1009651402 185
382 3300009093 Ga0105240_10087755 Ga0105240_100877553 185
383 3300009174 Ga0105241_10090338 Ga0105241_100903382 185
384 3300025911 Ga0207654_10360528 Ga0207654_103605281 185
385 3300025913 Ga0207695_10102911 Ga0207695_101029113 185
386 3300044658 Ga0466972_0048879 Ga0466972_0048879_1065_1625 186
387 3300044901 Ga0466960_0672965 Ga0466960_0672965_49_609 186
388 3300003911 JGI25405J52794_10098329 JGI25405J52794_100983291 187
389 3300005937 Ga0081455_10000043 Ga0081455_10000043120 187
390 3300005548 Ga0070665_100645966 Ga0070665_1006459661 188
391 3300003203 JGI25406J46586_10004078 JGI25406J46586_100040784 189
392 3300005337 Ga0070682_100450179 Ga0070682_1004501791 189
393 3300005547 Ga0070693_100205852 Ga0070693_1002058522 189
394 3300005844 Ga0068862_100022839 Ga0068862_1000228394 189
395 3300005985 Ga0081539_10000046 Ga0081539_1000004679 189
396 3300006358 Ga0068871_100809597 Ga0068871_1008095972 189
397 3300009553 Ga0105249_10481686 Ga0105249_104816862 189
398 3300013297 Ga0157378_10735128 Ga0157378_107351282 189
399 3300025961 Ga0207712_10761307 Ga0207712_107613072 189
400 3300028380 Ga0268265_10184547 Ga0268265_101845472 189
401 3300031507 Ga0307509_10088983 Ga0307509_100889832 189
402 3300053090 Ga0500646_0089478 Ga0500646_0089478_178_747 189
403 3300053092 Ga0500583_0039283 Ga0500583_0039283_1107_1676 189
404 3300053104 Ga0500556_0049332 Ga0500556_0049332_823_1392 189
405 3300053130 Ga0500642_0060500 Ga0500642_0060500_205_774 189
406 3300053134 Ga0500658_0060132 Ga0500658_0060132_969_1538 189
407 3300053146 Ga0500588_0167037 Ga0500588_0167037_59_628 189
408 3300053732 Ga0500656_002022 Ga0500656_002022_308_877 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01025

GrpE

GrpE

40

199

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6n5x-assembly1.cif.gz_A crystal structure of the snx5 px domain in complex with the ci-mpr (space group p212121 - form 1) 0.9477 92 129
6n5y-assembly1.cif.gz_A crystal structure of the snx5 px domain in complex with the ci-mpr (space group p212121 - form 1) 0.9091 89 129
5tp1-assembly2.cif.gz_B the structure of the c-terminus of virulence protein ince from chlamydia trachomatis bound to mus musculus snx5-px domain 0.8567 89 129
1g73-assembly2.cif.gz_B crystal structure of smac bound to xiap-bir3 domain 0.8378 83 129
2l3l-assembly1.cif.gz_A the solution structure of the n-terminal domain of human tubulin binding cofactor c reveals a platform for the interaction with ab-tubulin 0.8252 83 129
ID Description Score Start End Superfamily
af_Q99LP6_159_215_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9968 132 187 2.30.22.10
af_A0A1D6EAQ0_210_272_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9832 132 186 2.30.22.10
af_Q2FXZ1_152_207_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.983 132 185 2.30.22.10
af_A0A0P0VLJ4_201_256_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9764 132 185 2.30.22.10
af_Q18421_178_235_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9664 132 185 2.30.22.10
ID Description Score Start End GO Terms
AF-A0A534BBZ5-F1-model_v4 Protein GrpE (HSP-70 cofactor) 0.977 84 189 GO:0000774
GO:0005829
GO:0006457
GO:0042803
GO:0051082
GO:0051087
AF-A0A842PDT0-F1-model_v4 Protein GrpE (HSP-70 cofactor) 0.9614 34 189 GO:0000774
GO:0005506
GO:0005737
GO:0006457
GO:0042803
GO:0051082
GO:0051087
AF-A0A645D385-F1-model_v4 Protein GrpE 0.9546 34 186 GO:0000774
GO:0006457
GO:0042803
GO:0051082
GO:0051087
AF-A0A101ISZ5-F1-model_v4 deleted 0.9494 89 187
AF-A0A3N9NA14-F1-model_v4 Protein GrpE (HSP-70 cofactor) 0.9481 29 187 GO:0000774
GO:0005737
GO:0006457
GO:0042803
GO:0051082
GO:0051087

Feature Viewer

pLDDT pTM Quality
86.88 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map