F436788
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 408 | 209 | 408 | 183 |
Family's Representative Sequence
| Representative Sequence | 3300041451|Ga0451791_0388950|Ga0451791_0388950_275_883 |
| Length | 202 |
| Sequence | MRAAVGAELSKYLIRLRSLMPDPSNMSAPSSQDEKTEVLPETAVQLVEMERLKTELAGAEERAKNHWEQYLRALADVDNVRKRAAKDLESARQFAVEKFAQELVGVKDSLELGIQNSSKADVASLIEGQQATLRLLAKAFEKAQIEEINPEGQAFNPELHEAMMAQPSDAAPNTVLTVIQRGYQLNGRLLRPARVVVSAARN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 62 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 134 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 135 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 136 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 137 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 138 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 139 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 140 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 141 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 142 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 143 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 144 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 145 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 146 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 147 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 148 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 149 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 150 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 151 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 152 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 153 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 154 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 155 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 156 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 157 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 158 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 159 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 160 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 161 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 162 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 163 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 164 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 165 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 178 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 193 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 194 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 195 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 196 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 197 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 198 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 199 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 200 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 201 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 202 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 203 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 204 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 205 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 206 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 207 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 208 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.51 |
| Metatranscriptomes | 0.49 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.62 |
| Nodule | 0 |
| Rhizoplane | 4.17 |
| Rhizosphere | 85.29 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.92 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10004078 | 3300003203 | Bacteria | 6830 |
| 2 | rootL2_10022271 | 3300003322 | Bacteria | 2135 |
| 3 | rootL2_10136634 | 3300003322 | Bacteria | 3025 |
| 4 | JGI25405J52794_10098329 | 3300003911 | Bacteria | 651 |
| 5 | Ga0070658_10779035 | 3300005327 | Bacteria | 831 |
| 6 | Ga0070676_10457414 | 3300005328 | Bacteria | 899 |
| 7 | Ga0070676_10655095 | 3300005328 | Bacteria | 763 |
| 8 | Ga0070683_100739023 | 3300005329 | Bacteria | 943 |
| 9 | Ga0070690_100017084 | 3300005330 | Bacteria | 4356 |
| 10 | Ga0070690_100421095 | 3300005330 | Bacteria | 985 |
| 11 | Ga0070670_100061049 | 3300005331 | Bacteria | 3236 |
| 12 | Ga0070677_10004338 | 3300005333 | Bacteria | 4621 |
| 13 | Ga0068869_100186805 | 3300005334 | Bacteria | 1627 |
| 14 | Ga0068869_100276285 | 3300005334 | Bacteria | 1350 |
| 15 | Ga0070666_10046057 | 3300005335 | Bacteria | 2925 |
| 16 | Ga0070682_100060571 | 3300005337 | Bacteria | 2394 |
| 17 | Ga0070682_100122889 | 3300005337 | Bacteria | 1745 |
| 18 | Ga0070682_100150702 | 3300005337 | Bacteria | 1595 |
| 19 | Ga0070682_100238366 | 3300005337 | Bacteria | 1304 |
| 20 | Ga0070682_100419164 | 3300005337 | Bacteria | 1017 |
| 21 | Ga0070682_100450179 | 3300005337 | Bacteria | 986 |
| 22 | Ga0068868_100797699 | 3300005338 | Bacteria | 852 |
| 23 | Ga0068868_100828005 | 3300005338 | Bacteria | 837 |
| 24 | Ga0070660_100924318 | 3300005339 | Unclassified | 736 |
| 25 | Ga0070689_100135884 | 3300005340 | Bacteria | 1974 |
| 26 | Ga0070689_100216778 | 3300005340 | Bacteria | 1569 |
| 27 | Ga0070692_10542772 | 3300005345 | Unclassified | 760 |
| 28 | Ga0070668_100150202 | 3300005347 | Bacteria | 1883 |
| 29 | Ga0070668_100890178 | 3300005347 | Bacteria | 795 |
| 30 | Ga0070669_100154153 | 3300005353 | Bacteria | 1780 |
| 31 | Ga0070675_100008631 | 3300005354 | Bacteria | 7914 |
| 32 | Ga0070675_100097832 | 3300005354 | Bacteria | 2467 |
| 33 | Ga0070675_100230743 | 3300005354 | Bacteria | 1615 |
| 34 | Ga0070671_100224262 | 3300005355 | Bacteria | 1595 |
| 35 | Ga0070671_100589116 | 3300005355 | Bacteria | 961 |
| 36 | Ga0070671_100700185 | 3300005355 | Bacteria | 879 |
| 37 | Ga0070674_100027458 | 3300005356 | Bacteria | 3730 |
| 38 | Ga0070674_100294500 | 3300005356 | Bacteria | 1291 |
| 39 | Ga0070674_100487257 | 3300005356 | Bacteria | 1024 |
| 40 | Ga0070674_101082166 | 3300005356 | Bacteria | 707 |
| 41 | Ga0070673_100056936 | 3300005364 | Bacteria | 3087 |
| 42 | Ga0070673_100296814 | 3300005364 | Bacteria | 1422 |
| 43 | Ga0070688_100061524 | 3300005365 | Bacteria | 2374 |
| 44 | Ga0070688_100113865 | 3300005365 | Bacteria | 1803 |
| 45 | Ga0070688_100237685 | 3300005365 | Bacteria | 1291 |
| 46 | Ga0070688_100245150 | 3300005365 | Bacteria | 1274 |
| 47 | Ga0070659_100661819 | 3300005366 | Bacteria | 901 |
| 48 | Ga0070667_100000176 | 3300005367 | Bacteria | 79346 |
| 49 | Ga0070667_100556185 | 3300005367 | Bacteria | 1055 |
| 50 | Ga0070701_10007542 | 3300005438 | Bacteria | 4655 |
| 51 | Ga0070701_10104632 | 3300005438 | Bacteria | 1573 |
| 52 | Ga0070701_10747688 | 3300005438 | Unclassified | 662 |
| 53 | Ga0070705_100258337 | 3300005440 | Bacteria | 1227 |
| 54 | Ga0070700_100066679 | 3300005441 | Bacteria | 2285 |
| 55 | Ga0070700_100096534 | 3300005441 | Bacteria | 1939 |
| 56 | Ga0070700_100097691 | 3300005441 | Bacteria | 1929 |
| 57 | Ga0070700_100476109 | 3300005441 | Bacteria | 956 |
| 58 | Ga0070694_100259986 | 3300005444 | Bacteria | 1316 |
| 59 | Ga0070663_100107374 | 3300005455 | Bacteria | 2092 |
| 60 | Ga0070663_100731022 | 3300005455 | Bacteria | 844 |
| 61 | Ga0070678_100038470 | 3300005456 | Bacteria | 3368 |
| 62 | Ga0070662_100267720 | 3300005457 | Bacteria | 1379 |
| 63 | Ga0070681_10028459 | 3300005458 | Bacteria | 5619 |
| 64 | Ga0068867_100082564 | 3300005459 | Bacteria | 2424 |
| 65 | Ga0068867_100294371 | 3300005459 | Bacteria | 1336 |
| 66 | Ga0068867_100415254 | 3300005459 | Bacteria | 1138 |
| 67 | Ga0070685_10117258 | 3300005466 | Bacteria | 1649 |
| 68 | Ga0070685_10448206 | 3300005466 | Bacteria | 904 |
| 69 | Ga0070685_10518801 | 3300005466 | Bacteria | 846 |
| 70 | Ga0070679_100017664 | 3300005530 | Bacteria | 6906 |
| 71 | Ga0070679_100107875 | 3300005530 | Bacteria | 2770 |
| 72 | Ga0070679_100188625 | 3300005530 | Bacteria | 2031 |
| 73 | Ga0068853_100235854 | 3300005539 | Bacteria | 1675 |
| 74 | Ga0068853_100288012 | 3300005539 | Bacteria | 1516 |
| 75 | Ga0070672_100009398 | 3300005543 | Bacteria | 6739 |
| 76 | Ga0070672_100050470 | 3300005543 | Bacteria | 3240 |
| 77 | Ga0070672_100131242 | 3300005543 | Bacteria | 2059 |
| 78 | Ga0070672_100223884 | 3300005543 | Bacteria | 1578 |
| 79 | Ga0070672_100244305 | 3300005543 | Bacteria | 1511 |
| 80 | Ga0070672_100911650 | 3300005543 | Unclassified | 777 |
| 81 | Ga0070672_100989170 | 3300005543 | Bacteria | 745 |
| 82 | Ga0070686_100077514 | 3300005544 | Bacteria | 2192 |
| 83 | Ga0070686_100126445 | 3300005544 | Bacteria | 1762 |
| 84 | Ga0070686_100345963 | 3300005544 | Bacteria | 1115 |
| 85 | Ga0070695_100084847 | 3300005545 | Bacteria | 2102 |
| 86 | Ga0070695_100348949 | 3300005545 | Bacteria | 1108 |
| 87 | Ga0070696_100206770 | 3300005546 | Bacteria | 1468 |
| 88 | Ga0070693_100205852 | 3300005547 | Bacteria | 1281 |
| 89 | Ga0070693_100211155 | 3300005547 | Bacteria | 1266 |
| 90 | Ga0070693_101052624 | 3300005547 | Unclassified | 618 |
| 91 | Ga0070665_100009043 | 3300005548 | Bacteria | 10091 |
| 92 | Ga0070665_100016294 | 3300005548 | Bacteria | 7454 |
| 93 | Ga0070665_100626509 | 3300005548 | Bacteria | 1089 |
| 94 | Ga0070665_100645966 | 3300005548 | Bacteria | 1071 |
| 95 | Ga0068855_100002113 | 3300005563 | Bacteria | 24577 |
| 96 | Ga0068855_100965140 | 3300005563 | Bacteria | 897 |
| 97 | Ga0070664_100068541 | 3300005564 | Bacteria | 3033 |
| 98 | Ga0070664_100143272 | 3300005564 | Bacteria | 2106 |
| 99 | Ga0070664_100250555 | 3300005564 | Bacteria | 1592 |
| 100 | Ga0068857_100272860 | 3300005577 | Bacteria | 1555 |
| 101 | Ga0068857_100576410 | 3300005577 | Bacteria | 1062 |
| 102 | Ga0068857_100824575 | 3300005577 | Bacteria | 887 |
| 103 | Ga0068854_100342863 | 3300005578 | Bacteria | 1221 |
| 104 | Ga0068856_100385738 | 3300005614 | Bacteria | 1421 |
| 105 | Ga0070702_100082365 | 3300005615 | Bacteria | 1930 |
| 106 | Ga0070702_100161604 | 3300005615 | Bacteria | 1448 |
| 107 | Ga0068859_100055139 | 3300005617 | Bacteria | 4000 |
| 108 | Ga0068864_100077449 | 3300005618 | Bacteria | 2907 |
| 109 | Ga0068864_100398899 | 3300005618 | Bacteria | 1307 |
| 110 | Ga0068864_100841570 | 3300005618 | Bacteria | 904 |
| 111 | Ga0068864_101870477 | 3300005618 | Bacteria | 606 |
| 112 | Ga0068866_10477033 | 3300005718 | Bacteria | 821 |
| 113 | Ga0068861_100041772 | 3300005719 | Bacteria | 3435 |
| 114 | Ga0068861_100109577 | 3300005719 | Bacteria | 2210 |
| 115 | Ga0068861_100232065 | 3300005719 | Bacteria | 1566 |
| 116 | Ga0068861_100248209 | 3300005719 | Bacteria | 1517 |
| 117 | Ga0068861_100610368 | 3300005719 | Bacteria | 1003 |
| 118 | Ga0068861_101005583 | 3300005719 | Bacteria | 796 |
| 119 | Ga0068870_10003318 | 3300005840 | Bacteria | 6802 |
| 120 | Ga0068870_10090833 | 3300005840 | Bacteria | 1707 |
| 121 | Ga0068863_100042140 | 3300005841 | Bacteria | 4337 |
| 122 | Ga0068863_100538141 | 3300005841 | Bacteria | 1152 |
| 123 | Ga0068858_100126003 | 3300005842 | Bacteria | 2398 |
| 124 | Ga0068858_101296285 | 3300005842 | Bacteria | 717 |
| 125 | Ga0068860_100064276 | 3300005843 | Bacteria | 3486 |
| 126 | Ga0068860_100547029 | 3300005843 | Bacteria | 1160 |
| 127 | Ga0068860_100894818 | 3300005843 | Unclassified | 903 |
| 128 | Ga0068862_100022839 | 3300005844 | Bacteria | 5237 |
| 129 | Ga0068862_100052442 | 3300005844 | Bacteria | 3490 |
| 130 | Ga0068862_100177438 | 3300005844 | Bacteria | 1910 |
| 131 | Ga0068862_100539362 | 3300005844 | Bacteria | 1113 |
| 132 | Ga0068862_100579694 | 3300005844 | Bacteria | 1074 |
| 133 | Ga0068862_100587506 | 3300005844 | Bacteria | 1068 |
| 134 | Ga0068862_100985805 | 3300005844 | Unclassified | 833 |
| 135 | Ga0081455_10000043 | 3300005937 | Bacteria | 132283 |
| 136 | Ga0081539_10000046 | 3300005985 | Bacteria | 275677 |
| 137 | Ga0075364_10368643 | 3300006051 | Bacteria | 979 |
| 138 | Ga0075366_10272255 | 3300006195 | Bacteria | 1034 |
| 139 | Ga0075366_10594007 | 3300006195 | Unclassified | 686 |
| 140 | Ga0097621_100136360 | 3300006237 | Bacteria | 2093 |
| 141 | Ga0097621_100956915 | 3300006237 | Bacteria | 800 |
| 142 | Ga0068871_100163527 | 3300006358 | Bacteria | 1904 |
| 143 | Ga0068871_100690489 | 3300006358 | Bacteria | 934 |
| 144 | Ga0068871_100809597 | 3300006358 | Bacteria | 864 |
| 145 | Ga0075430_100703452 | 3300006846 | Bacteria | 833 |
| 146 | Ga0075430_100832018 | 3300006846 | Unclassified | 761 |
| 147 | Ga0097620_100055139 | 3300006931 | Bacteria | 4000 |
| 148 | Ga0105240_10087755 | 3300009093 | Bacteria | 3808 |
| 149 | Ga0105240_10220678 | 3300009093 | Bacteria | 2209 |
| 150 | Ga0105240_10224903 | 3300009093 | Bacteria | 2184 |
| 151 | Ga0111539_11292271 | 3300009094 | Bacteria | 847 |
| 152 | Ga0111539_11316361 | 3300009094 | Bacteria | 838 |
| 153 | Ga0105247_10053717 | 3300009101 | Bacteria | 2486 |
| 154 | Ga0105241_10090338 | 3300009174 | Bacteria | 2415 |
| 155 | Ga0105241_10318402 | 3300009174 | Bacteria | 1340 |
| 156 | Ga0105242_10081784 | 3300009176 | Bacteria | 2701 |
| 157 | Ga0105248_10021656 | 3300009177 | Bacteria | 7120 |
| 158 | Ga0105249_10396992 | 3300009553 | Bacteria | 1409 |
| 159 | Ga0105249_10481686 | 3300009553 | Bacteria | 1284 |
| 160 | Ga0105249_11479225 | 3300009553 | Bacteria | 751 |
| 161 | Ga0157370_10563248 | 3300013104 | Bacteria | 1044 |
| 162 | Ga0157370_10601993 | 3300013104 | Bacteria | 1006 |
| 163 | Ga0157369_10195482 | 3300013105 | Bacteria | 2124 |
| 164 | Ga0157369_10502190 | 3300013105 | Bacteria | 1255 |
| 165 | Ga0157374_10162161 | 3300013296 | Bacteria | 2177 |
| 166 | Ga0157378_10350234 | 3300013297 | Bacteria | 1442 |
| 167 | Ga0157378_10735128 | 3300013297 | Bacteria | 1008 |
| 168 | Ga0163162_10236403 | 3300013306 | Bacteria | 1957 |
| 169 | Ga0157375_10090106 | 3300013308 | Bacteria | 3125 |
| 170 | Ga0157375_10164058 | 3300013308 | Bacteria | 2365 |
| 171 | Ga0163163_10105747 | 3300014325 | Bacteria | 2840 |
| 172 | Ga0163163_10210142 | 3300014325 | Bacteria | 1995 |
| 173 | Ga0163163_10747095 | 3300014325 | Bacteria | 1042 |
| 174 | Ga0157380_10039703 | 3300014326 | Bacteria | 3662 |
| 175 | Ga0157380_10110967 | 3300014326 | Bacteria | 2305 |
| 176 | Ga0157380_10228342 | 3300014326 | Bacteria | 1670 |
| 177 | Ga0157380_10254413 | 3300014326 | Bacteria | 1592 |
| 178 | Ga0157380_10319309 | 3300014326 | Bacteria | 1439 |
| 179 | Ga0157380_10660759 | 3300014326 | Bacteria | 1044 |
| 180 | Ga0157380_10672488 | 3300014326 | Bacteria | 1036 |
| 181 | Ga0157380_10824981 | 3300014326 | Bacteria | 947 |
| 182 | Ga0157379_10073673 | 3300014968 | Bacteria | 3057 |
| 183 | Ga0157379_10288761 | 3300014968 | Bacteria | 1493 |
| 184 | Ga0157376_10114432 | 3300014969 | Bacteria | 2380 |
| 185 | Ga0163161_10183874 | 3300017792 | Bacteria | 1604 |
| 186 | Ga0163161_11000430 | 3300017792 | Unclassified | 714 |
| 187 | Ga0206353_11631158 | 3300020082 | Bacteria | 713 |
| 188 | Ga0224712_10234086 | 3300022467 | Bacteria | 844 |
| 189 | Ga0207682_10002366 | 3300025893 | Bacteria | 8494 |
| 190 | Ga0207682_10013765 | 3300025893 | Bacteria | 3149 |
| 191 | Ga0207642_10211627 | 3300025899 | Bacteria | 1078 |
| 192 | Ga0207642_10325873 | 3300025899 | Bacteria | 898 |
| 193 | Ga0207710_10066273 | 3300025900 | Bacteria | 1647 |
| 194 | Ga0207680_10040110 | 3300025903 | Bacteria | 2722 |
| 195 | Ga0207645_10077546 | 3300025907 | Bacteria | 2129 |
| 196 | Ga0207645_10374648 | 3300025907 | Bacteria | 955 |
| 197 | Ga0207643_10093669 | 3300025908 | Bacteria | 1754 |
| 198 | Ga0207643_10116469 | 3300025908 | Bacteria | 1578 |
| 199 | Ga0207643_10203468 | 3300025908 | Bacteria | 1206 |
| 200 | Ga0207654_10360528 | 3300025911 | Bacteria | 1003 |
| 201 | Ga0207707_10000045 | 3300025912 | Bacteria | 122598 |
| 202 | Ga0207707_10042089 | 3300025912 | Bacteria | 3988 |
| 203 | Ga0207695_10012566 | 3300025913 | Bacteria | 10147 |
| 204 | Ga0207695_10102911 | 3300025913 | Bacteria | 2848 |
| 205 | Ga0207660_10000958 | 3300025917 | Bacteria | 19113 |
| 206 | Ga0207662_10145603 | 3300025918 | Bacteria | 1503 |
| 207 | Ga0207649_10471042 | 3300025920 | Bacteria | 951 |
| 208 | Ga0207649_10544310 | 3300025920 | Bacteria | 887 |
| 209 | Ga0207652_10005918 | 3300025921 | Bacteria | 9893 |
| 210 | Ga0207652_10038374 | 3300025921 | Bacteria | 4061 |
| 211 | Ga0207652_10150658 | 3300025921 | Bacteria | 2083 |
| 212 | Ga0207652_10582934 | 3300025921 | Bacteria | 1004 |
| 213 | Ga0207681_10136591 | 3300025923 | Bacteria | 1820 |
| 214 | Ga0207694_10088383 | 3300025924 | Bacteria | 2443 |
| 215 | Ga0207659_10162525 | 3300025926 | Bacteria | 1755 |
| 216 | Ga0207659_10215956 | 3300025926 | Bacteria | 1539 |
| 217 | Ga0207659_10312457 | 3300025926 | Bacteria | 1294 |
| 218 | Ga0207644_10673207 | 3300025931 | Bacteria | 862 |
| 219 | Ga0207706_10294841 | 3300025933 | Bacteria | 1414 |
| 220 | Ga0207706_10506445 | 3300025933 | Bacteria | 1042 |
| 221 | Ga0207686_10092712 | 3300025934 | Bacteria | 1998 |
| 222 | Ga0207670_10190796 | 3300025936 | Bacteria | 1550 |
| 223 | Ga0207670_10278011 | 3300025936 | Bacteria | 1304 |
| 224 | Ga0207669_10054280 | 3300025937 | Bacteria | 2419 |
| 225 | Ga0207704_10423923 | 3300025938 | Bacteria | 1055 |
| 226 | Ga0207691_10007146 | 3300025940 | Bacteria | 10773 |
| 227 | Ga0207691_10009176 | 3300025940 | Bacteria | 9493 |
| 228 | Ga0207691_10022186 | 3300025940 | Bacteria | 5988 |
| 229 | Ga0207691_10211420 | 3300025940 | Bacteria | 1685 |
| 230 | Ga0207711_10262616 | 3300025941 | Bacteria | 1587 |
| 231 | Ga0207689_10036574 | 3300025942 | Bacteria | 4075 |
| 232 | Ga0207689_10104309 | 3300025942 | Bacteria | 2329 |
| 233 | Ga0207689_10149889 | 3300025942 | Bacteria | 1922 |
| 234 | Ga0207661_10860707 | 3300025944 | Bacteria | 835 |
| 235 | Ga0207679_10061578 | 3300025945 | Bacteria | 2793 |
| 236 | Ga0207679_10597979 | 3300025945 | Bacteria | 994 |
| 237 | Ga0207679_10799447 | 3300025945 | Bacteria | 860 |
| 238 | Ga0207667_10000887 | 3300025949 | Bacteria | 38097 |
| 239 | Ga0207667_10864694 | 3300025949 | Bacteria | 898 |
| 240 | Ga0207712_10761307 | 3300025961 | Bacteria | 849 |
| 241 | Ga0207668_10184514 | 3300025972 | Bacteria | 1648 |
| 242 | Ga0207668_10460776 | 3300025972 | Bacteria | 1087 |
| 243 | Ga0207668_10817278 | 3300025972 | Unclassified | 826 |
| 244 | Ga0207658_10000236 | 3300025986 | Bacteria | 58435 |
| 245 | Ga0207658_10898505 | 3300025986 | Unclassified | 806 |
| 246 | Ga0207677_11050741 | 3300026023 | Unclassified | 740 |
| 247 | Ga0207703_10889327 | 3300026035 | Bacteria | 853 |
| 248 | Ga0207639_10361519 | 3300026041 | Bacteria | 1299 |
| 249 | Ga0207639_10400199 | 3300026041 | Bacteria | 1237 |
| 250 | Ga0207639_10546565 | 3300026041 | Bacteria | 1063 |
| 251 | Ga0207678_10228677 | 3300026067 | Bacteria | 1592 |
| 252 | Ga0207708_10028376 | 3300026075 | Bacteria | 4239 |
| 253 | Ga0207708_10126314 | 3300026075 | Unclassified | 1996 |
| 254 | Ga0207708_10210144 | 3300026075 | Bacteria | 1555 |
| 255 | Ga0207708_10423637 | 3300026075 | Bacteria | 1104 |
| 256 | Ga0207708_10604302 | 3300026075 | Bacteria | 929 |
| 257 | Ga0207702_10598521 | 3300026078 | Bacteria | 1082 |
| 258 | Ga0207641_10013278 | 3300026088 | Bacteria | 6757 |
| 259 | Ga0207641_10272479 | 3300026088 | Bacteria | 1588 |
| 260 | Ga0207641_10865592 | 3300026088 | Bacteria | 896 |
| 261 | Ga0207648_10018003 | 3300026089 | Bacteria | 6404 |
| 262 | Ga0207648_10181872 | 3300026089 | Bacteria | 1861 |
| 263 | Ga0207676_10071814 | 3300026095 | Bacteria | 2780 |
| 264 | Ga0207676_10491475 | 3300026095 | Bacteria | 1164 |
| 265 | Ga0207676_10760646 | 3300026095 | Bacteria | 943 |
| 266 | Ga0207674_10294709 | 3300026116 | Bacteria | 1571 |
| 267 | Ga0207674_10366087 | 3300026116 | Bacteria | 1393 |
| 268 | Ga0207675_100012250 | 3300026118 | Bacteria | 8010 |
| 269 | Ga0207675_100015078 | 3300026118 | Bacteria | 7210 |
| 270 | Ga0207675_100275016 | 3300026118 | Bacteria | 1635 |
| 271 | Ga0207675_100436965 | 3300026118 | Bacteria | 1295 |
| 272 | Ga0207675_100519905 | 3300026118 | Bacteria | 1186 |
| 273 | Ga0207675_100774143 | 3300026118 | Bacteria | 972 |
| 274 | Ga0207683_10406031 | 3300026121 | Bacteria | 1254 |
| 275 | Ga0207683_10406628 | 3300026121 | Bacteria | 1253 |
| 276 | Ga0268266_10131761 | 3300028379 | Bacteria | 2236 |
| 277 | Ga0268266_10683100 | 3300028379 | Bacteria | 989 |
| 278 | Ga0268265_10020321 | 3300028380 | Bacteria | 4634 |
| 279 | Ga0268265_10184547 | 3300028380 | Bacteria | 1796 |
| 280 | Ga0268265_10605335 | 3300028380 | Bacteria | 1048 |
| 281 | Ga0268265_10663932 | 3300028380 | Bacteria | 1003 |
| 282 | Ga0268265_10803455 | 3300028380 | Bacteria | 917 |
| 283 | Ga0268264_11081588 | 3300028381 | Unclassified | 810 |
| 284 | Ga0307515_10012639 | 3300028794 | Bacteria | 15860 |
| 285 | Ga0307515_10269418 | 3300028794 | Bacteria | 1426 |
| 286 | Ga0307515_10386588 | 3300028794 | Bacteria | 1030 |
| 287 | Ga0307513_10037044 | 3300031456 | Bacteria | 5432 |
| 288 | Ga0307513_10071890 | 3300031456 | Bacteria | 3608 |
| 289 | Ga0307513_10085124 | 3300031456 | Bacteria | 3245 |
| 290 | Ga0307513_10105536 | 3300031456 | Bacteria | 2826 |
| 291 | Ga0307509_10009871 | 3300031507 | Bacteria | 11810 |
| 292 | Ga0307509_10088983 | 3300031507 | Bacteria | 3168 |
| 293 | Ga0307509_10500715 | 3300031507 | Bacteria | 899 |
| 294 | Ga0307509_10533882 | 3300031507 | Unclassified | 853 |
| 295 | Ga0307408_100031000 | 3300031548 | Bacteria | 3719 |
| 296 | Ga0307408_100371345 | 3300031548 | Bacteria | 1220 |
| 297 | Ga0307408_100578587 | 3300031548 | Bacteria | 995 |
| 298 | Ga0307408_101495561 | 3300031548 | Unclassified | 638 |
| 299 | Ga0307405_10029249 | 3300031731 | Bacteria | 3219 |
| 300 | Ga0307413_10004180 | 3300031824 | Bacteria | 6236 |
| 301 | Ga0307413_10210307 | 3300031824 | Bacteria | 1412 |
| 302 | Ga0307410_10007402 | 3300031852 | Bacteria | 6006 |
| 303 | Ga0307410_10012046 | 3300031852 | Bacteria | 4977 |
| 304 | Ga0307406_10060544 | 3300031901 | Bacteria | 2442 |
| 305 | Ga0307406_11057890 | 3300031901 | Unclassified | 699 |
| 306 | Ga0307407_10002873 | 3300031903 | Bacteria | 6882 |
| 307 | Ga0307407_10298936 | 3300031903 | Bacteria | 1122 |
| 308 | Ga0307407_10705328 | 3300031903 | Bacteria | 760 |
| 309 | Ga0307412_10294425 | 3300031911 | Bacteria | 1280 |
| 310 | Ga0307409_100007401 | 3300031995 | Bacteria | 6565 |
| 311 | Ga0307409_100008601 | 3300031995 | Bacteria | 6209 |
| 312 | Ga0307409_100047806 | 3300031995 | Bacteria | 3251 |
| 313 | Ga0307416_100325860 | 3300032002 | Bacteria | 1541 |
| 314 | Ga0307416_100346711 | 3300032002 | Bacteria | 1501 |
| 315 | Ga0307416_100365278 | 3300032002 | Bacteria | 1467 |
| 316 | Ga0307411_10013209 | 3300032005 | Bacteria | 4545 |
| 317 | Ga0307415_100175323 | 3300032126 | Bacteria | 1676 |
| 318 | Ga0307415_100326378 | 3300032126 | Bacteria | 1282 |
| 319 | Ga0307415_100352120 | 3300032126 | Bacteria | 1240 |
| 320 | Ga0373954_0074319 | 3300035118 | Bacteria | 1618 |
| 321 | Ga0373955_0116405 | 3300035172 | Bacteria | 1550 |
| 322 | Ga0451787_048931 | 3300041441 | Bacteria | 2706 |
| 323 | Ga0451789_1140445 | 3300041443 | Bacteria | 1393 |
| 324 | Ga0451791_0388950 | 3300041451 | Bacteria | 1497 |
| 325 | Ga0451793_1259970 | 3300041452 | Bacteria | 862 |
| 326 | Ga0451793_1369791 | 3300041452 | Bacteria | 1566 |
| 327 | Ga0451793_1523224 | 3300041452 | Bacteria | 2325 |
| 328 | Ga0451797_0747851 | 3300041453 | Bacteria | 1305 |
| 329 | Ga0451797_0956248 | 3300041453 | Bacteria | 1205 |
| 330 | Ga0451800_0426383 | 3300041459 | Bacteria | 2175 |
| 331 | Ga0451802_0367945 | 3300041460 | Bacteria | 4799 |
| 332 | Ga0451802_2139266 | 3300041460 | Bacteria | 1130 |
| 333 | Ga0451804_0961374 | 3300041463 | Bacteria | 878 |
| 334 | Ga0451807_0235429 | 3300041486 | Bacteria | 5584 |
| 335 | Ga0451807_0309231 | 3300041486 | Unclassified | 745 |
| 336 | Ga0451807_0349479 | 3300041486 | Bacteria | 883 |
| 337 | Ga0451807_2134497 | 3300041486 | Bacteria | 821 |
| 338 | Ga0451833_0264962 | 3300041491 | Bacteria | 1209 |
| 339 | Ga0451837_1285619 | 3300041494 | Bacteria | 917 |
| 340 | Ga0451853_3282110 | 3300041512 | Bacteria | 1308 |
| 341 | Ga0439454_010856 | 3300042011 | Bacteria | 1207 |
| 342 | Ga0450911_030735 | 3300042115 | Bacteria | 696 |
| 343 | Ga0466972_0048879 | 3300044658 | Bacteria | 2043 |
| 344 | Ga0466960_0672965 | 3300044901 | Bacteria | 619 |
| 345 | Ga0495590_0000646 | 3300046457 | Bacteria | 16170 |
| 346 | Ga0495590_0191326 | 3300046457 | Unclassified | 750 |
| 347 | Ga0495638_0007531 | 3300046460 | Bacteria | 7792 |
| 348 | Ga0495638_0035624 | 3300046460 | Bacteria | 3172 |
| 349 | Ga0495596_0134681 | 3300046500 | Bacteria | 959 |
| 350 | Ga0495596_0328786 | 3300046500 | Unclassified | 595 |
| 351 | Ga0495583_0268684 | 3300046506 | Unclassified | 681 |
| 352 | Ga0495616_0001194 | 3300046513 | Bacteria | 18313 |
| 353 | Ga0495632_0016452 | 3300046519 | Bacteria | 4114 |
| 354 | Ga0495598_0234068 | 3300046537 | Unclassified | 675 |
| 355 | Ga0495668_0147499 | 3300046616 | Bacteria | 1288 |
| 356 | Ga0495625_0065605 | 3300046660 | Bacteria | 2559 |
| 357 | Ga0495625_0182579 | 3300046660 | Bacteria | 1394 |
| 358 | Ga0495625_0216356 | 3300046660 | Bacteria | 1257 |
| 359 | Ga0495625_0322814 | 3300046660 | Bacteria | 983 |
| 360 | Ga0495649_0141765 | 3300046694 | Bacteria | 1265 |
| 361 | Ga0495686_0029418 | 3300047472 | Bacteria | 3574 |
| 362 | Ga0495626_0206113 | 3300048091 | Bacteria | 804 |
| 363 | Ga0496114_1071311 | 3300048917 | Bacteria | 690 |
| 364 | Ga0501039_0451852 | 3300049575 | Bacteria | 1009 |
| 365 | Ga0501042_0126150 | 3300049578 | Bacteria | 1843 |
| 366 | Ga0501068_0000333 | 3300049584 | Bacteria | 23681 |
| 367 | Ga0501070_0030361 | 3300049586 | Bacteria | 4529 |
| 368 | Ga0501071_0002373 | 3300049587 | Bacteria | 11404 |
| 369 | Ga0501071_0197291 | 3300049587 | Bacteria | 1511 |
| 370 | Ga0501071_0693202 | 3300049587 | Bacteria | 784 |
| 371 | Ga0501073_0453108 | 3300049589 | Bacteria | 887 |
| 372 | Ga0501074_0005826 | 3300049590 | Bacteria | 8886 |
| 373 | Ga0501075_0806231 | 3300049591 | Unclassified | 714 |
| 374 | Ga0501076_0026391 | 3300049592 | Bacteria | 4500 |
| 375 | Ga0501077_0009480 | 3300049593 | Bacteria | 6052 |
| 376 | Ga0501079_0001264 | 3300049741 | Bacteria | 17746 |
| 377 | Ga0501080_0002029 | 3300049742 | Bacteria | 17504 |
| 378 | Ga0501080_0229364 | 3300049742 | Bacteria | 1698 |
| 379 | Ga0501083_0133347 | 3300049744 | Bacteria | 1628 |
| 380 | Ga0501083_0632893 | 3300049744 | Bacteria | 696 |
| 381 | nmdc:mga08y16_425045_c1 | 3300050511 | Bacteria | 1357 |
| 382 | nmdc:mga08y16_440293_c1 | 3300050511 | Bacteria | 1330 |
| 383 | Ga0500643_067457 | 3300053087 | Bacteria | 996 |
| 384 | Ga0500646_0023732 | 3300053090 | Bacteria | 1647 |
| 385 | Ga0500646_0089478 | 3300053090 | Bacteria | 951 |
| 386 | Ga0500583_0039283 | 3300053092 | Bacteria | 2136 |
| 387 | Ga0500641_0023639 | 3300053096 | Bacteria | 2366 |
| 388 | Ga0500641_0172366 | 3300053096 | Bacteria | 931 |
| 389 | Ga0500556_0049332 | 3300053104 | Bacteria | 1517 |
| 390 | Ga0500562_084783 | 3300053108 | Bacteria | 858 |
| 391 | Ga0500617_139742 | 3300053124 | Bacteria | 973 |
| 392 | Ga0500642_0008051 | 3300053130 | Bacteria | 3582 |
| 393 | Ga0500642_0060500 | 3300053130 | Bacteria | 1699 |
| 394 | Ga0500658_0060132 | 3300053134 | Bacteria | 1578 |
| 395 | Ga0500568_0135211 | 3300053139 | Bacteria | 915 |
| 396 | Ga0500568_0244002 | 3300053139 | Bacteria | 654 |
| 397 | Ga0500588_0030465 | 3300053146 | Bacteria | 1548 |
| 398 | Ga0500588_0167037 | 3300053146 | Bacteria | 803 |
| 399 | Ga0500589_097059 | 3300053147 | Bacteria | 1287 |
| 400 | Ga0500616_0000569 | 3300053153 | Bacteria | 45203 |
| 401 | Ga0500616_0038781 | 3300053153 | Bacteria | 2571 |
| 402 | Ga0500622_0001101 | 3300053156 | Bacteria | 22477 |
| 403 | Ga0500622_0005155 | 3300053156 | Bacteria | 7921 |
| 404 | Ga0500622_0007124 | 3300053156 | Bacteria | 6382 |
| 405 | Ga0500611_109377 | 3300053727 | Bacteria | 725 |
| 406 | Ga0500656_002022 | 3300053732 | Bacteria | 1805 |
| 407 | Ga0501084_0004825 | 3300054114 | Bacteria | 11019 |
| 408 | Ga0501082_0039668 | 3300060353 | Bacteria | 4062 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049587 | Ga0501071_0693202 | Ga0501071_0693202_277_756 | 153 |
| 2 | 3300032002 | Ga0307416_100346711 | Ga0307416_1003467111 | 154 |
| 3 | 3300053139 | Ga0500568_0135211 | Ga0500568_0135211_257_778 | 157 |
| 4 | 3300053156 | Ga0500622_0005155 | Ga0500622_0005155_819_1340 | 157 |
| 5 | 3300028794 | Ga0307515_10012639 | Ga0307515_1001263912 | 159 |
| 6 | 3300005544 | Ga0070686_100077514 | Ga0070686_1000775142 | 164 |
| 7 | 3300035118 | Ga0373954_0074319 | Ga0373954_0074319_243_803 | 164 |
| 8 | 3300035172 | Ga0373955_0116405 | Ga0373955_0116405_818_1378 | 164 |
| 9 | 3300005466 | Ga0070685_10518801 | Ga0070685_105188011 | 165 |
| 10 | 3300041453 | Ga0451797_0956248 | Ga0451797_0956248_387_935 | 165 |
| 11 | 3300049744 | Ga0501083_0632893 | Ga0501083_0632893_14_511 | 165 |
| 12 | 3300053124 | Ga0500617_139742 | Ga0500617_139742_466_963 | 165 |
| 13 | 3300053147 | Ga0500589_097059 | Ga0500589_097059_26_523 | 165 |
| 14 | 3300005548 | Ga0070665_100626509 | Ga0070665_1006265092 | 167 |
| 15 | 3300028379 | Ga0268266_10683100 | Ga0268266_106831001 | 167 |
| 16 | 3300046660 | Ga0495625_0322814 | Ga0495625_0322814_281_799 | 167 |
| 17 | 3300053087 | Ga0500643_067457 | Ga0500643_067457_42_560 | 167 |
| 18 | 3300053108 | Ga0500562_084783 | Ga0500562_084783_106_624 | 167 |
| 19 | 3300053139 | Ga0500568_0244002 | Ga0500568_0244002_34_552 | 167 |
| 20 | 3300053156 | Ga0500622_0001101 | Ga0500622_0001101_7554_8072 | 167 |
| 21 | 3300053156 | Ga0500622_0007124 | Ga0500622_0007124_2068_2595 | 167 |
| 22 | 3300005330 | Ga0070690_100421095 | Ga0070690_1004210951 | 168 |
| 23 | 3300005333 | Ga0070677_10004338 | Ga0070677_100043383 | 168 |
| 24 | 3300005334 | Ga0068869_100186805 | Ga0068869_1001868052 | 168 |
| 25 | 3300005337 | Ga0070682_100060571 | Ga0070682_1000605711 | 168 |
| 26 | 3300005337 | Ga0070682_100238366 | Ga0070682_1002383662 | 168 |
| 27 | 3300005338 | Ga0068868_100828005 | Ga0068868_1008280051 | 168 |
| 28 | 3300005353 | Ga0070669_100154153 | Ga0070669_1001541532 | 168 |
| 29 | 3300005354 | Ga0070675_100008631 | Ga0070675_1000086317 | 168 |
| 30 | 3300005365 | Ga0070688_100245150 | Ga0070688_1002451501 | 168 |
| 31 | 3300005441 | Ga0070700_100097691 | Ga0070700_1000976912 | 168 |
| 32 | 3300005455 | Ga0070663_100731022 | Ga0070663_1007310221 | 168 |
| 33 | 3300005539 | Ga0068853_100235854 | Ga0068853_1002358542 | 168 |
| 34 | 3300005543 | Ga0070672_100050470 | Ga0070672_1000504702 | 168 |
| 35 | 3300005543 | Ga0070672_100911650 | Ga0070672_1009116501 | 168 |
| 36 | 3300005618 | Ga0068864_100398899 | Ga0068864_1003988992 | 168 |
| 37 | 3300005840 | Ga0068870_10003318 | Ga0068870_100033188 | 168 |
| 38 | 3300005841 | Ga0068863_100538141 | Ga0068863_1005381412 | 168 |
| 39 | 3300006358 | Ga0068871_100163527 | Ga0068871_1001635272 | 168 |
| 40 | 3300006358 | Ga0068871_100690489 | Ga0068871_1006904892 | 168 |
| 41 | 3300009176 | Ga0105242_10081784 | Ga0105242_100817843 | 168 |
| 42 | 3300009177 | Ga0105248_10021656 | Ga0105248_100216567 | 168 |
| 43 | 3300009553 | Ga0105249_10396992 | Ga0105249_103969922 | 168 |
| 44 | 3300013296 | Ga0157374_10162161 | Ga0157374_101621612 | 168 |
| 45 | 3300013297 | Ga0157378_10350234 | Ga0157378_103502342 | 168 |
| 46 | 3300013306 | Ga0163162_10236403 | Ga0163162_102364032 | 168 |
| 47 | 3300013308 | Ga0157375_10090106 | Ga0157375_100901062 | 168 |
| 48 | 3300014325 | Ga0163163_10210142 | Ga0163163_102101422 | 168 |
| 49 | 3300014968 | Ga0157379_10288761 | Ga0157379_102887612 | 168 |
| 50 | 3300014969 | Ga0157376_10114432 | Ga0157376_101144322 | 168 |
| 51 | 3300017792 | Ga0163161_10183874 | Ga0163161_101838742 | 168 |
| 52 | 3300025893 | Ga0207682_10013765 | Ga0207682_100137652 | 168 |
| 53 | 3300025908 | Ga0207643_10116469 | Ga0207643_101164692 | 168 |
| 54 | 3300025923 | Ga0207681_10136591 | Ga0207681_101365912 | 168 |
| 55 | 3300025933 | Ga0207706_10506445 | Ga0207706_105064451 | 168 |
| 56 | 3300025934 | Ga0207686_10092712 | Ga0207686_100927122 | 168 |
| 57 | 3300025937 | Ga0207669_10054280 | Ga0207669_100542802 | 168 |
| 58 | 3300025938 | Ga0207704_10423923 | Ga0207704_104239232 | 168 |
| 59 | 3300025940 | Ga0207691_10007146 | Ga0207691_100071464 | 168 |
| 60 | 3300025941 | Ga0207711_10262616 | Ga0207711_102626162 | 168 |
| 61 | 3300025942 | Ga0207689_10036574 | Ga0207689_100365742 | 168 |
| 62 | 3300025972 | Ga0207668_10184514 | Ga0207668_101845142 | 168 |
| 63 | 3300026023 | Ga0207677_11050741 | Ga0207677_110507411 | 168 |
| 64 | 3300026041 | Ga0207639_10546565 | Ga0207639_105465652 | 168 |
| 65 | 3300026067 | Ga0207678_10228677 | Ga0207678_102286772 | 168 |
| 66 | 3300026075 | Ga0207708_10210144 | Ga0207708_102101442 | 168 |
| 67 | 3300026088 | Ga0207641_10272479 | Ga0207641_102724792 | 168 |
| 68 | 3300026089 | Ga0207648_10018003 | Ga0207648_100180032 | 168 |
| 69 | 3300026095 | Ga0207676_10491475 | Ga0207676_104914752 | 168 |
| 70 | 3300026118 | Ga0207675_100436965 | Ga0207675_1004369652 | 168 |
| 71 | 3300026118 | Ga0207675_100519905 | Ga0207675_1005199051 | 168 |
| 72 | 3300026121 | Ga0207683_10406031 | Ga0207683_104060312 | 168 |
| 73 | 3300041443 | Ga0451789_1140445 | Ga0451789_1140445_506_1072 | 168 |
| 74 | 3300046460 | Ga0495638_0007531 | Ga0495638_0007531_4432_4983 | 168 |
| 75 | 3300046500 | Ga0495596_0134681 | Ga0495596_0134681_279_845 | 168 |
| 76 | 3300047472 | Ga0495686_0029418 | Ga0495686_0029418_1229_1777 | 168 |
| 77 | 3300014326 | Ga0157380_10660759 | Ga0157380_106607592 | 171 |
| 78 | 3300041452 | Ga0451793_1523224 | Ga0451793_1523224_618_1166 | 171 |
| 79 | 3300041486 | Ga0451807_2134497 | Ga0451807_2134497_243_791 | 171 |
| 80 | 3300006846 | Ga0075430_100703452 | Ga0075430_1007034522 | 172 |
| 81 | 3300046500 | Ga0495596_0328786 | Ga0495596_0328786_41_580 | 172 |
| 82 | 3300005335 | Ga0070666_10046057 | Ga0070666_100460572 | 173 |
| 83 | 3300005367 | Ga0070667_100000176 | Ga0070667_10000017681 | 173 |
| 84 | 3300009101 | Ga0105247_10053717 | Ga0105247_100537173 | 173 |
| 85 | 3300014325 | Ga0163163_10105747 | Ga0163163_101057472 | 173 |
| 86 | 3300014968 | Ga0157379_10073673 | Ga0157379_100736732 | 173 |
| 87 | 3300025900 | Ga0207710_10066273 | Ga0207710_100662732 | 173 |
| 88 | 3300025903 | Ga0207680_10040110 | Ga0207680_100401102 | 173 |
| 89 | 3300025986 | Ga0207658_10000236 | Ga0207658_1000023615 | 173 |
| 90 | 3300053090 | Ga0500646_0023732 | Ga0500646_0023732_109_633 | 173 |
| 91 | 3300005347 | Ga0070668_100890178 | Ga0070668_1008901781 | 174 |
| 92 | 3300041452 | Ga0451793_1259970 | Ga0451793_1259970_252_800 | 174 |
| 93 | 3300046506 | Ga0495583_0268684 | Ga0495583_0268684_85_612 | 174 |
| 94 | 3300042115 | Ga0450911_030735 | Ga0450911_030735_124_669 | 175 |
| 95 | 3300049578 | Ga0501042_0126150 | Ga0501042_0126150_599_1150 | 175 |
| 96 | 3300005843 | Ga0068860_100064276 | Ga0068860_1000642762 | 177 |
| 97 | 3300031456 | Ga0307513_10037044 | Ga0307513_100370444 | 177 |
| 98 | 3300003322 | rootL2_10022271 | rootL2_100222711 | 178 |
| 99 | 3300003322 | rootL2_10136634 | rootL2_101366343 | 178 |
| 100 | 3300005328 | Ga0070676_10457414 | Ga0070676_104574141 | 178 |
| 101 | 3300005328 | Ga0070676_10655095 | Ga0070676_106550951 | 178 |
| 102 | 3300005329 | Ga0070683_100739023 | Ga0070683_1007390232 | 178 |
| 103 | 3300005330 | Ga0070690_100017084 | Ga0070690_1000170845 | 178 |
| 104 | 3300005331 | Ga0070670_100061049 | Ga0070670_1000610494 | 178 |
| 105 | 3300005334 | Ga0068869_100276285 | Ga0068869_1002762852 | 178 |
| 106 | 3300005337 | Ga0070682_100122889 | Ga0070682_1001228892 | 178 |
| 107 | 3300005337 | Ga0070682_100150702 | Ga0070682_1001507022 | 178 |
| 108 | 3300005337 | Ga0070682_100419164 | Ga0070682_1004191641 | 178 |
| 109 | 3300005338 | Ga0068868_100797699 | Ga0068868_1007976991 | 178 |
| 110 | 3300005339 | Ga0070660_100924318 | Ga0070660_1009243181 | 178 |
| 111 | 3300005340 | Ga0070689_100135884 | Ga0070689_1001358843 | 178 |
| 112 | 3300005340 | Ga0070689_100216778 | Ga0070689_1002167782 | 178 |
| 113 | 3300005345 | Ga0070692_10542772 | Ga0070692_105427721 | 178 |
| 114 | 3300005347 | Ga0070668_100150202 | Ga0070668_1001502022 | 178 |
| 115 | 3300005354 | Ga0070675_100097832 | Ga0070675_1000978322 | 178 |
| 116 | 3300005354 | Ga0070675_100230743 | Ga0070675_1002307432 | 178 |
| 117 | 3300005355 | Ga0070671_100224262 | Ga0070671_1002242622 | 178 |
| 118 | 3300005355 | Ga0070671_100589116 | Ga0070671_1005891161 | 178 |
| 119 | 3300005355 | Ga0070671_100700185 | Ga0070671_1007001852 | 178 |
| 120 | 3300005356 | Ga0070674_100027458 | Ga0070674_1000274582 | 178 |
| 121 | 3300005356 | Ga0070674_100294500 | Ga0070674_1002945002 | 178 |
| 122 | 3300005356 | Ga0070674_100487257 | Ga0070674_1004872572 | 178 |
| 123 | 3300005364 | Ga0070673_100056936 | Ga0070673_1000569362 | 178 |
| 124 | 3300005364 | Ga0070673_100296814 | Ga0070673_1002968142 | 178 |
| 125 | 3300005365 | Ga0070688_100061524 | Ga0070688_1000615243 | 178 |
| 126 | 3300005365 | Ga0070688_100113865 | Ga0070688_1001138652 | 178 |
| 127 | 3300005365 | Ga0070688_100237685 | Ga0070688_1002376851 | 178 |
| 128 | 3300005366 | Ga0070659_100661819 | Ga0070659_1006618191 | 178 |
| 129 | 3300005367 | Ga0070667_100556185 | Ga0070667_1005561852 | 178 |
| 130 | 3300005438 | Ga0070701_10007542 | Ga0070701_100075422 | 178 |
| 131 | 3300005438 | Ga0070701_10104632 | Ga0070701_101046322 | 178 |
| 132 | 3300005438 | Ga0070701_10747688 | Ga0070701_107476881 | 178 |
| 133 | 3300005440 | Ga0070705_100258337 | Ga0070705_1002583372 | 178 |
| 134 | 3300005441 | Ga0070700_100066679 | Ga0070700_1000666791 | 178 |
| 135 | 3300005441 | Ga0070700_100096534 | Ga0070700_1000965342 | 178 |
| 136 | 3300005441 | Ga0070700_100476109 | Ga0070700_1004761091 | 178 |
| 137 | 3300005444 | Ga0070694_100259986 | Ga0070694_1002599862 | 178 |
| 138 | 3300005455 | Ga0070663_100107374 | Ga0070663_1001073742 | 178 |
| 139 | 3300005456 | Ga0070678_100038470 | Ga0070678_1000384704 | 178 |
| 140 | 3300005457 | Ga0070662_100267720 | Ga0070662_1002677202 | 178 |
| 141 | 3300005459 | Ga0068867_100082564 | Ga0068867_1000825642 | 178 |
| 142 | 3300005459 | Ga0068867_100294371 | Ga0068867_1002943711 | 178 |
| 143 | 3300005459 | Ga0068867_100415254 | Ga0068867_1004152542 | 178 |
| 144 | 3300005466 | Ga0070685_10117258 | Ga0070685_101172582 | 178 |
| 145 | 3300005466 | Ga0070685_10448206 | Ga0070685_104482062 | 178 |
| 146 | 3300005539 | Ga0068853_100288012 | Ga0068853_1002880122 | 178 |
| 147 | 3300005543 | Ga0070672_100009398 | Ga0070672_1000093983 | 178 |
| 148 | 3300005543 | Ga0070672_100131242 | Ga0070672_1001312422 | 178 |
| 149 | 3300005543 | Ga0070672_100223884 | Ga0070672_1002238842 | 178 |
| 150 | 3300005543 | Ga0070672_100244305 | Ga0070672_1002443052 | 178 |
| 151 | 3300005544 | Ga0070686_100126445 | Ga0070686_1001264452 | 178 |
| 152 | 3300005544 | Ga0070686_100345963 | Ga0070686_1003459632 | 178 |
| 153 | 3300005545 | Ga0070695_100084847 | Ga0070695_1000848472 | 178 |
| 154 | 3300005546 | Ga0070696_100206770 | Ga0070696_1002067702 | 178 |
| 155 | 3300005547 | Ga0070693_100211155 | Ga0070693_1002111552 | 178 |
| 156 | 3300005547 | Ga0070693_101052624 | Ga0070693_1010526241 | 178 |
| 157 | 3300005548 | Ga0070665_100016294 | Ga0070665_1000162942 | 178 |
| 158 | 3300005564 | Ga0070664_100068541 | Ga0070664_1000685414 | 178 |
| 159 | 3300005564 | Ga0070664_100143272 | Ga0070664_1001432721 | 178 |
| 160 | 3300005564 | Ga0070664_100250555 | Ga0070664_1002505552 | 178 |
| 161 | 3300005577 | Ga0068857_100272860 | Ga0068857_1002728602 | 178 |
| 162 | 3300005577 | Ga0068857_100576410 | Ga0068857_1005764102 | 178 |
| 163 | 3300005577 | Ga0068857_100824575 | Ga0068857_1008245752 | 178 |
| 164 | 3300005578 | Ga0068854_100342863 | Ga0068854_1003428632 | 178 |
| 165 | 3300005615 | Ga0070702_100082365 | Ga0070702_1000823652 | 178 |
| 166 | 3300005615 | Ga0070702_100161604 | Ga0070702_1001616042 | 178 |
| 167 | 3300005617 | Ga0068859_100055139 | Ga0068859_1000551394 | 178 |
| 168 | 3300005618 | Ga0068864_100077449 | Ga0068864_1000774492 | 178 |
| 169 | 3300005618 | Ga0068864_100841570 | Ga0068864_1008415702 | 178 |
| 170 | 3300005718 | Ga0068866_10477033 | Ga0068866_104770331 | 178 |
| 171 | 3300005719 | Ga0068861_100041772 | Ga0068861_1000417724 | 178 |
| 172 | 3300005719 | Ga0068861_100109577 | Ga0068861_1001095772 | 178 |
| 173 | 3300005719 | Ga0068861_100232065 | Ga0068861_1002320652 | 178 |
| 174 | 3300005719 | Ga0068861_100248209 | Ga0068861_1002482092 | 178 |
| 175 | 3300005719 | Ga0068861_100610368 | Ga0068861_1006103682 | 178 |
| 176 | 3300005840 | Ga0068870_10090833 | Ga0068870_100908332 | 178 |
| 177 | 3300005841 | Ga0068863_100042140 | Ga0068863_1000421404 | 178 |
| 178 | 3300005842 | Ga0068858_100126003 | Ga0068858_1001260032 | 178 |
| 179 | 3300005843 | Ga0068860_100894818 | Ga0068860_1008948182 | 178 |
| 180 | 3300005844 | Ga0068862_100052442 | Ga0068862_1000524422 | 178 |
| 181 | 3300005844 | Ga0068862_100177438 | Ga0068862_1001774383 | 178 |
| 182 | 3300005844 | Ga0068862_100539362 | Ga0068862_1005393621 | 178 |
| 183 | 3300005844 | Ga0068862_100587506 | Ga0068862_1005875062 | 178 |
| 184 | 3300005844 | Ga0068862_100985805 | Ga0068862_1009858052 | 178 |
| 185 | 3300006051 | Ga0075364_10368643 | Ga0075364_103686432 | 178 |
| 186 | 3300006195 | Ga0075366_10594007 | Ga0075366_105940071 | 178 |
| 187 | 3300006237 | Ga0097621_100136360 | Ga0097621_1001363603 | 178 |
| 188 | 3300006237 | Ga0097621_100956915 | Ga0097621_1009569151 | 178 |
| 189 | 3300006846 | Ga0075430_100832018 | Ga0075430_1008320181 | 178 |
| 190 | 3300006931 | Ga0097620_100055139 | Ga0097620_1000551392 | 178 |
| 191 | 3300009094 | Ga0111539_11292271 | Ga0111539_112922711 | 178 |
| 192 | 3300009094 | Ga0111539_11316361 | Ga0111539_113163611 | 178 |
| 193 | 3300009553 | Ga0105249_11479225 | Ga0105249_114792252 | 178 |
| 194 | 3300013308 | Ga0157375_10164058 | Ga0157375_101640583 | 178 |
| 195 | 3300014325 | Ga0163163_10747095 | Ga0163163_107470952 | 178 |
| 196 | 3300014326 | Ga0157380_10039703 | Ga0157380_100397034 | 178 |
| 197 | 3300014326 | Ga0157380_10110967 | Ga0157380_101109673 | 178 |
| 198 | 3300014326 | Ga0157380_10228342 | Ga0157380_102283422 | 178 |
| 199 | 3300014326 | Ga0157380_10254413 | Ga0157380_102544132 | 178 |
| 200 | 3300014326 | Ga0157380_10319309 | Ga0157380_103193091 | 178 |
| 201 | 3300014326 | Ga0157380_10672488 | Ga0157380_106724881 | 178 |
| 202 | 3300014326 | Ga0157380_10824981 | Ga0157380_108249812 | 178 |
| 203 | 3300017792 | Ga0163161_11000430 | Ga0163161_110004301 | 178 |
| 204 | 3300025893 | Ga0207682_10002366 | Ga0207682_100023662 | 178 |
| 205 | 3300025899 | Ga0207642_10211627 | Ga0207642_102116271 | 178 |
| 206 | 3300025899 | Ga0207642_10325873 | Ga0207642_103258732 | 178 |
| 207 | 3300025907 | Ga0207645_10077546 | Ga0207645_100775462 | 178 |
| 208 | 3300025907 | Ga0207645_10374648 | Ga0207645_103746482 | 178 |
| 209 | 3300025908 | Ga0207643_10093669 | Ga0207643_100936692 | 178 |
| 210 | 3300025908 | Ga0207643_10203468 | Ga0207643_102034682 | 178 |
| 211 | 3300025918 | Ga0207662_10145603 | Ga0207662_101456032 | 178 |
| 212 | 3300025920 | Ga0207649_10471042 | Ga0207649_104710421 | 178 |
| 213 | 3300025926 | Ga0207659_10162525 | Ga0207659_101625252 | 178 |
| 214 | 3300025926 | Ga0207659_10215956 | Ga0207659_102159562 | 178 |
| 215 | 3300025926 | Ga0207659_10312457 | Ga0207659_103124572 | 178 |
| 216 | 3300025931 | Ga0207644_10673207 | Ga0207644_106732072 | 178 |
| 217 | 3300025933 | Ga0207706_10294841 | Ga0207706_102948412 | 178 |
| 218 | 3300025936 | Ga0207670_10190796 | Ga0207670_101907962 | 178 |
| 219 | 3300025936 | Ga0207670_10278011 | Ga0207670_102780111 | 178 |
| 220 | 3300025940 | Ga0207691_10009176 | Ga0207691_1000917610 | 178 |
| 221 | 3300025940 | Ga0207691_10022186 | Ga0207691_100221862 | 178 |
| 222 | 3300025940 | Ga0207691_10211420 | Ga0207691_102114202 | 178 |
| 223 | 3300025942 | Ga0207689_10104309 | Ga0207689_101043093 | 178 |
| 224 | 3300025944 | Ga0207661_10860707 | Ga0207661_108607072 | 178 |
| 225 | 3300025945 | Ga0207679_10061578 | Ga0207679_100615783 | 178 |
| 226 | 3300025945 | Ga0207679_10597979 | Ga0207679_105979792 | 178 |
| 227 | 3300025945 | Ga0207679_10799447 | Ga0207679_107994472 | 178 |
| 228 | 3300025972 | Ga0207668_10817278 | Ga0207668_108172781 | 178 |
| 229 | 3300025986 | Ga0207658_10898505 | Ga0207658_108985051 | 178 |
| 230 | 3300026041 | Ga0207639_10400199 | Ga0207639_104001992 | 178 |
| 231 | 3300026075 | Ga0207708_10028376 | Ga0207708_100283764 | 178 |
| 232 | 3300026075 | Ga0207708_10126314 | Ga0207708_101263142 | 178 |
| 233 | 3300026075 | Ga0207708_10423637 | Ga0207708_104236372 | 178 |
| 234 | 3300026075 | Ga0207708_10604302 | Ga0207708_106043022 | 178 |
| 235 | 3300026088 | Ga0207641_10013278 | Ga0207641_100132784 | 178 |
| 236 | 3300026088 | Ga0207641_10865592 | Ga0207641_108655922 | 178 |
| 237 | 3300026089 | Ga0207648_10181872 | Ga0207648_101818722 | 178 |
| 238 | 3300026095 | Ga0207676_10071814 | Ga0207676_100718142 | 178 |
| 239 | 3300026095 | Ga0207676_10760646 | Ga0207676_107606462 | 178 |
| 240 | 3300026116 | Ga0207674_10294709 | Ga0207674_102947092 | 178 |
| 241 | 3300026116 | Ga0207674_10366087 | Ga0207674_103660872 | 178 |
| 242 | 3300026118 | Ga0207675_100012250 | Ga0207675_1000122509 | 178 |
| 243 | 3300026118 | Ga0207675_100015078 | Ga0207675_1000150789 | 178 |
| 244 | 3300026118 | Ga0207675_100774143 | Ga0207675_1007741432 | 178 |
| 245 | 3300026121 | Ga0207683_10406628 | Ga0207683_104066282 | 178 |
| 246 | 3300028379 | Ga0268266_10131761 | Ga0268266_101317612 | 178 |
| 247 | 3300028380 | Ga0268265_10020321 | Ga0268265_100203214 | 178 |
| 248 | 3300028380 | Ga0268265_10605335 | Ga0268265_106053352 | 178 |
| 249 | 3300028380 | Ga0268265_10663932 | Ga0268265_106639322 | 178 |
| 250 | 3300028380 | Ga0268265_10803455 | Ga0268265_108034552 | 178 |
| 251 | 3300028381 | Ga0268264_11081588 | Ga0268264_110815881 | 178 |
| 252 | 3300028794 | Ga0307515_10269418 | Ga0307515_102694181 | 178 |
| 253 | 3300031456 | Ga0307513_10071890 | Ga0307513_100718902 | 178 |
| 254 | 3300031456 | Ga0307513_10085124 | Ga0307513_100851242 | 178 |
| 255 | 3300031456 | Ga0307513_10105536 | Ga0307513_101055362 | 178 |
| 256 | 3300031507 | Ga0307509_10009871 | Ga0307509_100098719 | 178 |
| 257 | 3300031507 | Ga0307509_10500715 | Ga0307509_105007152 | 178 |
| 258 | 3300031548 | Ga0307408_100031000 | Ga0307408_1000310002 | 178 |
| 259 | 3300031548 | Ga0307408_100371345 | Ga0307408_1003713452 | 178 |
| 260 | 3300031548 | Ga0307408_100578587 | Ga0307408_1005785872 | 178 |
| 261 | 3300031548 | Ga0307408_101495561 | Ga0307408_1014955611 | 178 |
| 262 | 3300031731 | Ga0307405_10029249 | Ga0307405_100292493 | 178 |
| 263 | 3300031824 | Ga0307413_10004180 | Ga0307413_100041802 | 178 |
| 264 | 3300031852 | Ga0307410_10007402 | Ga0307410_100074025 | 178 |
| 265 | 3300031901 | Ga0307406_10060544 | Ga0307406_100605442 | 178 |
| 266 | 3300031903 | Ga0307407_10002873 | Ga0307407_100028736 | 178 |
| 267 | 3300031903 | Ga0307407_10298936 | Ga0307407_102989362 | 178 |
| 268 | 3300031911 | Ga0307412_10294425 | Ga0307412_102944252 | 178 |
| 269 | 3300031995 | Ga0307409_100008601 | Ga0307409_1000086012 | 178 |
| 270 | 3300032002 | Ga0307416_100325860 | Ga0307416_1003258602 | 178 |
| 271 | 3300032002 | Ga0307416_100365278 | Ga0307416_1003652782 | 178 |
| 272 | 3300032005 | Ga0307411_10013209 | Ga0307411_100132093 | 178 |
| 273 | 3300032126 | Ga0307415_100175323 | Ga0307415_1001753232 | 178 |
| 274 | 3300032126 | Ga0307415_100326378 | Ga0307415_1003263782 | 178 |
| 275 | 3300032126 | Ga0307415_100352120 | Ga0307415_1003521201 | 178 |
| 276 | 3300041441 | Ga0451787_048931 | Ga0451787_048931_1973_2524 | 178 |
| 277 | 3300041451 | Ga0451791_0388950 | Ga0451791_0388950_275_883 | 178 |
| 278 | 3300041452 | Ga0451793_1369791 | Ga0451793_1369791_643_1194 | 178 |
| 279 | 3300041453 | Ga0451797_0747851 | Ga0451797_0747851_532_1140 | 178 |
| 280 | 3300041459 | Ga0451800_0426383 | Ga0451800_0426383_1049_1600 | 178 |
| 281 | 3300041460 | Ga0451802_0367945 | Ga0451802_0367945_430_981 | 178 |
| 282 | 3300041460 | Ga0451802_2139266 | Ga0451802_2139266_79_630 | 178 |
| 283 | 3300041463 | Ga0451804_0961374 | Ga0451804_0961374_225_833 | 178 |
| 284 | 3300041486 | Ga0451807_0235429 | Ga0451807_0235429_4225_4833 | 178 |
| 285 | 3300041486 | Ga0451807_0349479 | Ga0451807_0349479_255_806 | 178 |
| 286 | 3300041494 | Ga0451837_1285619 | Ga0451837_1285619_142_750 | 178 |
| 287 | 3300041512 | Ga0451853_3282110 | Ga0451853_3282110_697_1248 | 178 |
| 288 | 3300046457 | Ga0495590_0000646 | Ga0495590_0000646_6877_7425 | 178 |
| 289 | 3300046457 | Ga0495590_0191326 | Ga0495590_0191326_123_674 | 178 |
| 290 | 3300046460 | Ga0495638_0035624 | Ga0495638_0035624_2081_2632 | 178 |
| 291 | 3300046513 | Ga0495616_0001194 | Ga0495616_0001194_7894_8445 | 178 |
| 292 | 3300046519 | Ga0495632_0016452 | Ga0495632_0016452_3226_3774 | 178 |
| 293 | 3300046537 | Ga0495598_0234068 | Ga0495598_0234068_98_664 | 178 |
| 294 | 3300046616 | Ga0495668_0147499 | Ga0495668_0147499_354_902 | 178 |
| 295 | 3300046660 | Ga0495625_0065605 | Ga0495625_0065605_683_1234 | 178 |
| 296 | 3300046660 | Ga0495625_0182579 | Ga0495625_0182579_329_877 | 178 |
| 297 | 3300046660 | Ga0495625_0216356 | Ga0495625_0216356_439_990 | 178 |
| 298 | 3300046694 | Ga0495649_0141765 | Ga0495649_0141765_352_900 | 178 |
| 299 | 3300048091 | Ga0495626_0206113 | Ga0495626_0206113_35_598 | 178 |
| 300 | 3300048917 | Ga0496114_1071311 | Ga0496114_1071311_112_663 | 178 |
| 301 | 3300049575 | Ga0501039_0451852 | Ga0501039_0451852_300_854 | 178 |
| 302 | 3300049584 | Ga0501068_0000333 | Ga0501068_0000333_3287_3841 | 178 |
| 303 | 3300049586 | Ga0501070_0030361 | Ga0501070_0030361_2919_3473 | 178 |
| 304 | 3300049587 | Ga0501071_0002373 | Ga0501071_0002373_3250_3804 | 178 |
| 305 | 3300049587 | Ga0501071_0197291 | Ga0501071_0197291_607_1173 | 178 |
| 306 | 3300049589 | Ga0501073_0453108 | Ga0501073_0453108_39_605 | 178 |
| 307 | 3300049590 | Ga0501074_0005826 | Ga0501074_0005826_2434_2988 | 178 |
| 308 | 3300049591 | Ga0501075_0806231 | Ga0501075_0806231_140_694 | 178 |
| 309 | 3300049592 | Ga0501076_0026391 | Ga0501076_0026391_1832_2386 | 178 |
| 310 | 3300049593 | Ga0501077_0009480 | Ga0501077_0009480_1019_1573 | 178 |
| 311 | 3300049741 | Ga0501079_0001264 | Ga0501079_0001264_13924_14478 | 178 |
| 312 | 3300049742 | Ga0501080_0002029 | Ga0501080_0002029_3282_3836 | 178 |
| 313 | 3300049742 | Ga0501080_0229364 | Ga0501080_0229364_754_1305 | 178 |
| 314 | 3300049744 | Ga0501083_0133347 | Ga0501083_0133347_362_916 | 178 |
| 315 | 3300050511 | nmdc:mga08y16_425045_c1 | nmdc:mga08y16_425045_c1_500_1066 | 178 |
| 316 | 3300050511 | nmdc:mga08y16_440293_c1 | nmdc:mga08y16_440293_c1_42_593 | 178 |
| 317 | 3300053727 | Ga0500611_109377 | Ga0500611_109377_129_680 | 178 |
| 318 | 3300054114 | Ga0501084_0004825 | Ga0501084_0004825_1331_1885 | 178 |
| 319 | 3300060353 | Ga0501082_0039668 | Ga0501082_0039668_2675_3229 | 178 |
| 320 | 3300031852 | Ga0307410_10012046 | Ga0307410_100120462 | 179 |
| 321 | 3300031903 | Ga0307407_10705328 | Ga0307407_107053281 | 179 |
| 322 | 3300031995 | Ga0307409_100007401 | Ga0307409_1000074013 | 179 |
| 323 | 3300041491 | Ga0451833_0264962 | Ga0451833_0264962_447_1013 | 179 |
| 324 | 3300005356 | Ga0070674_101082166 | Ga0070674_1010821661 | 180 |
| 325 | 3300005543 | Ga0070672_100989170 | Ga0070672_1009891701 | 180 |
| 326 | 3300009174 | Ga0105241_10318402 | Ga0105241_103184022 | 180 |
| 327 | 3300005618 | Ga0068864_101870477 | Ga0068864_1018704771 | 181 |
| 328 | 3300005327 | Ga0070658_10779035 | Ga0070658_107790351 | 182 |
| 329 | 3300005458 | Ga0070681_10028459 | Ga0070681_100284595 | 182 |
| 330 | 3300005530 | Ga0070679_100017664 | Ga0070679_1000176646 | 182 |
| 331 | 3300005530 | Ga0070679_100107875 | Ga0070679_1001078752 | 182 |
| 332 | 3300005530 | Ga0070679_100188625 | Ga0070679_1001886251 | 182 |
| 333 | 3300005563 | Ga0068855_100002113 | Ga0068855_10000211320 | 182 |
| 334 | 3300005614 | Ga0068856_100385738 | Ga0068856_1003857381 | 182 |
| 335 | 3300009093 | Ga0105240_10220678 | Ga0105240_102206782 | 182 |
| 336 | 3300009093 | Ga0105240_10224903 | Ga0105240_102249032 | 182 |
| 337 | 3300013104 | Ga0157370_10563248 | Ga0157370_105632482 | 182 |
| 338 | 3300013104 | Ga0157370_10601993 | Ga0157370_106019932 | 182 |
| 339 | 3300013105 | Ga0157369_10195482 | Ga0157369_101954821 | 182 |
| 340 | 3300013105 | Ga0157369_10502190 | Ga0157369_105021902 | 182 |
| 341 | 3300020082 | Ga0206353_11631158 | Ga0206353_116311581 | 182 |
| 342 | 3300022467 | Ga0224712_10234086 | Ga0224712_102340861 | 182 |
| 343 | 3300025912 | Ga0207707_10000045 | Ga0207707_1000004516 | 182 |
| 344 | 3300025912 | Ga0207707_10042089 | Ga0207707_100420893 | 182 |
| 345 | 3300025913 | Ga0207695_10012566 | Ga0207695_100125665 | 182 |
| 346 | 3300025917 | Ga0207660_10000958 | Ga0207660_100009582 | 182 |
| 347 | 3300025920 | Ga0207649_10544310 | Ga0207649_105443101 | 182 |
| 348 | 3300025921 | Ga0207652_10005918 | Ga0207652_1000591810 | 182 |
| 349 | 3300025921 | Ga0207652_10038374 | Ga0207652_100383744 | 182 |
| 350 | 3300025921 | Ga0207652_10150658 | Ga0207652_101506582 | 182 |
| 351 | 3300025921 | Ga0207652_10582934 | Ga0207652_105829342 | 182 |
| 352 | 3300025924 | Ga0207694_10088383 | Ga0207694_100883832 | 182 |
| 353 | 3300025949 | Ga0207667_10000887 | Ga0207667_100008873 | 182 |
| 354 | 3300025949 | Ga0207667_10864694 | Ga0207667_108646942 | 182 |
| 355 | 3300026041 | Ga0207639_10361519 | Ga0207639_103615191 | 182 |
| 356 | 3300026078 | Ga0207702_10598521 | Ga0207702_105985211 | 182 |
| 357 | 3300005548 | Ga0070665_100009043 | Ga0070665_1000090439 | 183 |
| 358 | 3300005719 | Ga0068861_101005583 | Ga0068861_1010055832 | 183 |
| 359 | 3300005842 | Ga0068858_101296285 | Ga0068858_1012962851 | 183 |
| 360 | 3300005843 | Ga0068860_100547029 | Ga0068860_1005470292 | 183 |
| 361 | 3300005844 | Ga0068862_100579694 | Ga0068862_1005796941 | 183 |
| 362 | 3300006195 | Ga0075366_10272255 | Ga0075366_102722552 | 183 |
| 363 | 3300025942 | Ga0207689_10149889 | Ga0207689_101498892 | 183 |
| 364 | 3300025972 | Ga0207668_10460776 | Ga0207668_104607762 | 183 |
| 365 | 3300026035 | Ga0207703_10889327 | Ga0207703_108893272 | 183 |
| 366 | 3300026118 | Ga0207675_100275016 | Ga0207675_1002750162 | 183 |
| 367 | 3300028794 | Ga0307515_10386588 | Ga0307515_103865882 | 183 |
| 368 | 3300031507 | Ga0307509_10533882 | Ga0307509_105338821 | 183 |
| 369 | 3300031824 | Ga0307413_10210307 | Ga0307413_102103071 | 183 |
| 370 | 3300031901 | Ga0307406_11057890 | Ga0307406_110578901 | 183 |
| 371 | 3300031995 | Ga0307409_100047806 | Ga0307409_1000478063 | 183 |
| 372 | 3300041486 | Ga0451807_0309231 | Ga0451807_0309231_110_667 | 183 |
| 373 | 3300053096 | Ga0500641_0023639 | Ga0500641_0023639_1225_1782 | 183 |
| 374 | 3300053096 | Ga0500641_0172366 | Ga0500641_0172366_332_889 | 183 |
| 375 | 3300053130 | Ga0500642_0008051 | Ga0500642_0008051_1787_2344 | 183 |
| 376 | 3300053146 | Ga0500588_0030465 | Ga0500588_0030465_416_973 | 183 |
| 377 | 3300053153 | Ga0500616_0000569 | Ga0500616_0000569_40451_41008 | 183 |
| 378 | 3300053153 | Ga0500616_0038781 | Ga0500616_0038781_686_1243 | 183 |
| 379 | 3300005545 | Ga0070695_100348949 | Ga0070695_1003489491 | 184 |
| 380 | 3300042011 | Ga0439454_010856 | Ga0439454_010856_160_726 | 184 |
| 381 | 3300005563 | Ga0068855_100965140 | Ga0068855_1009651402 | 185 |
| 382 | 3300009093 | Ga0105240_10087755 | Ga0105240_100877553 | 185 |
| 383 | 3300009174 | Ga0105241_10090338 | Ga0105241_100903382 | 185 |
| 384 | 3300025911 | Ga0207654_10360528 | Ga0207654_103605281 | 185 |
| 385 | 3300025913 | Ga0207695_10102911 | Ga0207695_101029113 | 185 |
| 386 | 3300044658 | Ga0466972_0048879 | Ga0466972_0048879_1065_1625 | 186 |
| 387 | 3300044901 | Ga0466960_0672965 | Ga0466960_0672965_49_609 | 186 |
| 388 | 3300003911 | JGI25405J52794_10098329 | JGI25405J52794_100983291 | 187 |
| 389 | 3300005937 | Ga0081455_10000043 | Ga0081455_10000043120 | 187 |
| 390 | 3300005548 | Ga0070665_100645966 | Ga0070665_1006459661 | 188 |
| 391 | 3300003203 | JGI25406J46586_10004078 | JGI25406J46586_100040784 | 189 |
| 392 | 3300005337 | Ga0070682_100450179 | Ga0070682_1004501791 | 189 |
| 393 | 3300005547 | Ga0070693_100205852 | Ga0070693_1002058522 | 189 |
| 394 | 3300005844 | Ga0068862_100022839 | Ga0068862_1000228394 | 189 |
| 395 | 3300005985 | Ga0081539_10000046 | Ga0081539_1000004679 | 189 |
| 396 | 3300006358 | Ga0068871_100809597 | Ga0068871_1008095972 | 189 |
| 397 | 3300009553 | Ga0105249_10481686 | Ga0105249_104816862 | 189 |
| 398 | 3300013297 | Ga0157378_10735128 | Ga0157378_107351282 | 189 |
| 399 | 3300025961 | Ga0207712_10761307 | Ga0207712_107613072 | 189 |
| 400 | 3300028380 | Ga0268265_10184547 | Ga0268265_101845472 | 189 |
| 401 | 3300031507 | Ga0307509_10088983 | Ga0307509_100889832 | 189 |
| 402 | 3300053090 | Ga0500646_0089478 | Ga0500646_0089478_178_747 | 189 |
| 403 | 3300053092 | Ga0500583_0039283 | Ga0500583_0039283_1107_1676 | 189 |
| 404 | 3300053104 | Ga0500556_0049332 | Ga0500556_0049332_823_1392 | 189 |
| 405 | 3300053130 | Ga0500642_0060500 | Ga0500642_0060500_205_774 | 189 |
| 406 | 3300053134 | Ga0500658_0060132 | Ga0500658_0060132_969_1538 | 189 |
| 407 | 3300053146 | Ga0500588_0167037 | Ga0500588_0167037_59_628 | 189 |
| 408 | 3300053732 | Ga0500656_002022 | Ga0500656_002022_308_877 | 189 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6n5x-assembly1.cif.gz_A | crystal structure of the snx5 px domain in complex with the ci-mpr (space group p212121 - form 1) | 0.9477 | 92 | 129 |
| 6n5y-assembly1.cif.gz_A | crystal structure of the snx5 px domain in complex with the ci-mpr (space group p212121 - form 1) | 0.9091 | 89 | 129 |
| 5tp1-assembly2.cif.gz_B | the structure of the c-terminus of virulence protein ince from chlamydia trachomatis bound to mus musculus snx5-px domain | 0.8567 | 89 | 129 |
| 1g73-assembly2.cif.gz_B | crystal structure of smac bound to xiap-bir3 domain | 0.8378 | 83 | 129 |
| 2l3l-assembly1.cif.gz_A | the solution structure of the n-terminal domain of human tubulin binding cofactor c reveals a platform for the interaction with ab-tubulin | 0.8252 | 83 | 129 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q99LP6_159_215_2.30.22.10 | Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE | 0.9968 | 132 | 187 | 2.30.22.10 |
| af_A0A1D6EAQ0_210_272_2.30.22.10 | Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE | 0.9832 | 132 | 186 | 2.30.22.10 |
| af_Q2FXZ1_152_207_2.30.22.10 | Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE | 0.983 | 132 | 185 | 2.30.22.10 |
| af_A0A0P0VLJ4_201_256_2.30.22.10 | Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE | 0.9764 | 132 | 185 | 2.30.22.10 |
| af_Q18421_178_235_2.30.22.10 | Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE | 0.9664 | 132 | 185 | 2.30.22.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534BBZ5-F1-model_v4 | Protein GrpE (HSP-70 cofactor) | 0.977 | 84 | 189 |
GO:0000774
GO:0005829 GO:0006457 GO:0042803 GO:0051082 GO:0051087 |
| AF-A0A842PDT0-F1-model_v4 | Protein GrpE (HSP-70 cofactor) | 0.9614 | 34 | 189 |
GO:0000774
GO:0005506 GO:0005737 GO:0006457 GO:0042803 GO:0051082 GO:0051087 |
| AF-A0A645D385-F1-model_v4 | Protein GrpE | 0.9546 | 34 | 186 |
GO:0000774
GO:0006457 GO:0042803 GO:0051082 GO:0051087 |
| AF-A0A101ISZ5-F1-model_v4 | deleted | 0.9494 | 89 | 187 |
|
| AF-A0A3N9NA14-F1-model_v4 | Protein GrpE (HSP-70 cofactor) | 0.9481 | 29 | 187 |
GO:0000774
GO:0005737 GO:0006457 GO:0042803 GO:0051082 GO:0051087 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar