F436773

General Info

Members Datasets Scaffolds Average Seq Length
408 245 816 129

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_1019196|Ga0395905_1019196_87_545
Length 152
Sequence MPTMAAVARQGLYETEGWVMEPAAAADRWARVWRDAWRAQDTEAIVALYRPDVRFSTEAFRAPYRARDGVRTYVAQAFAEEREPRVWVGEPIVAGDRAAIEWWAAVIENDVPITLAGVSIVRFDEQGLVAEQWDSWNQVDGLREPPEGWGRA

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
95 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
155 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
156 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
157 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
158 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
160 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
163 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
164 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
176 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
177 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
178 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
179 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
180 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
181 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
182 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
189 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
190 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
197 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
200 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
201 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
204 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
205 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
206 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
207 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
232 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
242 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
243 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 11.52
Rhizosphere 86.27
Stem 0
Stem Tuber 0
Unclassified 11.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_1019196 3300037471 Bacteria 731
2 JGI24747J21853_1033393 3300001978 Bacteria 594
3 JGI25405J52794_10156733 3300003911 Unclassified 520
4 Ga0070676_10271151 3300005328 Bacteria 1140
5 Ga0070690_100022500 3300005330 Bacteria 3856
6 Ga0070677_10211006 3300005333 Bacteria 943
7 Ga0070666_10130933 3300005335 Bacteria 1743
8 Ga0070666_10612296 3300005335 Bacteria 795
9 Ga0070680_100040630 3300005336 Bacteria 3768
10 Ga0070680_100087978 3300005336 Bacteria 2569
11 Ga0070680_101457353 3300005336 Unclassified 593
12 Ga0070682_100016884 3300005337 Bacteria 4248
13 Ga0070682_100033044 3300005337 Bacteria 3140
14 Ga0068868_100062636 3300005338 Bacteria 2949
15 Ga0070660_100046169 3300005339 Bacteria 3338
16 Ga0070689_100098969 3300005340 Bacteria 2307
17 Ga0070691_10055873 3300005341 Bacteria 1891
18 Ga0070687_100005913 3300005343 Bacteria 4976
19 Ga0070692_10003190 3300005345 Bacteria 6595
20 Ga0070668_100137527 3300005347 Bacteria 1966
21 Ga0070669_100049857 3300005353 Bacteria 3057
22 Ga0070675_101601628 3300005354 Bacteria 601
23 Ga0070671_100196873 3300005355 Bacteria 1708
24 Ga0070674_100051348 3300005356 Bacteria 2841
25 Ga0070673_100320353 3300005364 Bacteria 1369
26 Ga0070673_100755327 3300005364 Unclassified 896
27 Ga0070673_100857486 3300005364 Bacteria 841
28 Ga0070673_101116557 3300005364 Bacteria 737
29 Ga0070688_100072946 3300005365 Bacteria 2201
30 Ga0070659_100030536 3300005366 Bacteria 4170
31 Ga0070667_100131338 3300005367 Bacteria 2186
32 Ga0070703_10011237 3300005406 Bacteria 2527
33 Ga0070709_10226219 3300005434 Bacteria 1336
34 Ga0070714_100210394 3300005435 Bacteria 1782
35 Ga0070714_100425207 3300005435 Bacteria 1259
36 Ga0070714_100449747 3300005435 Bacteria 1223
37 Ga0070714_100462246 3300005435 Unclassified 1207
38 Ga0070714_101217113 3300005435 Bacteria 735
39 Ga0070714_102339546 3300005435 Bacteria 519
40 Ga0070713_100038833 3300005436 Bacteria 3860
41 Ga0070713_100063060 3300005436 Bacteria 3105
42 Ga0070713_100064979 3300005436 Bacteria 3063
43 Ga0070713_100142371 3300005436 Bacteria 2125
44 Ga0070713_100364934 3300005436 Bacteria 1342
45 Ga0070713_100471493 3300005436 Bacteria 1181
46 Ga0070713_100471550 3300005436 Bacteria 1181
47 Ga0070713_100489221 3300005436 Bacteria 1160
48 Ga0070710_10270681 3300005437 Bacteria 1098
49 Ga0070710_11055708 3300005437 Bacteria 594
50 Ga0070710_11107719 3300005437 Bacteria 581
51 Ga0070701_10083869 3300005438 Bacteria 1731
52 Ga0070711_100113526 3300005439 Bacteria 1992
53 Ga0070711_100222027 3300005439 Bacteria 1469
54 Ga0070711_101034741 3300005439 Unclassified 705
55 Ga0070711_101071433 3300005439 Bacteria 694
56 Ga0070711_101222888 3300005439 Bacteria 650
57 Ga0070711_101358556 3300005439 Bacteria 617
58 Ga0070705_100007716 3300005440 Bacteria 5308
59 Ga0070700_100006398 3300005441 Bacteria 6294
60 Ga0070700_100957803 3300005441 Unclassified 701
61 Ga0070694_100034205 3300005444 Bacteria 3349
62 Ga0070694_101412732 3300005444 Bacteria 587
63 Ga0070708_100000751 3300005445 Bacteria 24476
64 Ga0070708_100262308 3300005445 Bacteria 1624
65 Ga0070708_100559515 3300005445 Unclassified 1079
66 Ga0070678_100025807 3300005456 Bacteria 3961
67 Ga0070662_100032967 3300005457 Bacteria 3645
68 Ga0070681_10251405 3300005458 Bacteria 1680
69 Ga0068867_100045367 3300005459 Bacteria 3223
70 Ga0070706_101307912 3300005467 Bacteria 665
71 Ga0070707_100016121 3300005468 Bacteria 7012
72 Ga0070698_100110414 3300005471 Bacteria 2715
73 Ga0070679_100010244 3300005530 Bacteria 8888
74 Ga0070679_100088419 3300005530 Bacteria 3085
75 Ga0070684_101242333 3300005535 Bacteria 701
76 Ga0070684_102002259 3300005535 Unclassified 547
77 Ga0070697_100638113 3300005536 Bacteria 937
78 Ga0070697_101536948 3300005536 Unclassified 595
79 Ga0068853_100046740 3300005539 Bacteria 3712
80 Ga0070672_100057425 3300005543 Bacteria 3055
81 Ga0070686_100029333 3300005544 Bacteria 3346
82 Ga0070686_100264143 3300005544 Bacteria 1263
83 Ga0070695_100010492 3300005545 Bacteria 5531
84 Ga0070696_100041135 3300005546 Bacteria 3192
85 Ga0070696_100094731 3300005546 Bacteria 2131
86 Ga0070696_100815120 3300005546 Bacteria 769
87 Ga0070693_100014358 3300005547 Bacteria 4057
88 Ga0070693_100062093 3300005547 Bacteria 2174
89 Ga0070693_100065693 3300005547 Bacteria 2121
90 Ga0070704_100009956 3300005549 Bacteria 5772
91 Ga0070704_100620353 3300005549 Bacteria 952
92 Ga0068855_100068406 3300005563 Bacteria 4135
93 Ga0068855_100838336 3300005563 Bacteria 975
94 Ga0070664_100504548 3300005564 Bacteria 1115
95 Ga0068854_100022790 3300005578 Bacteria 4272
96 Ga0068854_100927452 3300005578 Bacteria 767
97 Ga0068856_100396545 3300005614 Bacteria 1400
98 Ga0068856_100972996 3300005614 Bacteria 867
99 Ga0068856_101245279 3300005614 Unclassified 760
100 Ga0070702_100004726 3300005615 Bacteria 6254
101 Ga0070702_100291664 3300005615 Bacteria 1125
102 Ga0068852_100036528 3300005616 Bacteria 4112
103 Ga0068859_101249260 3300005617 Bacteria 818
104 Ga0068866_10013652 3300005718 Bacteria 3570
105 Ga0068866_10547350 3300005718 Bacteria 773
106 Ga0068861_100041443 3300005719 Bacteria 3449
107 Ga0068851_10688550 3300005834 Bacteria 628
108 Ga0068870_10372639 3300005840 Bacteria 922
109 Ga0068870_11199640 3300005840 Bacteria 549
110 Ga0068858_100427650 3300005842 Bacteria 1274
111 Ga0068860_100616824 3300005843 Bacteria 1091
112 Ga0068862_100061594 3300005844 Bacteria 3225
113 Ga0081455_10046034 3300005937 Bacteria 3790
114 Ga0081455_10166308 3300005937 Bacteria 1685
115 Ga0081539_10001453 3300005985 Bacteria 40412
116 Ga0070717_10072519 3300006028 Bacteria 2875
117 Ga0070717_10136435 3300006028 Bacteria 2113
118 Ga0070717_10805487 3300006028 Bacteria 854
119 Ga0070717_10837661 3300006028 Bacteria 837
120 Ga0075365_10821286 3300006038 Bacteria 656
121 Ga0075432_10066791 3300006058 Bacteria 1287
122 Ga0075432_10212507 3300006058 Bacteria 770
123 Ga0070715_10079167 3300006163 Bacteria 1487
124 Ga0070715_10316343 3300006163 Bacteria 841
125 Ga0070715_10769405 3300006163 Bacteria 582
126 Ga0070716_100036798 3300006173 Bacteria 2700
127 Ga0070716_100249758 3300006173 Bacteria 1208
128 Ga0070712_100025063 3300006175 Bacteria 3960
129 Ga0070712_100038122 3300006175 Bacteria 3282
130 Ga0070712_100081654 3300006175 Bacteria 2343
131 Ga0070712_100173140 3300006175 Bacteria 1676
132 Ga0097621_100076518 3300006237 Bacteria 2776
133 Ga0097621_101990454 3300006237 Bacteria 555
134 Ga0068871_100004933 3300006358 Bacteria 9320
135 Ga0075431_100407521 3300006847 Bacteria 1360
136 Ga0075433_10121826 3300006852 Bacteria 2316
137 Ga0075434_100008855 3300006871 Bacteria 9368
138 Ga0075434_100891347 3300006871 Bacteria 905
139 Ga0068865_100045040 3300006881 Bacteria 3023
140 Ga0075436_100003758 3300006914 Bacteria 10404
141 Ga0075436_100550141 3300006914 Unclassified 847
142 Ga0097620_101249526 3300006931 Bacteria 818
143 Ga0075435_100023583 3300007076 Bacteria 4761
144 Ga0075435_100039867 3300007076 Bacteria 3749
145 Ga0075435_101140361 3300007076 Bacteria 682
146 Ga0105250_10120330 3300009092 Bacteria 1079
147 Ga0105245_10018852 3300009098 Bacteria 6038
148 Ga0105245_10036239 3300009098 Bacteria 4381
149 Ga0105245_10727739 3300009098 Unclassified 1027
150 Ga0114129_10019334 3300009147 Bacteria 9700
151 Ga0105243_10040105 3300009148 Bacteria 3655
152 Ga0105243_11334511 3300009148 Bacteria 736
153 Ga0105241_11531480 3300009174 Bacteria 643
154 Ga0105241_11552199 3300009174 Bacteria 639
155 Ga0105242_10029382 3300009176 Bacteria 4384
156 Ga0105237_10215256 3300009545 Bacteria 1921
157 Ga0105238_10752615 3300009551 Bacteria 988
158 Ga0105249_10057371 3300009553 Bacteria 3567
159 Ga0105239_10062564 3300010375 Bacteria 4085
160 Ga0157313_1020106 3300012503 Bacteria 673
161 Ga0157324_1025983 3300012506 Unclassified 632
162 Ga0157371_10068458 3300013102 Bacteria 2513
163 Ga0157370_11073459 3300013104 Bacteria 728
164 Ga0157378_10231691 3300013297 Bacteria 1760
165 Ga0163162_10165759 3300013306 Bacteria 2333
166 Ga0157375_10064409 3300013308 Bacteria 3649
167 Ga0157375_10831011 3300013308 Bacteria 1071
168 Ga0157380_10059485 3300014326 Bacteria 3049
169 Ga0182008_10351282 3300014497 Unclassified 782
170 Ga0157376_10041785 3300014969 Bacteria 3757
171 Ga0157376_10069560 3300014969 Bacteria 2984
172 Ga0163161_10118208 3300017792 Bacteria 1989
173 Ga0213874_10072263 3300021377 Unclassified 1103
174 Ga0207656_10457311 3300025321 Bacteria 645
175 Ga0207642_10408184 3300025899 Bacteria 814
176 Ga0207680_10921835 3300025903 Bacteria 626
177 Ga0207685_10183462 3300025905 Bacteria 972
178 Ga0207699_10155728 3300025906 Bacteria 1516
179 Ga0207699_11430512 3300025906 Bacteria 511
180 Ga0207645_10071275 3300025907 Bacteria 2224
181 Ga0207654_10082206 3300025911 Bacteria 1942
182 Ga0207654_11073896 3300025911 Bacteria 586
183 Ga0207707_10185707 3300025912 Bacteria 1814
184 Ga0207707_10602043 3300025912 Bacteria 930
185 Ga0207695_10870064 3300025913 Bacteria 781
186 Ga0207671_10888201 3300025914 Bacteria 705
187 Ga0207693_10028734 3300025915 Bacteria 4394
188 Ga0207693_10184589 3300025915 Bacteria 1642
189 Ga0207693_10232177 3300025915 Bacteria 1449
190 Ga0207693_10238798 3300025915 Bacteria 1427
191 Ga0207693_10617652 3300025915 Bacteria 843
192 Ga0207663_10085581 3300025916 Bacteria 2076
193 Ga0207663_10149648 3300025916 Bacteria 1636
194 Ga0207663_10245487 3300025916 Bacteria 1315
195 Ga0207663_11323898 3300025916 Bacteria 580
196 Ga0207660_10068536 3300025917 Bacteria 2573
197 Ga0207660_10117557 3300025917 Bacteria 2010
198 Ga0207660_10166601 3300025917 Bacteria 1703
199 Ga0207662_10019635 3300025918 Bacteria 3849
200 Ga0207662_10602711 3300025918 Bacteria 764
201 Ga0207657_10024749 3300025919 Bacteria 5550
202 Ga0207652_10608652 3300025921 Bacteria 979
203 Ga0207681_10165581 3300025923 Bacteria 1671
204 Ga0207687_10500923 3300025927 Bacteria 1014
205 Ga0207687_11248040 3300025927 Bacteria 639
206 Ga0207700_10088877 3300025928 Bacteria 2434
207 Ga0207700_10105135 3300025928 Unclassified 2260
208 Ga0207700_10345634 3300025928 Bacteria 1294
209 Ga0207700_10387363 3300025928 Bacteria 1223
210 Ga0207700_10423752 3300025928 Bacteria 1169
211 Ga0207700_10482423 3300025928 Bacteria 1095
212 Ga0207700_10568718 3300025928 Unclassified 1007
213 Ga0207700_10748592 3300025928 Bacteria 873
214 Ga0207664_10073192 3300025929 Bacteria 2764
215 Ga0207664_10118171 3300025929 Bacteria 2214
216 Ga0207690_10061756 3300025932 Bacteria 2549
217 Ga0207706_10016795 3300025933 Bacteria 6606
218 Ga0207709_10095772 3300025935 Bacteria 1951
219 Ga0207709_10306854 3300025935 Bacteria 1182
220 Ga0207709_11048102 3300025935 Bacteria 668
221 Ga0207670_10456042 3300025936 Bacteria 1031
222 Ga0207669_10073063 3300025937 Bacteria 2162
223 Ga0207704_10013949 3300025938 Bacteria 4043
224 Ga0207665_10008334 3300025939 Bacteria 6840
225 Ga0207691_10058712 3300025940 Bacteria 3499
226 Ga0207689_10700918 3300025942 Bacteria 854
227 Ga0207689_11126620 3300025942 Bacteria 661
228 Ga0207661_11687204 3300025944 Unclassified 579
229 Ga0207679_10760580 3300025945 Bacteria 882
230 Ga0207667_10185728 3300025949 Bacteria 2134
231 Ga0207651_11163246 3300025960 Bacteria 692
232 Ga0207712_10029737 3300025961 Bacteria 3668
233 Ga0207668_10132091 3300025972 Bacteria 1908
234 Ga0207640_11300523 3300025981 Bacteria 649
235 Ga0207658_10129038 3300025986 Bacteria 2029
236 Ga0207677_10277669 3300026023 Bacteria 1373
237 Ga0207677_10716825 3300026023 Bacteria 889
238 Ga0207703_10434229 3300026035 Bacteria 1224
239 Ga0207639_10053871 3300026041 Bacteria 3072
240 Ga0207708_10003703 3300026075 Bacteria 11288
241 Ga0207708_10048987 3300026075 Bacteria 3217
242 Ga0207702_10093555 3300026078 Bacteria 2636
243 Ga0207702_10242844 3300026078 Bacteria 1688
244 Ga0207702_12037395 3300026078 Bacteria 564
245 Ga0207648_10029159 3300026089 Bacteria 4894
246 Ga0207675_100004367 3300026118 Bacteria 13661
247 Ga0207683_10006871 3300026121 Bacteria 9746
248 Ga0207683_10113983 3300026121 Bacteria 2422
249 Ga0207698_10045809 3300026142 Bacteria 3297
250 Ga0268265_10178584 3300028380 Bacteria 1822
251 Ga0268264_10051678 3300028381 Bacteria 3426
252 Ga0373948_0057176 3300034817 Bacteria 850
253 Ga0373959_0036131 3300034820 Bacteria 1019
254 Ga0373940_0206633 3300035088 Bacteria 647
255 Ga0373951_0014155 3300035091 Bacteria 1792
256 Ga0373923_0226225 3300035111 Bacteria 871
257 Ga0373941_0047532 3300035115 Bacteria 1352
258 Ga0373960_0287463 3300035121 Bacteria 608
259 Ga0373943_0008009 3300035170 Bacteria 4743
260 Ga0373943_0287359 3300035170 Bacteria 931
261 Ga0373943_0420361 3300035170 Bacteria 774
262 Ga0373942_0028416 3300035207 Bacteria 1462
263 Ga0373961_0022180 3300035241 Bacteria 1697
264 Ga0373962_0007659 3300035242 Bacteria 2648
265 Ga0373931_0020343 3300035691 Bacteria 3320
266 Ga0373931_1076697 3300035691 Bacteria 547
267 Ga0373935_0078396 3300035692 Bacteria 2143
268 Ga0373935_0109186 3300035692 Bacteria 1834
269 Ga0373927_0962623 3300035695 Bacteria 563
270 Ga0373947_0071988 3300035725 Bacteria 2121
271 Ga0373937_1392736 3300036401 Bacteria 649
272 Ga0373925_1258146 3300037068 Bacteria 608
273 Ga0373925_1587336 3300037068 Unclassified 535
274 Ga0373925_1792518 3300037068 Bacteria 501
275 Ga0395899_0015260 3300037312 Bacteria 5855
276 Ga0395899_0057333 3300037312 Bacteria 2876
277 Ga0395899_0121092 3300037312 Bacteria 1874
278 Ga0395899_0211385 3300037312 Bacteria 1348
279 Ga0395899_0548598 3300037312 Unclassified 743
280 Ga0395900_0018151 3300037418 Bacteria 7178
281 Ga0395900_0033986 3300037418 Bacteria 5248
282 Ga0395900_0050845 3300037418 Bacteria 4268
283 Ga0395900_0121686 3300037418 Unclassified 2677
284 Ga0395900_0197037 3300037418 Bacteria 2040
285 Ga0395898_0011561 3300037466 Bacteria 9166
286 Ga0395898_0015753 3300037466 Bacteria 7747
287 Ga0395898_0134784 3300037466 Bacteria 2364
288 Ga0395898_0159476 3300037466 Bacteria 2157
289 Ga0395898_1387908 3300037466 Unclassified 630
290 Ga0395905_0013484 3300037471 Bacteria 7830
291 Ga0395905_0060979 3300037471 Bacteria 3527
292 Ga0395905_0429719 3300037471 Unclassified 1217
293 Ga0395905_0762456 3300037471 Unclassified 870
294 Ga0395901_0013213 3300038443 Bacteria 8383
295 Ga0395901_0014765 3300038443 Bacteria 7936
296 Ga0395901_0041838 3300038443 Bacteria 4749
297 Ga0395901_0260456 3300038443 Bacteria 1805
298 Ga0395901_0762664 3300038443 Bacteria 959
299 Ga0436363_0113379 3300039450 Bacteria 10864
300 Ga0436363_1161123 3300039450 Unclassified 809
301 Ga0436363_1532653 3300039450 Unclassified 1175
302 Ga0451793_0887223 3300041452 Unclassified 2207
303 Ga0451807_0922740 3300041486 Unclassified 505
304 Ga0451833_1381382 3300041491 Unclassified 954
305 Ga0451835_0113505 3300041492 Unclassified 671
306 Ga0451851_0511165 3300041507 Unclassified 740
307 Ga0451853_0237903 3300041512 Bacteria 769
308 Ga0439450_043859 3300042008 Bacteria 1046
309 Ga0451576_0057417 3300045051 Bacteria 4068
310 Ga0495603_0002669 3300046455 Bacteria 10522
311 Ga0495641_0002430 3300046461 Bacteria 14716
312 Ga0495651_0354468 3300046462 Bacteria 969
313 Ga0495580_0095744 3300046472 Bacteria 2065
314 Ga0495664_0791942 3300046477 Unclassified 557
315 Ga0495584_0066359 3300046491 Bacteria 1815
316 Ga0495594_0003650 3300046499 Bacteria 7911
317 Ga0495608_0489405 3300046511 Unclassified 746
318 Ga0495630_0265830 3300046517 Bacteria 1310
319 Ga0495630_0429133 3300046517 Bacteria 1013
320 Ga0495666_0044792 3300046526 Bacteria 2135
321 Ga0495652_0394701 3300046529 Bacteria 981
322 Ga0495652_0499799 3300046529 Unclassified 843
323 Ga0495652_1078571 3300046529 Unclassified 522
324 Ga0495645_0036735 3300046543 Bacteria 3570
325 Ga0495622_0078340 3300046557 Bacteria 1522
326 Ga0495656_0077244 3300046615 Bacteria 1494
327 Ga0495635_1054242 3300046663 Unclassified 516
328 Ga0495659_0027184 3300046664 Bacteria 1972
329 Ga0495588_0000537 3300046674 Bacteria 18303
330 Ga0495657_0763796 3300046675 Unclassified 554
331 Ga0495657_0823672 3300046675 Bacteria 530
332 Ga0495599_0633038 3300046678 Unclassified 621
333 Ga0495623_0671724 3300046679 Bacteria 533
334 Ga0495646_0555655 3300046680 Bacteria 586
335 Ga0495670_0404149 3300046691 Bacteria 738
336 Ga0495581_0223094 3300047315 Bacteria 1102
337 Ga0495604_0605420 3300047317 Bacteria 702
338 Ga0495674_0314337 3300047319 Bacteria 1277
339 Ga0495676_0003263 3300047321 Bacteria 14659
340 Ga0495593_0196655 3300047673 Bacteria 1014
341 Ga0496100_0042127 3300048903 Bacteria 2915
342 Ga0496100_0061010 3300048903 Bacteria 2483
343 Ga0496100_0324250 3300048903 Bacteria 1158
344 Ga0496101_0079116 3300048904 Bacteria 2427
345 Ga0496101_0116988 3300048904 Bacteria 2012
346 Ga0496101_0224496 3300048904 Bacteria 1458
347 Ga0496102_0011804 3300048905 Bacteria 7540
348 Ga0496102_0054541 3300048905 Bacteria 3645
349 Ga0496102_0075421 3300048905 Bacteria 3100
350 Ga0496102_0467515 3300048905 Unclassified 1182
351 Ga0496103_0077696 3300048906 Bacteria 2084
352 Ga0496104_0040087 3300048907 Bacteria 4388
353 Ga0496104_0275799 3300048907 Unclassified 1594
354 Ga0496104_0650073 3300048907 Unclassified 963
355 Ga0496105_0050640 3300048908 Bacteria 3430
356 Ga0496105_0103513 3300048908 Bacteria 2351
357 Ga0496106_0098622 3300048909 Bacteria 2264
358 Ga0496106_0268589 3300048909 Bacteria 1365
359 Ga0496106_0863304 3300048909 Bacteria 716
360 Ga0496106_0867695 3300048909 Bacteria 714
361 Ga0496107_0200933 3300048910 Bacteria 1481
362 Ga0496107_0290358 3300048910 Bacteria 1217
363 Ga0496107_0421851 3300048910 Bacteria 992
364 Ga0496108_0886144 3300048911 Unclassified 766
365 Ga0496109_0369337 3300048912 Bacteria 1355
366 Ga0496109_0436841 3300048912 Bacteria 1236
367 Ga0496110_0153694 3300048913 Bacteria 2084
368 Ga0496110_0524386 3300048913 Bacteria 1077
369 Ga0496110_0671700 3300048913 Unclassified 936
370 Ga0496111_0075243 3300048914 Bacteria 2460
371 Ga0496111_0262861 3300048914 Bacteria 1280
372 Ga0496112_0024375 3300048915 Bacteria 5791
373 Ga0496112_0029080 3300048915 Bacteria 5342
374 Ga0496112_0061655 3300048915 Bacteria 3698
375 Ga0496112_0208649 3300048915 Bacteria 1911
376 Ga0496112_0407710 3300048915 Bacteria 1299
377 Ga0496113_0349915 3300048916 Bacteria 1185
378 Ga0496113_0386353 3300048916 Bacteria 1123
379 Ga0496113_0565593 3300048916 Bacteria 911
380 Ga0496114_0040098 3300048917 Bacteria 3875
381 Ga0496114_0230878 3300048917 Bacteria 1626
382 Ga0496114_0517563 3300048917 Bacteria 1055
383 Ga0496115_0078804 3300048918 Bacteria 2680
384 Ga0496115_0289432 3300048918 Bacteria 1344
385 Ga0496115_0914743 3300048918 Bacteria 676
386 Ga0501031_0814964 3300049568 Bacteria 598
387 Ga0501038_0285641 3300049574 Bacteria 1298
388 Ga0501040_0423478 3300049576 Bacteria 957
389 Ga0501042_0380933 3300049578 Bacteria 1021
390 Ga0501042_0643479 3300049578 Bacteria 771
391 Ga0501042_1242955 3300049578 Bacteria 543
392 Ga0501067_0662940 3300049583 Unclassified 586
393 Ga0501070_1505387 3300049586 Unclassified 509
394 Ga0501071_0090160 3300049587 Bacteria 2251
395 Ga0501074_1148263 3300049590 Unclassified 545
396 Ga0501076_0244553 3300049592 Bacteria 1468
397 Ga0501079_0354378 3300049741 Bacteria 1150
398 Ga0501081_0250611 3300049743 Bacteria 1293
399 Ga0501045_0998719 3300049824 Unclassified 614
400 nmdc:mga05p37_18434_c1 3300050507 Bacteria 8431
401 nmdc:mga06r32_186831_c1 3300050510 Bacteria 2059
402 nmdc:mga0n895_76495_c1 3300050512 Bacteria 3329
403 nmdc:mga0rr50_351809_c1 3300050513 Bacteria 1239
404 nmdc:mga0rr50_634562_c1 3300050513 Bacteria 911
405 nmdc:mga08x19_14799_c1 3300050514 Bacteria 4737
406 nmdc:mga08x19_86575_c1 3300050514 Bacteria 2063
407 nmdc:mga0a205_185776_c1 3300050515 Bacteria 1972
408 Ga0501084_0294004 3300054114 Unclassified 1372
409 Ga0395905_1019196
410 JGI24747J21853_1033393
411 JGI25405J52794_10156733
412 Ga0070676_10271151
413 Ga0070690_100022500
414 Ga0070677_10211006
415 Ga0070666_10130933
416 Ga0070666_10612296
417 Ga0070680_100040630
418 Ga0070680_100087978
419 Ga0070680_101457353
420 Ga0070682_100016884
421 Ga0070682_100033044
422 Ga0068868_100062636
423 Ga0070660_100046169
424 Ga0070689_100098969
425 Ga0070691_10055873
426 Ga0070687_100005913
427 Ga0070692_10003190
428 Ga0070668_100137527
429 Ga0070669_100049857
430 Ga0070675_101601628
431 Ga0070671_100196873
432 Ga0070674_100051348
433 Ga0070673_100320353
434 Ga0070673_100755327
435 Ga0070673_100857486
436 Ga0070673_101116557
437 Ga0070688_100072946
438 Ga0070659_100030536
439 Ga0070667_100131338
440 Ga0070703_10011237
441 Ga0070709_10226219
442 Ga0070714_100210394
443 Ga0070714_100425207
444 Ga0070714_100449747
445 Ga0070714_100462246
446 Ga0070714_101217113
447 Ga0070714_102339546
448 Ga0070713_100038833
449 Ga0070713_100063060
450 Ga0070713_100064979
451 Ga0070713_100142371
452 Ga0070713_100364934
453 Ga0070713_100471493
454 Ga0070713_100471550
455 Ga0070713_100489221
456 Ga0070710_10270681
457 Ga0070710_11055708
458 Ga0070710_11107719
459 Ga0070701_10083869
460 Ga0070711_100113526
461 Ga0070711_100222027
462 Ga0070711_101034741
463 Ga0070711_101071433
464 Ga0070711_101222888
465 Ga0070711_101358556
466 Ga0070705_100007716
467 Ga0070700_100006398
468 Ga0070700_100957803
469 Ga0070694_100034205
470 Ga0070694_101412732
471 Ga0070708_100000751
472 Ga0070708_100262308
473 Ga0070708_100559515
474 Ga0070678_100025807
475 Ga0070662_100032967
476 Ga0070681_10251405
477 Ga0068867_100045367
478 Ga0070706_101307912
479 Ga0070707_100016121
480 Ga0070698_100110414
481 Ga0070679_100010244
482 Ga0070679_100088419
483 Ga0070684_101242333
484 Ga0070684_102002259
485 Ga0070697_100638113
486 Ga0070697_101536948
487 Ga0068853_100046740
488 Ga0070672_100057425
489 Ga0070686_100029333
490 Ga0070686_100264143
491 Ga0070695_100010492
492 Ga0070696_100041135
493 Ga0070696_100094731
494 Ga0070696_100815120
495 Ga0070693_100014358
496 Ga0070693_100062093
497 Ga0070693_100065693
498 Ga0070704_100009956
499 Ga0070704_100620353
500 Ga0068855_100068406
501 Ga0068855_100838336
502 Ga0070664_100504548
503 Ga0068854_100022790
504 Ga0068854_100927452
505 Ga0068856_100396545
506 Ga0068856_100972996
507 Ga0068856_101245279
508 Ga0070702_100004726
509 Ga0070702_100291664
510 Ga0068852_100036528
511 Ga0068859_101249260
512 Ga0068866_10013652
513 Ga0068866_10547350
514 Ga0068861_100041443
515 Ga0068851_10688550
516 Ga0068870_10372639
517 Ga0068870_11199640
518 Ga0068858_100427650
519 Ga0068860_100616824
520 Ga0068862_100061594
521 Ga0081455_10046034
522 Ga0081455_10166308
523 Ga0081539_10001453
524 Ga0070717_10072519
525 Ga0070717_10136435
526 Ga0070717_10805487
527 Ga0070717_10837661
528 Ga0075365_10821286
529 Ga0075432_10066791
530 Ga0075432_10212507
531 Ga0070715_10079167
532 Ga0070715_10316343
533 Ga0070715_10769405
534 Ga0070716_100036798
535 Ga0070716_100249758
536 Ga0070712_100025063
537 Ga0070712_100038122
538 Ga0070712_100081654
539 Ga0070712_100173140
540 Ga0097621_100076518
541 Ga0097621_101990454
542 Ga0068871_100004933
543 Ga0075431_100407521
544 Ga0075433_10121826
545 Ga0075434_100008855
546 Ga0075434_100891347
547 Ga0068865_100045040
548 Ga0075436_100003758
549 Ga0075436_100550141
550 Ga0097620_101249526
551 Ga0075435_100023583
552 Ga0075435_100039867
553 Ga0075435_101140361
554 Ga0105250_10120330
555 Ga0105245_10018852
556 Ga0105245_10036239
557 Ga0105245_10727739
558 Ga0114129_10019334
559 Ga0105243_10040105
560 Ga0105243_11334511
561 Ga0105241_11531480
562 Ga0105241_11552199
563 Ga0105242_10029382
564 Ga0105237_10215256
565 Ga0105238_10752615
566 Ga0105249_10057371
567 Ga0105239_10062564
568 Ga0157313_1020106
569 Ga0157324_1025983
570 Ga0157371_10068458
571 Ga0157370_11073459
572 Ga0157378_10231691
573 Ga0163162_10165759
574 Ga0157375_10064409
575 Ga0157375_10831011
576 Ga0157380_10059485
577 Ga0182008_10351282
578 Ga0157376_10041785
579 Ga0157376_10069560
580 Ga0163161_10118208
581 Ga0213874_10072263
582 Ga0207656_10457311
583 Ga0207642_10408184
584 Ga0207680_10921835
585 Ga0207685_10183462
586 Ga0207699_10155728
587 Ga0207699_11430512
588 Ga0207645_10071275
589 Ga0207654_10082206
590 Ga0207654_11073896
591 Ga0207707_10185707
592 Ga0207707_10602043
593 Ga0207695_10870064
594 Ga0207671_10888201
595 Ga0207693_10028734
596 Ga0207693_10184589
597 Ga0207693_10232177
598 Ga0207693_10238798
599 Ga0207693_10617652
600 Ga0207663_10085581
601 Ga0207663_10149648
602 Ga0207663_10245487
603 Ga0207663_11323898
604 Ga0207660_10068536
605 Ga0207660_10117557
606 Ga0207660_10166601
607 Ga0207662_10019635
608 Ga0207662_10602711
609 Ga0207657_10024749
610 Ga0207652_10608652
611 Ga0207681_10165581
612 Ga0207687_10500923
613 Ga0207687_11248040
614 Ga0207700_10088877
615 Ga0207700_10105135
616 Ga0207700_10345634
617 Ga0207700_10387363
618 Ga0207700_10423752
619 Ga0207700_10482423
620 Ga0207700_10568718
621 Ga0207700_10748592
622 Ga0207664_10073192
623 Ga0207664_10118171
624 Ga0207690_10061756
625 Ga0207706_10016795
626 Ga0207709_10095772
627 Ga0207709_10306854
628 Ga0207709_11048102
629 Ga0207670_10456042
630 Ga0207669_10073063
631 Ga0207704_10013949
632 Ga0207665_10008334
633 Ga0207691_10058712
634 Ga0207689_10700918
635 Ga0207689_11126620
636 Ga0207661_11687204
637 Ga0207679_10760580
638 Ga0207667_10185728
639 Ga0207651_11163246
640 Ga0207712_10029737
641 Ga0207668_10132091
642 Ga0207640_11300523
643 Ga0207658_10129038
644 Ga0207677_10277669
645 Ga0207677_10716825
646 Ga0207703_10434229
647 Ga0207639_10053871
648 Ga0207708_10003703
649 Ga0207708_10048987
650 Ga0207702_10093555
651 Ga0207702_10242844
652 Ga0207702_12037395
653 Ga0207648_10029159
654 Ga0207675_100004367
655 Ga0207683_10006871
656 Ga0207683_10113983
657 Ga0207698_10045809
658 Ga0268265_10178584
659 Ga0268264_10051678
660 Ga0373948_0057176
661 Ga0373959_0036131
662 Ga0373940_0206633
663 Ga0373951_0014155
664 Ga0373923_0226225
665 Ga0373941_0047532
666 Ga0373960_0287463
667 Ga0373943_0008009
668 Ga0373943_0287359
669 Ga0373943_0420361
670 Ga0373942_0028416
671 Ga0373961_0022180
672 Ga0373962_0007659
673 Ga0373931_0020343
674 Ga0373931_1076697
675 Ga0373935_0078396
676 Ga0373935_0109186
677 Ga0373927_0962623
678 Ga0373947_0071988
679 Ga0373937_1392736
680 Ga0373925_1258146
681 Ga0373925_1587336
682 Ga0373925_1792518
683 Ga0395899_0015260
684 Ga0395899_0057333
685 Ga0395899_0121092
686 Ga0395899_0211385
687 Ga0395899_0548598
688 Ga0395900_0018151
689 Ga0395900_0033986
690 Ga0395900_0050845
691 Ga0395900_0121686
692 Ga0395900_0197037
693 Ga0395898_0011561
694 Ga0395898_0015753
695 Ga0395898_0134784
696 Ga0395898_0159476
697 Ga0395898_1387908
698 Ga0395905_0013484
699 Ga0395905_0060979
700 Ga0395905_0429719
701 Ga0395905_0762456
702 Ga0395901_0013213
703 Ga0395901_0014765
704 Ga0395901_0041838
705 Ga0395901_0260456
706 Ga0395901_0762664
707 Ga0436363_0113379
708 Ga0436363_1161123
709 Ga0436363_1532653
710 Ga0451793_0887223
711 Ga0451807_0922740
712 Ga0451833_1381382
713 Ga0451835_0113505
714 Ga0451851_0511165
715 Ga0451853_0237903
716 Ga0439450_043859
717 Ga0451576_0057417
718 Ga0495603_0002669
719 Ga0495641_0002430
720 Ga0495651_0354468
721 Ga0495580_0095744
722 Ga0495664_0791942
723 Ga0495584_0066359
724 Ga0495594_0003650
725 Ga0495608_0489405
726 Ga0495630_0265830
727 Ga0495630_0429133
728 Ga0495666_0044792
729 Ga0495652_0394701
730 Ga0495652_0499799
731 Ga0495652_1078571
732 Ga0495645_0036735
733 Ga0495622_0078340
734 Ga0495656_0077244
735 Ga0495635_1054242
736 Ga0495659_0027184
737 Ga0495588_0000537
738 Ga0495657_0763796
739 Ga0495657_0823672
740 Ga0495599_0633038
741 Ga0495623_0671724
742 Ga0495646_0555655
743 Ga0495670_0404149
744 Ga0495581_0223094
745 Ga0495604_0605420
746 Ga0495674_0314337
747 Ga0495676_0003263
748 Ga0495593_0196655
749 Ga0496100_0042127
750 Ga0496100_0061010
751 Ga0496100_0324250
752 Ga0496101_0079116
753 Ga0496101_0116988
754 Ga0496101_0224496
755 Ga0496102_0011804
756 Ga0496102_0054541
757 Ga0496102_0075421
758 Ga0496102_0467515
759 Ga0496103_0077696
760 Ga0496104_0040087
761 Ga0496104_0275799
762 Ga0496104_0650073
763 Ga0496105_0050640
764 Ga0496105_0103513
765 Ga0496106_0098622
766 Ga0496106_0268589
767 Ga0496106_0863304
768 Ga0496106_0867695
769 Ga0496107_0200933
770 Ga0496107_0290358
771 Ga0496107_0421851
772 Ga0496108_0886144
773 Ga0496109_0369337
774 Ga0496109_0436841
775 Ga0496110_0153694
776 Ga0496110_0524386
777 Ga0496110_0671700
778 Ga0496111_0075243
779 Ga0496111_0262861
780 Ga0496112_0024375
781 Ga0496112_0029080
782 Ga0496112_0061655
783 Ga0496112_0208649
784 Ga0496112_0407710
785 Ga0496113_0349915
786 Ga0496113_0386353
787 Ga0496113_0565593
788 Ga0496114_0040098
789 Ga0496114_0230878
790 Ga0496114_0517563
791 Ga0496115_0078804
792 Ga0496115_0289432
793 Ga0496115_0914743
794 Ga0501031_0814964
795 Ga0501038_0285641
796 Ga0501040_0423478
797 Ga0501042_0380933
798 Ga0501042_0643479
799 Ga0501042_1242955
800 Ga0501067_0662940
801 Ga0501070_1505387
802 Ga0501071_0090160
803 Ga0501074_1148263
804 Ga0501076_0244553
805 Ga0501079_0354378
806 Ga0501081_0250611
807 Ga0501045_0998719
808 nmdc:mga05p37_18434_c1
809 nmdc:mga06r32_186831_c1
810 nmdc:mga0n895_76495_c1
811 nmdc:mga0rr50_351809_c1
812 nmdc:mga0rr50_634562_c1
813 nmdc:mga08x19_14799_c1
814 nmdc:mga08x19_86575_c1
815 nmdc:mga0a205_185776_c1
816 Ga0501084_0294004

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

30

132

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ocv-assembly2.cif.gz_C the f116w mutant structure of ketosteroid isomerase from comamonas testosteroni 0.879 5 119
5ugi-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase d38gf54a mutant from pseudomonas testosteroni (tksi) bound to equilenin 0.8646 4 119
1ohs-assembly2.cif.gz_D crystal structure of 5-3-ketosteroid isomerase mutant y14f/d38n from pseudomonas testosteroni complexed with androstanedione 0.8626 1 119
1ohp-assembly2.cif.gz_C crystal structure of 5-3-ketosteroid isomerase mutant d38n from pseudomonas testosteroni complexed with 5alpha-estran-3,17-dione 0.8537 1 119
3ov4-assembly1.cif.gz_B crystal structure of ketosteroid isomerase p39gv40gs42g from pseudomonas testosteroni (tksi) bound to equilenin 0.8502 1 119
ID Description Score Start End Superfamily
5jppA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8504 6 113 3.10.450.50
5cxoA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8326 8 118 3.10.450.50
af_Q10083_1_118_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8325 4 115 3.10.450.50
1nu3A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8278 17 114 3.10.450.50
2geyC00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8266 4 113 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A538MPU6-F1-model_v4 Nuclear transport factor 2 family protein 0.9752 6 127
AF-A0A7V9PZF7-F1-model_v4 Nuclear transport factor 2 family protein 0.9447 3 128
AF-A0A7W1BVG5-F1-model_v4 Nuclear transport factor 2 family protein 0.9447 29 124
AF-A0A538FSW3-F1-model_v4 Nuclear transport factor 2 family protein 0.9405 1 128
AF-A0A7J9WVM4-F1-model_v4 SnoaL-like domain-containing protein 0.9364 4 128

Map