F436711

General Info

Members Datasets Scaffolds Average Seq Length
408 214 816 281

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10496364|Ga0105249_104963641
Length 333
Sequence VSQVAVPSDKRFRRAHVKPARQRRSWRTWTGRPVRYALLAVALAYAAYRGAGFVAQAHVLPIENIVVRGNEHMSSAEVLAVLTGLRGQSLLWTNLEVWRHRLLSSPWVRDANLRRSLPSTIEVVVAERQPSGIARIGGRLYLVDDHGVIIDEYGPTYAKFDLPVIDGLPEPSETGATDAARMDLAARVIASLRPTPEIATRLSQIDVRDAHNATVILSGDSAMIQLGDQQFLKRLQSYLELAPTLRDRVADIDYVDLRFDSRVYVRPAGKPAKAQKNGVMAPAPKGCRQPASRLVPKPALMKSPVQCSLVIAGTGLSGLGAPGTEVKRSVVLL

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
126 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
127 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
128 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
129 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
130 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
131 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
132 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
133 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
134 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
135 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
137 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
139 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
140 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
141 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
142 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
143 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
144 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
151 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
158 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
159 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
160 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
161 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
214 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 5.39
Rhizosphere 94.36
Stem 0
Stem Tuber 0
Unclassified 9.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_10496364 3300009553 Bacteria 1265
2 Ga0070690_100073894 3300005330 Unclassified 2219
3 Ga0070690_100134773 3300005330 Bacteria 1671
4 Ga0070670_100069337 3300005331 Bacteria 3026
5 Ga0068869_100084186 3300005334 Bacteria 2380
6 Ga0068869_100111710 3300005334 Bacteria 2080
7 Ga0070666_10083458 3300005335 Bacteria 2186
8 Ga0070666_10149896 3300005335 Bacteria 1627
9 Ga0070666_10169419 3300005335 Bacteria 1529
10 Ga0068868_100016833 3300005338 Bacteria 5438
11 Ga0068868_100138480 3300005338 Bacteria 1996
12 Ga0070691_10002957 3300005341 Bacteria 7611
13 Ga0070687_100011520 3300005343 Bacteria 3871
14 Ga0070668_100020662 3300005347 Bacteria 4971
15 Ga0070668_100111594 3300005347 Bacteria 2177
16 Ga0070669_100017860 3300005353 Bacteria 5064
17 Ga0070669_100018540 3300005353 Bacteria 4972
18 Ga0070669_100052139 3300005353 Bacteria 2992
19 Ga0070669_100294966 3300005353 Bacteria 1303
20 Ga0070675_100000251 3300005354 Bacteria 34921
21 Ga0070674_100112443 3300005356 Bacteria 2002
22 Ga0070674_100280468 3300005356 Unclassified 1320
23 Ga0070659_100343437 3300005366 Bacteria 1251
24 Ga0070667_100009935 3300005367 Bacteria 7887
25 Ga0070703_10091096 3300005406 Bacteria 1057
26 Ga0070701_10029377 3300005438 Bacteria 2711
27 Ga0070701_10157501 3300005438 Bacteria 1313
28 Ga0070705_100027325 3300005440 Bacteria 3115
29 Ga0070705_100174614 3300005440 Bacteria 1449
30 Ga0070700_100053604 3300005441 Bacteria 2518
31 Ga0070694_100010527 3300005444 Bacteria 5709
32 Ga0070708_100057899 3300005445 Bacteria 3452
33 Ga0070678_100194177 3300005456 Unclassified 1671
34 Ga0070662_100065678 3300005457 Bacteria 2660
35 Ga0070662_100170127 3300005457 Bacteria 1711
36 Ga0068867_100070048 3300005459 Bacteria 2621
37 Ga0068867_100092356 3300005459 Bacteria 2299
38 Ga0068867_100142364 3300005459 Unclassified 1876
39 Ga0068867_100297814 3300005459 Unclassified 1329
40 Ga0068867_100356731 3300005459 Bacteria 1222
41 Ga0070685_10239070 3300005466 Bacteria 1198
42 Ga0070706_100419176 3300005467 Unclassified 1246
43 Ga0070707_100147151 3300005468 Bacteria 2293
44 Ga0070698_100051213 3300005471 Bacteria 4207
45 Ga0070698_100094591 3300005471 Bacteria 2967
46 Ga0070698_100257428 3300005471 Bacteria 1678
47 Ga0070699_100001478 3300005518 Bacteria 21521
48 Ga0070699_100204006 3300005518 Bacteria 1759
49 Ga0070697_100002728 3300005536 Bacteria 13607
50 Ga0070697_100386959 3300005536 Unclassified 1212
51 Ga0070672_100051078 3300005543 Bacteria 3223
52 Ga0070686_100000389 3300005544 Bacteria 28031
53 Ga0070686_100169193 3300005544 Bacteria 1544
54 Ga0070695_100010139 3300005545 Bacteria 5618
55 Ga0070695_100233019 3300005545 Bacteria 1332
56 Ga0070696_100007055 3300005546 Bacteria 7501
57 Ga0070696_100030043 3300005546 Bacteria 3718
58 Ga0070696_100115561 3300005546 Bacteria 1936
59 Ga0070696_100249053 3300005546 Bacteria 1343
60 Ga0070665_100009060 3300005548 Bacteria 10083
61 Ga0070665_100015153 3300005548 Bacteria 7739
62 Ga0070665_100306656 3300005548 Bacteria 1591
63 Ga0070664_100312773 3300005564 Bacteria 1422
64 Ga0070664_100436159 3300005564 Unclassified 1201
65 Ga0068854_100079278 3300005578 Bacteria 2421
66 Ga0070702_100010304 3300005615 Bacteria 4597
67 Ga0068859_100100819 3300005617 Bacteria 2944
68 Ga0068864_100009659 3300005618 Bacteria 7959
69 Ga0068866_10021806 3300005718 Bacteria 2955
70 Ga0068866_10025669 3300005718 Bacteria 2773
71 Ga0068861_100003921 3300005719 Bacteria 9946
72 Ga0068861_100032487 3300005719 Bacteria 3842
73 Ga0068861_100218272 3300005719 Bacteria 1610
74 Ga0068861_100660390 3300005719 Bacteria 967
75 Ga0068851_10161444 3300005834 Unclassified 1231
76 Ga0068863_100025611 3300005841 Bacteria 5624
77 Ga0068863_100042624 3300005841 Bacteria 4313
78 Ga0068863_100187210 3300005841 Bacteria 1989
79 Ga0068863_100250341 3300005841 Bacteria 1711
80 Ga0068858_100003519 3300005842 Bacteria 15516
81 Ga0068858_100116221 3300005842 Bacteria 2500
82 Ga0068858_100188711 3300005842 Bacteria 1948
83 Ga0068858_100196204 3300005842 Bacteria 1908
84 Ga0068858_100619080 3300005842 Unclassified 1051
85 Ga0068860_100138961 3300005843 Bacteria 2334
86 Ga0068860_100193447 3300005843 Unclassified 1969
87 Ga0068862_100038728 3300005844 Bacteria 4045
88 Ga0068862_100192378 3300005844 Bacteria 1836
89 Ga0070717_10023988 3300006028 Bacteria 4840
90 Ga0070715_10018165 3300006163 Bacteria 2676
91 Ga0097621_100002420 3300006237 Bacteria 12781
92 Ga0097621_100013796 3300006237 Bacteria 6032
93 Ga0097621_100125874 3300006237 Bacteria 2176
94 Ga0097621_100157652 3300006237 Bacteria 1949
95 Ga0097621_100181887 3300006237 Bacteria 1817
96 Ga0097621_100203411 3300006237 Bacteria 1720
97 Ga0097621_100317981 3300006237 Bacteria 1378
98 Ga0068871_100003478 3300006358 Bacteria 10822
99 Ga0068871_100016752 3300006358 Bacteria 5530
100 Ga0068871_100020606 3300006358 Bacteria 5054
101 Ga0068871_100063763 3300006358 Bacteria 3015
102 Ga0068871_100216042 3300006358 Bacteria 1660
103 Ga0075428_100275511 3300006844 Bacteria 1810
104 Ga0075431_100023007 3300006847 Bacteria 6370
105 Ga0075431_100102200 3300006847 Bacteria 2958
106 Ga0075431_100212282 3300006847 Bacteria 1977
107 Ga0075433_10021034 3300006852 Bacteria 5465
108 Ga0075433_10026593 3300006852 Bacteria 4901
109 Ga0075433_10104430 3300006852 Bacteria 2510
110 Ga0075434_100004962 3300006871 Bacteria 12067
111 Ga0075434_100006526 3300006871 Bacteria 10698
112 Ga0075434_100118921 3300006871 Bacteria 2656
113 Ga0068865_100005722 3300006881 Bacteria 7555
114 Ga0075436_100016179 3300006914 Bacteria 5107
115 Ga0075436_100066255 3300006914 Bacteria 2496
116 Ga0075436_100104753 3300006914 Bacteria 1972
117 Ga0075436_100239060 3300006914 Bacteria 1291
118 Ga0097620_100100820 3300006931 Bacteria 2944
119 Ga0075435_100000052 3300007076 Bacteria 58955
120 Ga0075435_100000404 3300007076 Bacteria 26487
121 Ga0075435_100048012 3300007076 Bacteria 3428
122 Ga0075435_100117041 3300007076 Bacteria 2221
123 Ga0075435_100304325 3300007076 Bacteria 1364
124 Ga0105240_10506941 3300009093 Bacteria 1341
125 Ga0111539_10032700 3300009094 Bacteria 6316
126 Ga0111539_10111750 3300009094 Bacteria 3206
127 Ga0111539_10664384 3300009094 Unclassified 1213
128 Ga0105245_10017399 3300009098 Bacteria 6270
129 Ga0105245_10027307 3300009098 Bacteria 5029
130 Ga0105245_10104525 3300009098 Bacteria 2626
131 Ga0105245_10443951 3300009098 Bacteria 1305
132 Ga0105245_10469428 3300009098 Bacteria 1270
133 Ga0105247_10013694 3300009101 Bacteria 4863
134 Ga0105247_10024465 3300009101 Bacteria 3640
135 Ga0105247_10332640 3300009101 Bacteria 1063
136 Ga0114129_10000307 3300009147 Bacteria 57086
137 Ga0114129_10004401 3300009147 Bacteria 19869
138 Ga0114129_10007713 3300009147 Bacteria 15313
139 Ga0114129_10054288 3300009147 Bacteria 5618
140 Ga0114129_10180049 3300009147 Bacteria 2877
141 Ga0114129_10256932 3300009147 Bacteria 2343
142 Ga0105243_10006225 3300009148 Bacteria 9226
143 Ga0105241_10272316 3300009174 Bacteria 1443
144 Ga0105242_10030906 3300009176 Bacteria 4277
145 Ga0105242_10221969 3300009176 Bacteria 1689
146 Ga0105242_10262451 3300009176 Bacteria 1561
147 Ga0105248_10018850 3300009177 Bacteria 7633
148 Ga0105248_10074482 3300009177 Bacteria 3816
149 Ga0105248_10103712 3300009177 Bacteria 3206
150 Ga0105248_10209553 3300009177 Bacteria 2196
151 Ga0105248_10277155 3300009177 Bacteria 1888
152 Ga0105248_10335485 3300009177 Bacteria 1702
153 Ga0105248_10360816 3300009177 Bacteria 1636
154 Ga0105248_10362889 3300009177 Bacteria 1631
155 Ga0105248_10658911 3300009177 Unclassified 1181
156 Ga0105248_10982056 3300009177 Unclassified 954
157 Ga0157374_10040057 3300013296 Bacteria 4314
158 Ga0157374_10054141 3300013296 Bacteria 3742
159 Ga0157374_10829991 3300013296 Bacteria 941
160 Ga0157378_10381431 3300013297 Bacteria 1384
161 Ga0163162_10316264 3300013306 Bacteria 1694
162 Ga0163162_10332337 3300013306 Unclassified 1652
163 Ga0157375_10533929 3300013308 Bacteria 1336
164 Ga0163163_10009279 3300014325 Bacteria 8775
165 Ga0163163_10148363 3300014325 Bacteria 2389
166 Ga0163163_10515141 3300014325 Unclassified 1258
167 Ga0157380_10093913 3300014326 Bacteria 2481
168 Ga0157377_10037769 3300014745 Bacteria 2662
169 Ga0157377_10125371 3300014745 Bacteria 1562
170 Ga0157377_10184844 3300014745 Bacteria 1313
171 Ga0157379_10048482 3300014968 Bacteria 3791
172 Ga0157379_10097302 3300014968 Bacteria 2642
173 Ga0157379_10140668 3300014968 Bacteria 2176
174 Ga0157376_10008845 3300014969 Bacteria 7288
175 Ga0157376_10030525 3300014969 Bacteria 4305
176 Ga0157376_10258430 3300014969 Bacteria 1630
177 Ga0207697_10082066 3300025315 Bacteria 1359
178 Ga0207642_10048147 3300025899 Bacteria 1909
179 Ga0207642_10067290 3300025899 Bacteria 1690
180 Ga0207680_10077948 3300025903 Unclassified 2074
181 Ga0207685_10028119 3300025905 Bacteria 1976
182 Ga0207699_10031218 3300025906 Bacteria 2989
183 Ga0207645_10000703 3300025907 Bacteria 27863
184 Ga0207645_10046241 3300025907 Bacteria 2780
185 Ga0207645_10140809 3300025907 Unclassified 1572
186 Ga0207643_10016186 3300025908 Bacteria 4066
187 Ga0207663_10251985 3300025916 Bacteria 1300
188 Ga0207662_10030743 3300025918 Bacteria 3118
189 Ga0207646_10079288 3300025922 Bacteria 2936
190 Ga0207646_10082961 3300025922 Bacteria 2867
191 Ga0207646_10086831 3300025922 Bacteria 2799
192 Ga0207681_10013073 3300025923 Bacteria 5132
193 Ga0207681_10243066 3300025923 Bacteria 1402
194 Ga0207650_10202277 3300025925 Bacteria 1592
195 Ga0207659_10000220 3300025926 Bacteria 34521
196 Ga0207687_10009947 3300025927 Bacteria 6227
197 Ga0207687_10019588 3300025927 Bacteria 4484
198 Ga0207687_10283413 3300025927 Bacteria 1329
199 Ga0207687_10362409 3300025927 Bacteria 1183
200 Ga0207687_10503384 3300025927 Bacteria 1011
201 Ga0207690_10524395 3300025932 Unclassified 960
202 Ga0207706_10031369 3300025933 Bacteria 4735
203 Ga0207706_10230692 3300025933 Bacteria 1620
204 Ga0207706_10342626 3300025933 Bacteria 1300
205 Ga0207686_10086162 3300025934 Bacteria 2062
206 Ga0207670_10043243 3300025936 Bacteria 2973
207 Ga0207704_10016410 3300025938 Bacteria 3805
208 Ga0207665_10052698 3300025939 Bacteria 2741
209 Ga0207691_10087800 3300025940 Bacteria 2789
210 Ga0207691_10318502 3300025940 Bacteria 1334
211 Ga0207711_10016775 3300025941 Bacteria 6081
212 Ga0207711_10236354 3300025941 Bacteria 1675
213 Ga0207711_10462142 3300025941 Unclassified 1182
214 Ga0207689_10092907 3300025942 Bacteria 2479
215 Ga0207689_10123883 3300025942 Bacteria 2126
216 Ga0207689_10201583 3300025942 Bacteria 1642
217 Ga0207679_10627703 3300025945 Unclassified 970
218 Ga0207651_10118410 3300025960 Bacteria 2003
219 Ga0207651_10156798 3300025960 Bacteria 1780
220 Ga0207712_10123392 3300025961 Bacteria 1963
221 Ga0207712_10321185 3300025961 Bacteria 1277
222 Ga0207640_10331583 3300025981 Bacteria 1215
223 Ga0207658_10050511 3300025986 Bacteria 3060
224 Ga0207677_10006186 3300026023 Bacteria 6543
225 Ga0207677_10077171 3300026023 Bacteria 2375
226 Ga0207677_10110379 3300026023 Bacteria 2047
227 Ga0207677_10212767 3300026023 Bacteria 1545
228 Ga0207703_10010233 3300026035 Bacteria 7349
229 Ga0207703_10099309 3300026035 Bacteria 2464
230 Ga0207703_10263567 3300026035 Bacteria 1558
231 Ga0207703_10811833 3300026035 Bacteria 893
232 Ga0207708_10023824 3300026075 Bacteria 4628
233 Ga0207708_10110249 3300026075 Bacteria 2136
234 Ga0207641_10001027 3300026088 Bacteria 28287
235 Ga0207641_10032616 3300026088 Bacteria 4325
236 Ga0207641_10128632 3300026088 Bacteria 2271
237 Ga0207648_10040904 3300026089 Bacteria 4072
238 Ga0207648_10067241 3300026089 Bacteria 3125
239 Ga0207648_10073203 3300026089 Bacteria 2986
240 Ga0207648_10105073 3300026089 Bacteria 2477
241 Ga0207648_10317453 3300026089 Bacteria 1400
242 Ga0207676_10106411 3300026095 Bacteria 2337
243 Ga0207676_10181712 3300026095 Bacteria 1842
244 Ga0207674_10262365 3300026116 Bacteria 1675
245 Ga0207675_100002118 3300026118 Bacteria 19672
246 Ga0207675_100221386 3300026118 Bacteria 1823
247 Ga0207675_100449111 3300026118 Bacteria 1277
248 Ga0207675_100604627 3300026118 Bacteria 1100
249 Ga0207675_100666915 3300026118 Unclassified 1047
250 Ga0207683_10061464 3300026121 Bacteria 3306
251 Ga0207683_10089609 3300026121 Bacteria 2738
252 Ga0207683_10250392 3300026121 Bacteria 1617
253 Ga0207683_10258026 3300026121 Bacteria 1591
254 Ga0209998_10006844 3300027717 Bacteria 2366
255 Ga0207428_10080467 3300027907 Bacteria 2545
256 Ga0207428_10190710 3300027907 Bacteria 1545
257 Ga0268266_10015504 3300028379 Bacteria 6537
258 Ga0268265_10003653 3300028380 Bacteria 10969
259 Ga0268265_10023768 3300028380 Bacteria 4325
260 Ga0268265_10024337 3300028380 Bacteria 4282
261 Ga0268265_10883294 3300028380 Unclassified 877
262 Ga0268264_10092088 3300028381 Bacteria 2616
263 Ga0268264_10197254 3300028381 Bacteria 1839
264 Ga0268264_10366466 3300028381 Bacteria 1376
265 Ga0268264_10371616 3300028381 Bacteria 1367
266 Ga0268264_10407295 3300028381 Bacteria 1308
267 Ga0268264_10537030 3300028381 Bacteria 1145
268 Ga0307408_100008745 3300031548 Bacteria 6684
269 Ga0265314_10052583 3300031711 Bacteria 2830
270 Ga0307405_10242055 3300031731 Bacteria 1337
271 Ga0307416_100839553 3300032002 Unclassified 1016
272 Ga0307414_10139292 3300032004 Bacteria 1897
273 Ga0307415_100042345 3300032126 Bacteria 3030
274 Ga0373930_0001445 3300034816 Bacteria 3535
275 Ga0373948_0000149 3300034817 Bacteria 7612
276 Ga0373958_0013246 3300034819 Bacteria 1425
277 Ga0373959_0001231 3300034820 Bacteria 4127
278 Ga0373938_0009035 3300034957 Unclassified 1794
279 Ga0373928_0000264 3300035084 Bacteria 10408
280 Ga0373928_0012536 3300035084 Bacteria 1692
281 Ga0373929_0000677 3300035085 Bacteria 6573
282 Ga0373940_0000557 3300035088 Bacteria 5901
283 Ga0373940_0033145 3300035088 Bacteria 1388
284 Ga0373949_0001614 3300035090 Bacteria 6314
285 Ga0373951_0000285 3300035091 Bacteria 16211
286 Ga0373923_0152224 3300035111 Unclassified 1051
287 Ga0373932_0001328 3300035112 Bacteria 6943
288 Ga0373936_0159604 3300035113 Unclassified 982
289 Ga0373941_0000166 3300035115 Bacteria 12126
290 Ga0373945_0034045 3300035116 Bacteria 1814
291 Ga0373960_0000765 3300035121 Bacteria 6722
292 Ga0373943_0002966 3300035170 Bacteria 7700
293 Ga0373943_0153478 3300035170 Bacteria 1249
294 Ga0373946_0006253 3300035171 Bacteria 4313
295 Ga0373946_0125638 3300035171 Bacteria 1175
296 Ga0373946_0255010 3300035171 Unclassified 857
297 Ga0373942_0000475 3300035207 Bacteria 11401
298 Ga0373962_0000879 3300035242 Bacteria 6861
299 Ga0373931_0132947 3300035691 Bacteria 1434
300 Ga0373935_0068263 3300035692 Bacteria 2288
301 Ga0373935_0379393 3300035692 Unclassified 1012
302 Ga0373947_0010480 3300035725 Bacteria 5318
303 Ga0373937_0031247 3300036401 Bacteria 4824
304 Ga0373937_0197440 3300036401 Bacteria 1891
305 Ga0373937_0203797 3300036401 Bacteria 1860
306 Ga0373937_0257994 3300036401 Unclassified 1644
307 Ga0373937_0314002 3300036401 Unclassified 1483
308 Ga0373937_0369899 3300036401 Unclassified 1359
309 Ga0373925_0034548 3300037068 Bacteria 3727
310 Ga0450923_028663 3300042125 Unclassified 1125
311 Ga0439435_0005679 3300042436 Bacteria 2758
312 Ga0466957_0284187 3300044842 Bacteria 1108
313 Ga0451576_0192203 3300045051 Bacteria 2132
314 Ga0495592_0122922 3300046454 Bacteria 1824
315 Ga0495641_0169943 3300046461 Bacteria 976
316 Ga0495580_0197126 3300046472 Bacteria 1388
317 Ga0495582_0151519 3300046473 Bacteria 1317
318 Ga0495639_0079574 3300046475 Bacteria 1525
319 Ga0495664_0148645 3300046477 Bacteria 1421
320 Ga0495608_0002409 3300046511 Bacteria 13462
321 Ga0495618_0276316 3300046514 Unclassified 1049
322 Ga0495628_0011045 3300046516 Bacteria 7643
323 Ga0495630_0008441 3300046517 Bacteria 7392
324 Ga0495652_0184996 3300046529 Bacteria 1595
325 Ga0495640_0060824 3300046533 Bacteria 2568
326 Ga0495586_0235459 3300046535 Unclassified 1043
327 Ga0495645_0003669 3300046543 Bacteria 10429
328 Ga0495645_0013426 3300046543 Bacteria 5790
329 Ga0495667_0155750 3300046559 Bacteria 1470
330 Ga0495667_0160333 3300046559 Unclassified 1447
331 Ga0495635_0253107 3300046663 Bacteria 1187
332 Ga0495658_0039388 3300046683 Bacteria 2622
333 Ga0495658_0432138 3300046683 Bacteria 840
334 Ga0495669_0001138 3300046684 Bacteria 11003
335 Ga0495669_0049260 3300046684 Unclassified 1886
336 Ga0495613_0032041 3300046689 Bacteria 3905
337 Ga0495600_0055333 3300046809 Bacteria 2591
338 Ga0495675_0168486 3300047444 Bacteria 1346
339 Ga0495684_0000189 3300047471 Bacteria 47374
340 Ga0495684_0015249 3300047471 Bacteria 5920
341 Ga0495684_0097310 3300047471 Bacteria 2226
342 Ga0495614_0137338 3300048089 Bacteria 1085
343 Ga0496100_0002648 3300048903 Bacteria 9135
344 Ga0496101_0008879 3300048904 Bacteria 6580
345 Ga0496102_0025904 3300048905 Bacteria 5225
346 Ga0496102_0044668 3300048905 Bacteria 4022
347 Ga0496104_0137995 3300048907 Unclassified 2343
348 Ga0496104_0221011 3300048907 Bacteria 1806
349 Ga0496104_0222691 3300048907 Bacteria 1799
350 Ga0496104_0407301 3300048907 Bacteria 1272
351 Ga0496105_0138363 3300048908 Bacteria 2005
352 Ga0496105_0322750 3300048908 Bacteria 1237
353 Ga0496106_0146895 3300048909 Bacteria 1858
354 Ga0496106_0166378 3300048909 Bacteria 1746
355 Ga0496107_0438263 3300048910 Unclassified 971
356 Ga0496108_0009993 3300048911 Bacteria 7693
357 Ga0496109_0121383 3300048912 Bacteria 2435
358 Ga0496112_0004886 3300048915 Bacteria 11461
359 Ga0496112_0442829 3300048915 Unclassified 1237
360 Ga0496114_0027323 3300048917 Bacteria 4673
361 Ga0496114_0115082 3300048917 Bacteria 2307
362 Ga0496114_0140841 3300048917 Bacteria 2088
363 Ga0496115_0040626 3300048918 Bacteria 3699
364 Ga0496115_0165917 3300048918 Bacteria 1826
365 Ga0501039_0096165 3300049575 Bacteria 2309
366 Ga0501040_0028094 3300049576 Bacteria 3791
367 Ga0501041_0012504 3300049577 Bacteria 5028
368 Ga0501042_0062091 3300049578 Bacteria 2669
369 Ga0501048_0078027 3300049582 Bacteria 2337
370 Ga0501048_0142047 3300049582 Bacteria 1698
371 Ga0501067_0224967 3300049583 Bacteria 1045
372 Ga0501071_0057082 3300049587 Bacteria 2821
373 Ga0501075_0072807 3300049591 Bacteria 2598
374 Ga0501076_0335040 3300049592 Bacteria 1241
375 Ga0501079_0065489 3300049741 Bacteria 2803
376 Ga0501080_0240946 3300049742 Bacteria 1651
377 Ga0501081_0079400 3300049743 Bacteria 2295
378 Ga0501083_0058810 3300049744 Bacteria 2572
379 Ga0501045_0122810 3300049824 Bacteria 1928
380 Ga0501045_0357880 3300049824 Bacteria 1086
381 nmdc:mga05p37_10997_c1 3300050507 Bacteria 10745
382 nmdc:mga05p37_48766_c1 3300050507 Bacteria 5208
383 nmdc:mga05p37_52668_c1 3300050507 Bacteria 5004
384 nmdc:mga05p37_63707_c1 3300050507 Bacteria 4537
385 nmdc:mga05p37_6820_c1 3300050507 Bacteria 13458
386 nmdc:mga05p37_80197_c1 3300050507 Bacteria 4020
387 nmdc:mga08y16_25568_c1 3300050511 Bacteria 6228
388 nmdc:mga0n895_10770_c1 3300050512 Bacteria 8109
389 nmdc:mga0n895_45905_c1 3300050512 Bacteria 4266
390 nmdc:mga0n895_69253_c1 3300050512 Bacteria 3495
391 nmdc:mga0n895_8_c1 3300050512 Bacteria 121439
392 nmdc:mga0rr50_23_c1 3300050513 Bacteria 116800
393 nmdc:mga0rr50_412_c1 3300050513 Bacteria 23244
394 nmdc:mga08x19_165_c1 3300050514 Bacteria 54991
395 nmdc:mga08x19_168423_c1 3300050514 Bacteria 1491
396 nmdc:mga08x19_22298_c1 3300050514 Bacteria 3921
397 nmdc:mga08x19_52759_c1 3300050514 Bacteria 2616
398 nmdc:mga0a205_60465_c1 3300050515 Bacteria 3659
399 Ga0495601_0009077 3300053077 Bacteria 5873
400 Ga0495619_0003439 3300053085 Bacteria 10217
401 Ga0495619_0005158 3300053085 Bacteria 8294
402 Ga0495619_0024198 3300053085 Bacteria 3895
403 Ga0500658_0072587 3300053134 Bacteria 1456
404 Ga0501084_0052134 3300054114 Bacteria 3424
405 Ga0501084_0250306 3300054114 Bacteria 1496
406 Ga0501082_0241462 3300060353 Bacteria 1572
407 Ga0530510_0078392 3300061734 Bacteria 2402
408 Ga0530510_0250129 3300061734 Bacteria 1321
409 Ga0105249_10496364
410 Ga0070690_100073894
411 Ga0070690_100134773
412 Ga0070670_100069337
413 Ga0068869_100084186
414 Ga0068869_100111710
415 Ga0070666_10083458
416 Ga0070666_10149896
417 Ga0070666_10169419
418 Ga0068868_100016833
419 Ga0068868_100138480
420 Ga0070691_10002957
421 Ga0070687_100011520
422 Ga0070668_100020662
423 Ga0070668_100111594
424 Ga0070669_100017860
425 Ga0070669_100018540
426 Ga0070669_100052139
427 Ga0070669_100294966
428 Ga0070675_100000251
429 Ga0070674_100112443
430 Ga0070674_100280468
431 Ga0070659_100343437
432 Ga0070667_100009935
433 Ga0070703_10091096
434 Ga0070701_10029377
435 Ga0070701_10157501
436 Ga0070705_100027325
437 Ga0070705_100174614
438 Ga0070700_100053604
439 Ga0070694_100010527
440 Ga0070708_100057899
441 Ga0070678_100194177
442 Ga0070662_100065678
443 Ga0070662_100170127
444 Ga0068867_100070048
445 Ga0068867_100092356
446 Ga0068867_100142364
447 Ga0068867_100297814
448 Ga0068867_100356731
449 Ga0070685_10239070
450 Ga0070706_100419176
451 Ga0070707_100147151
452 Ga0070698_100051213
453 Ga0070698_100094591
454 Ga0070698_100257428
455 Ga0070699_100001478
456 Ga0070699_100204006
457 Ga0070697_100002728
458 Ga0070697_100386959
459 Ga0070672_100051078
460 Ga0070686_100000389
461 Ga0070686_100169193
462 Ga0070695_100010139
463 Ga0070695_100233019
464 Ga0070696_100007055
465 Ga0070696_100030043
466 Ga0070696_100115561
467 Ga0070696_100249053
468 Ga0070665_100009060
469 Ga0070665_100015153
470 Ga0070665_100306656
471 Ga0070664_100312773
472 Ga0070664_100436159
473 Ga0068854_100079278
474 Ga0070702_100010304
475 Ga0068859_100100819
476 Ga0068864_100009659
477 Ga0068866_10021806
478 Ga0068866_10025669
479 Ga0068861_100003921
480 Ga0068861_100032487
481 Ga0068861_100218272
482 Ga0068861_100660390
483 Ga0068851_10161444
484 Ga0068863_100025611
485 Ga0068863_100042624
486 Ga0068863_100187210
487 Ga0068863_100250341
488 Ga0068858_100003519
489 Ga0068858_100116221
490 Ga0068858_100188711
491 Ga0068858_100196204
492 Ga0068858_100619080
493 Ga0068860_100138961
494 Ga0068860_100193447
495 Ga0068862_100038728
496 Ga0068862_100192378
497 Ga0070717_10023988
498 Ga0070715_10018165
499 Ga0097621_100002420
500 Ga0097621_100013796
501 Ga0097621_100125874
502 Ga0097621_100157652
503 Ga0097621_100181887
504 Ga0097621_100203411
505 Ga0097621_100317981
506 Ga0068871_100003478
507 Ga0068871_100016752
508 Ga0068871_100020606
509 Ga0068871_100063763
510 Ga0068871_100216042
511 Ga0075428_100275511
512 Ga0075431_100023007
513 Ga0075431_100102200
514 Ga0075431_100212282
515 Ga0075433_10021034
516 Ga0075433_10026593
517 Ga0075433_10104430
518 Ga0075434_100004962
519 Ga0075434_100006526
520 Ga0075434_100118921
521 Ga0068865_100005722
522 Ga0075436_100016179
523 Ga0075436_100066255
524 Ga0075436_100104753
525 Ga0075436_100239060
526 Ga0097620_100100820
527 Ga0075435_100000052
528 Ga0075435_100000404
529 Ga0075435_100048012
530 Ga0075435_100117041
531 Ga0075435_100304325
532 Ga0105240_10506941
533 Ga0111539_10032700
534 Ga0111539_10111750
535 Ga0111539_10664384
536 Ga0105245_10017399
537 Ga0105245_10027307
538 Ga0105245_10104525
539 Ga0105245_10443951
540 Ga0105245_10469428
541 Ga0105247_10013694
542 Ga0105247_10024465
543 Ga0105247_10332640
544 Ga0114129_10000307
545 Ga0114129_10004401
546 Ga0114129_10007713
547 Ga0114129_10054288
548 Ga0114129_10180049
549 Ga0114129_10256932
550 Ga0105243_10006225
551 Ga0105241_10272316
552 Ga0105242_10030906
553 Ga0105242_10221969
554 Ga0105242_10262451
555 Ga0105248_10018850
556 Ga0105248_10074482
557 Ga0105248_10103712
558 Ga0105248_10209553
559 Ga0105248_10277155
560 Ga0105248_10335485
561 Ga0105248_10360816
562 Ga0105248_10362889
563 Ga0105248_10658911
564 Ga0105248_10982056
565 Ga0157374_10040057
566 Ga0157374_10054141
567 Ga0157374_10829991
568 Ga0157378_10381431
569 Ga0163162_10316264
570 Ga0163162_10332337
571 Ga0157375_10533929
572 Ga0163163_10009279
573 Ga0163163_10148363
574 Ga0163163_10515141
575 Ga0157380_10093913
576 Ga0157377_10037769
577 Ga0157377_10125371
578 Ga0157377_10184844
579 Ga0157379_10048482
580 Ga0157379_10097302
581 Ga0157379_10140668
582 Ga0157376_10008845
583 Ga0157376_10030525
584 Ga0157376_10258430
585 Ga0207697_10082066
586 Ga0207642_10048147
587 Ga0207642_10067290
588 Ga0207680_10077948
589 Ga0207685_10028119
590 Ga0207699_10031218
591 Ga0207645_10000703
592 Ga0207645_10046241
593 Ga0207645_10140809
594 Ga0207643_10016186
595 Ga0207663_10251985
596 Ga0207662_10030743
597 Ga0207646_10079288
598 Ga0207646_10082961
599 Ga0207646_10086831
600 Ga0207681_10013073
601 Ga0207681_10243066
602 Ga0207650_10202277
603 Ga0207659_10000220
604 Ga0207687_10009947
605 Ga0207687_10019588
606 Ga0207687_10283413
607 Ga0207687_10362409
608 Ga0207687_10503384
609 Ga0207690_10524395
610 Ga0207706_10031369
611 Ga0207706_10230692
612 Ga0207706_10342626
613 Ga0207686_10086162
614 Ga0207670_10043243
615 Ga0207704_10016410
616 Ga0207665_10052698
617 Ga0207691_10087800
618 Ga0207691_10318502
619 Ga0207711_10016775
620 Ga0207711_10236354
621 Ga0207711_10462142
622 Ga0207689_10092907
623 Ga0207689_10123883
624 Ga0207689_10201583
625 Ga0207679_10627703
626 Ga0207651_10118410
627 Ga0207651_10156798
628 Ga0207712_10123392
629 Ga0207712_10321185
630 Ga0207640_10331583
631 Ga0207658_10050511
632 Ga0207677_10006186
633 Ga0207677_10077171
634 Ga0207677_10110379
635 Ga0207677_10212767
636 Ga0207703_10010233
637 Ga0207703_10099309
638 Ga0207703_10263567
639 Ga0207703_10811833
640 Ga0207708_10023824
641 Ga0207708_10110249
642 Ga0207641_10001027
643 Ga0207641_10032616
644 Ga0207641_10128632
645 Ga0207648_10040904
646 Ga0207648_10067241
647 Ga0207648_10073203
648 Ga0207648_10105073
649 Ga0207648_10317453
650 Ga0207676_10106411
651 Ga0207676_10181712
652 Ga0207674_10262365
653 Ga0207675_100002118
654 Ga0207675_100221386
655 Ga0207675_100449111
656 Ga0207675_100604627
657 Ga0207675_100666915
658 Ga0207683_10061464
659 Ga0207683_10089609
660 Ga0207683_10250392
661 Ga0207683_10258026
662 Ga0209998_10006844
663 Ga0207428_10080467
664 Ga0207428_10190710
665 Ga0268266_10015504
666 Ga0268265_10003653
667 Ga0268265_10023768
668 Ga0268265_10024337
669 Ga0268265_10883294
670 Ga0268264_10092088
671 Ga0268264_10197254
672 Ga0268264_10366466
673 Ga0268264_10371616
674 Ga0268264_10407295
675 Ga0268264_10537030
676 Ga0307408_100008745
677 Ga0265314_10052583
678 Ga0307405_10242055
679 Ga0307416_100839553
680 Ga0307414_10139292
681 Ga0307415_100042345
682 Ga0373930_0001445
683 Ga0373948_0000149
684 Ga0373958_0013246
685 Ga0373959_0001231
686 Ga0373938_0009035
687 Ga0373928_0000264
688 Ga0373928_0012536
689 Ga0373929_0000677
690 Ga0373940_0000557
691 Ga0373940_0033145
692 Ga0373949_0001614
693 Ga0373951_0000285
694 Ga0373923_0152224
695 Ga0373932_0001328
696 Ga0373936_0159604
697 Ga0373941_0000166
698 Ga0373945_0034045
699 Ga0373960_0000765
700 Ga0373943_0002966
701 Ga0373943_0153478
702 Ga0373946_0006253
703 Ga0373946_0125638
704 Ga0373946_0255010
705 Ga0373942_0000475
706 Ga0373962_0000879
707 Ga0373931_0132947
708 Ga0373935_0068263
709 Ga0373935_0379393
710 Ga0373947_0010480
711 Ga0373937_0031247
712 Ga0373937_0197440
713 Ga0373937_0203797
714 Ga0373937_0257994
715 Ga0373937_0314002
716 Ga0373937_0369899
717 Ga0373925_0034548
718 Ga0450923_028663
719 Ga0439435_0005679
720 Ga0466957_0284187
721 Ga0451576_0192203
722 Ga0495592_0122922
723 Ga0495641_0169943
724 Ga0495580_0197126
725 Ga0495582_0151519
726 Ga0495639_0079574
727 Ga0495664_0148645
728 Ga0495608_0002409
729 Ga0495618_0276316
730 Ga0495628_0011045
731 Ga0495630_0008441
732 Ga0495652_0184996
733 Ga0495640_0060824
734 Ga0495586_0235459
735 Ga0495645_0003669
736 Ga0495645_0013426
737 Ga0495667_0155750
738 Ga0495667_0160333
739 Ga0495635_0253107
740 Ga0495658_0039388
741 Ga0495658_0432138
742 Ga0495669_0001138
743 Ga0495669_0049260
744 Ga0495613_0032041
745 Ga0495600_0055333
746 Ga0495675_0168486
747 Ga0495684_0000189
748 Ga0495684_0015249
749 Ga0495684_0097310
750 Ga0495614_0137338
751 Ga0496100_0002648
752 Ga0496101_0008879
753 Ga0496102_0025904
754 Ga0496102_0044668
755 Ga0496104_0137995
756 Ga0496104_0221011
757 Ga0496104_0222691
758 Ga0496104_0407301
759 Ga0496105_0138363
760 Ga0496105_0322750
761 Ga0496106_0146895
762 Ga0496106_0166378
763 Ga0496107_0438263
764 Ga0496108_0009993
765 Ga0496109_0121383
766 Ga0496112_0004886
767 Ga0496112_0442829
768 Ga0496114_0027323
769 Ga0496114_0115082
770 Ga0496114_0140841
771 Ga0496115_0040626
772 Ga0496115_0165917
773 Ga0501039_0096165
774 Ga0501040_0028094
775 Ga0501041_0012504
776 Ga0501042_0062091
777 Ga0501048_0078027
778 Ga0501048_0142047
779 Ga0501067_0224967
780 Ga0501071_0057082
781 Ga0501075_0072807
782 Ga0501076_0335040
783 Ga0501079_0065489
784 Ga0501080_0240946
785 Ga0501081_0079400
786 Ga0501083_0058810
787 Ga0501045_0122810
788 Ga0501045_0357880
789 nmdc:mga05p37_10997_c1
790 nmdc:mga05p37_48766_c1
791 nmdc:mga05p37_52668_c1
792 nmdc:mga05p37_63707_c1
793 nmdc:mga05p37_6820_c1
794 nmdc:mga05p37_80197_c1
795 nmdc:mga08y16_25568_c1
796 nmdc:mga0n895_10770_c1
797 nmdc:mga0n895_45905_c1
798 nmdc:mga0n895_69253_c1
799 nmdc:mga0n895_8_c1
800 nmdc:mga0rr50_23_c1
801 nmdc:mga0rr50_412_c1
802 nmdc:mga08x19_165_c1
803 nmdc:mga08x19_168423_c1
804 nmdc:mga08x19_22298_c1
805 nmdc:mga08x19_52759_c1
806 nmdc:mga0a205_60465_c1
807 Ga0495601_0009077
808 Ga0495619_0003439
809 Ga0495619_0005158
810 Ga0495619_0024198
811 Ga0500658_0072587
812 Ga0501084_0052134
813 Ga0501084_0250306
814 Ga0501082_0241462
815 Ga0530510_0078392
816 Ga0530510_0250129

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08478

POTRA_1

POTRA domain, FtsQ-type

60

128

0.99

PF03799

FtsQ_DivIB_C

Cell division protein FtsQ/DivIB, C-terminal

132

258

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ayw-assembly1.cif.gz_A structure of a membrane complex 0.8495 61 134
6lyq-assembly1.cif.gz_A structure of the bam complex 0.8457 59 134
2qcz-assembly2.cif.gz_B structure of n-terminal domain of e. coli yaet 0.8377 59 134
6lyr-assembly1.cif.gz_A structure of the bam complex 0.8097 59 134
3efc-assembly1.cif.gz_A crystal structure of yaet periplasmic domain 0.8062 59 134
ID Description Score Start End Superfamily
af_P9WNA1_124_191_3.10.20.310 Alpha Beta;Roll;Ubiquitin-like (UB roll);membrane protein fhac 0.9195 60 126 3.10.20.310
af_P9WNA1_124_191_3.10.20.310 Alpha Beta;Roll;Ubiquitin-like (UB roll);membrane protein fhac 0.8948 60 126 3.10.20.310
af_Q2FZ91_195_261_3.10.20.310 Alpha Beta;Roll;Ubiquitin-like (UB roll);membrane protein fhac 0.8846 60 125 3.10.20.310
af_Q2FZ91_195_261_3.10.20.310 Alpha Beta;Roll;Ubiquitin-like (UB roll);membrane protein fhac 0.8608 60 125 3.10.20.310
3efcA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);membrane protein fhac 0.841 59 127 3.10.20.310
ID Description Score Start End GO Terms
AF-A0A3D2B0J6-F1-model_v4 Uncharacterized protein 0.8938 86 279 GO:0005886
GO:0090529
AF-A0A3D2B0J6-F1-model_v4 Uncharacterized protein 0.8896 86 279 GO:0005886
GO:0090529
AF-A0A381Y2S0-F1-model_v4 POTRA domain-containing protein 0.8684 61 279 GO:0005886
GO:0090529
AF-A0A7Y4TFG5-F1-model_v4 FtsQ-type POTRA domain-containing protein 0.8428 56 277 GO:0005886
GO:0090529
AF-A0A2W4S1U1-F1-model_v4 Cell division protein FtsQ 0.8075 20 275 GO:0005886
GO:0032153
GO:0043093
GO:0090529

Map