F436222

General Info

Members Datasets Scaffolds Average Seq Length
406 217 812 535

Family's Representative Sequence

Representative Sequence 3300025919|Ga0207657_10040391|Ga0207657_100403911
Length 610
Sequence VNRRAFLAGAASLVSWPALAQPSQRPPGIQLTDVTRRAGLAFSHTNGSAGGKLLPETLGSGCAFLDYDADGWPDILFVNGCDWPSTLKRRKSTPRLYRNNRNGTFTDVTHAAGLDIEMYGMGVAVGDFDNDGFVDLLITCVGQAGRLAFSTSALWFDYNRDGLLDLFVCNYVKWSAEHDVFCSLDGTQKSYCTPEAYRGDTCWLFRNRGDGTFEDVTPSSGVFDTSSKSLGVTMLDYDQDGWPDLFVANDTQPNKLYRNLRNGTFKDVALEAGVAFDADGKARAGMGTDAGDVDNSGRPSLAITNFENEMVGLYRQTRPGVFEDVALRSGIGQPSRGTLGFGCAFADLNLDGHLDLIVANGHIDETVRDIAGNVGYAQPPHLFVNQGGGRFHDDASAAGAEFAQPKVARGLACGDFDRDGDVDLLLTTNNGPAHLYHNDTRSGNRSLRLYLRGTASNRDAIGAAVRISHGGESQSRMVKSGSSYLSQSELAVTFGVGGRDRIDRVVITWPNGRVEDYKNLASGRAYEKDGTLRSRKLPGALHTDPKLAAKQALSFARDGGVHAHDGSFLKMAVDTLCIHGDTPGAPEIGAAVRDALIGAGVKVRAAIIWP

Samples

Sample ID Description Type Environment
1 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
143 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
144 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
161 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
214 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
215 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 4.93
Rhizosphere 94.83
Stem 0
Stem Tuber 0
Unclassified 4.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207657_10040391 3300025919 Bacteria 4134
2 Ga0065712_10000476 3300005290 Bacteria 13252
3 Ga0065712_10068808 3300005290 Bacteria 8940
4 Ga0065715_10000209 3300005293 Bacteria 33013
5 Ga0065715_10091011 3300005293 Bacteria 6214
6 Ga0070683_100000013 3300005329 Bacteria 241235
7 Ga0070683_100058693 3300005329 Bacteria 3574
8 Ga0070683_100091147 3300005329 Bacteria 2862
9 Ga0070690_100008980 3300005330 Bacteria 5778
10 Ga0070690_100063928 3300005330 Bacteria 2376
11 Ga0070670_100006439 3300005331 Bacteria 9938
12 Ga0070670_100028062 3300005331 Bacteria 4843
13 Ga0070670_100034806 3300005331 Bacteria 4335
14 Ga0068869_100004645 3300005334 Bacteria 8567
15 Ga0068869_100018264 3300005334 Bacteria 4771
16 Ga0070666_10028832 3300005335 Bacteria 3645
17 Ga0068868_100018690 3300005338 Bacteria 5185
18 Ga0068868_100048730 3300005338 Bacteria 3324
19 Ga0070660_100152169 3300005339 Bacteria 1861
20 Ga0070661_100086797 3300005344 Bacteria 2314
21 Ga0070668_100007057 3300005347 Bacteria 8324
22 Ga0070669_100013066 3300005353 Bacteria 5898
23 Ga0070669_100042197 3300005353 Bacteria 3319
24 Ga0070675_100000107 3300005354 Bacteria 48865
25 Ga0070675_100007153 3300005354 Bacteria 8598
26 Ga0070675_100019506 3300005354 Bacteria 5406
27 Ga0070675_100070946 3300005354 Bacteria 2889
28 Ga0070675_100123603 3300005354 Bacteria 2200
29 Ga0070675_100165207 3300005354 Bacteria 1906
30 Ga0070674_100083586 3300005356 Bacteria 2287
31 Ga0070673_100012070 3300005364 Bacteria 5919
32 Ga0070673_100073212 3300005364 Bacteria 2757
33 Ga0070688_100003191 3300005365 Bacteria 8396
34 Ga0070667_100054641 3300005367 Bacteria 3372
35 Ga0070709_10040504 3300005434 Unclassified 2865
36 Ga0070713_100027258 3300005436 Bacteria 4496
37 Ga0070713_100042009 3300005436 Bacteria 3728
38 Ga0070713_100078921 3300005436 Bacteria 2803
39 Ga0070713_100093649 3300005436 Unclassified 2589
40 Ga0070701_10010606 3300005438 Bacteria 4082
41 Ga0070711_100018301 3300005439 Bacteria 4469
42 Ga0070705_100006952 3300005440 Bacteria 5560
43 Ga0070700_100033492 3300005441 Bacteria 3095
44 Ga0070700_100037565 3300005441 Bacteria 2946
45 Ga0070694_100009175 3300005444 Bacteria 6067
46 Ga0070708_100003613 3300005445 Bacteria 12134
47 Ga0070708_100074974 3300005445 Bacteria 3053
48 Ga0070708_100118608 3300005445 Bacteria 2438
49 Ga0070663_100042978 3300005455 Bacteria 3178
50 Ga0070678_100041657 3300005456 Bacteria 3257
51 Ga0070662_100066033 3300005457 Bacteria 2654
52 Ga0070681_10002981 3300005458 Bacteria 15706
53 Ga0070681_10005732 3300005458 Bacteria 12005
54 Ga0068867_100012776 3300005459 Bacteria 5940
55 Ga0068867_100037159 3300005459 Bacteria 3539
56 Ga0070685_10013384 3300005466 Bacteria 4325
57 Ga0070685_10029259 3300005466 Bacteria 3059
58 Ga0070706_100030239 3300005467 Bacteria 4989
59 Ga0070706_100045640 3300005467 Unclassified 4047
60 Ga0070699_100012511 3300005518 Bacteria 7324
61 Ga0070679_100004322 3300005530 Bacteria 13117
62 Ga0070684_100000015 3300005535 Bacteria 143515
63 Ga0070684_100001496 3300005535 Bacteria 16858
64 Ga0070672_100027554 3300005543 Bacteria 4239
65 Ga0070672_100028386 3300005543 Bacteria 4185
66 Ga0070672_100110363 3300005543 Bacteria 2241
67 Ga0070686_100002906 3300005544 Bacteria 9406
68 Ga0070695_100001515 3300005545 Bacteria 12905
69 Ga0070696_100003121 3300005546 Bacteria 11028
70 Ga0070696_100030406 3300005546 Bacteria 3697
71 Ga0070693_100000261 3300005547 Bacteria 24757
72 Ga0070665_100022885 3300005548 Bacteria 6291
73 Ga0070665_100033427 3300005548 Bacteria 5175
74 Ga0070665_100034542 3300005548 Bacteria 5085
75 Ga0070665_100065223 3300005548 Bacteria 3653
76 Ga0070704_100026769 3300005549 Bacteria 3816
77 Ga0070664_100000344 3300005564 Bacteria 34004
78 Ga0070664_100011909 3300005564 Bacteria 7059
79 Ga0068857_100120070 3300005577 Unclassified 2366
80 Ga0068854_100035106 3300005578 Bacteria 3508
81 Ga0068859_100010055 3300005617 Bacteria 9539
82 Ga0068859_100018342 3300005617 Bacteria 7035
83 Ga0068859_100062486 3300005617 Bacteria 3754
84 Ga0068859_100070526 3300005617 Bacteria 3530
85 Ga0068864_100007762 3300005618 Bacteria 8842
86 Ga0068861_100009426 3300005719 Bacteria 6739
87 Ga0068861_100151928 3300005719 Bacteria 1901
88 Ga0068870_10017828 3300005840 Bacteria 3417
89 Ga0068863_100005198 3300005841 Bacteria 12845
90 Ga0068858_100001422 3300005842 Bacteria 24628
91 Ga0068858_100002243 3300005842 Bacteria 19528
92 Ga0068858_100024831 3300005842 Bacteria 5579
93 Ga0068858_100030897 3300005842 Bacteria 4974
94 Ga0068858_100076511 3300005842 Bacteria 3108
95 Ga0068860_100067977 3300005843 Bacteria 3385
96 Ga0068862_100001134 3300005844 Bacteria 25234
97 Ga0068862_100014829 3300005844 Bacteria 6473
98 Ga0081540_1024170 3300005983 Unclassified 3532
99 Ga0081539_10001870 3300005985 Bacteria 33065
100 Ga0070717_10001835 3300006028 Bacteria 14838
101 Ga0075365_10065059 3300006038 Bacteria 2444
102 Ga0070716_100001794 3300006173 Bacteria 9723
103 Ga0070712_100006233 3300006175 Bacteria 7384
104 Ga0097621_100000181 3300006237 Bacteria 40008
105 Ga0097621_100000886 3300006237 Bacteria 20980
106 Ga0097621_100036050 3300006237 Unclassified 3955
107 Ga0097621_100055569 3300006237 Bacteria 3233
108 Ga0068871_100000311 3300006358 Bacteria 33811
109 Ga0068871_100001302 3300006358 Bacteria 16692
110 Ga0075428_100001772 3300006844 Bacteria 23052
111 Ga0075428_100002129 3300006844 Bacteria 21365
112 Ga0075428_100007985 3300006844 Bacteria 11739
113 Ga0075428_100076373 3300006844 Bacteria 3657
114 Ga0075430_100005827 3300006846 Bacteria 10396
115 Ga0075431_100003613 3300006847 Bacteria 14986
116 Ga0075431_100031572 3300006847 Bacteria 5455
117 Ga0075431_100047558 3300006847 Bacteria 4423
118 Ga0075431_100141820 3300006847 Bacteria 2477
119 Ga0075433_10001106 3300006852 Bacteria 19463
120 Ga0075433_10001887 3300006852 Bacteria 15756
121 Ga0075433_10008059 3300006852 Bacteria 8387
122 Ga0075433_10012752 3300006852 Bacteria 6805
123 Ga0075433_10020911 3300006852 Bacteria 5480
124 Ga0075433_10101000 3300006852 Bacteria 2554
125 Ga0075434_100000069 3300006871 Bacteria 53659
126 Ga0075434_100004675 3300006871 Bacteria 12372
127 Ga0075429_100004529 3300006880 Bacteria 11951
128 Ga0068865_100004076 3300006881 Bacteria 8779
129 Ga0075436_100001554 3300006914 Bacteria 15658
130 Ga0097620_100010055 3300006931 Bacteria 9539
131 Ga0097620_100018342 3300006931 Bacteria 7035
132 Ga0097620_100062486 3300006931 Bacteria 3754
133 Ga0097620_100070529 3300006931 Bacteria 3530
134 Ga0075435_100000420 3300007076 Bacteria 26177
135 Ga0099794_10003139 3300007265 Bacteria 6257
136 Ga0099794_10021589 3300007265 Bacteria 2926
137 Ga0105240_10011764 3300009093 Bacteria 12159
138 Ga0105240_10091076 3300009093 Bacteria 3726
139 Ga0111539_10004449 3300009094 Bacteria 18316
140 Ga0111539_10009562 3300009094 Bacteria 12237
141 Ga0111539_10013872 3300009094 Bacteria 10076
142 Ga0105245_10017519 3300009098 Bacteria 6251
143 Ga0114129_10021440 3300009147 Bacteria 9171
144 Ga0114129_10086520 3300009147 Bacteria 4347
145 Ga0105243_10010166 3300009148 Bacteria 7155
146 Ga0105242_10002485 3300009176 Bacteria 14450
147 Ga0105242_10048336 3300009176 Bacteria 3458
148 Ga0105248_10057079 3300009177 Bacteria 4381
149 Ga0105248_10068373 3300009177 Bacteria 3988
150 Ga0105248_10073857 3300009177 Bacteria 3833
151 Ga0105248_10106356 3300009177 Bacteria 3163
152 Ga0105237_10002215 3300009545 Bacteria 24337
153 Ga0105238_10000732 3300009551 Bacteria 34287
154 Ga0105238_10078659 3300009551 Bacteria 3288
155 Ga0105249_10019468 3300009553 Bacteria 6056
156 Ga0157369_10035006 3300013105 Bacteria 5507
157 Ga0157374_10009874 3300013296 Bacteria 8193
158 Ga0157374_10020859 3300013296 Bacteria 5820
159 Ga0157374_10040632 3300013296 Bacteria 4284
160 Ga0157378_10000162 3300013297 Bacteria 63795
161 Ga0163162_10006547 3300013306 Bacteria 11285
162 Ga0163162_10028067 3300013306 Bacteria 5568
163 Ga0163162_10098710 3300013306 Bacteria 3010
164 Ga0157375_10030850 3300013308 Bacteria 5060
165 Ga0157375_10046971 3300013308 Bacteria 4213
166 Ga0157375_10051976 3300013308 Bacteria 4027
167 Ga0163163_10029118 3300014325 Bacteria 5310
168 Ga0163163_10032851 3300014325 Bacteria 5015
169 Ga0163163_10070098 3300014325 Bacteria 3491
170 Ga0157380_10006872 3300014326 Bacteria 8042
171 Ga0157377_10001173 3300014745 Bacteria 11123
172 Ga0157377_10010823 3300014745 Bacteria 4529
173 Ga0157377_10032428 3300014745 Bacteria 2844
174 Ga0157376_10101331 3300014969 Bacteria 2516
175 Ga0163161_10020934 3300017792 Bacteria 4595
176 Ga0228598_1000927 3300024227 Bacteria 6360
177 Ga0207697_10002903 3300025315 Bacteria 8679
178 Ga0207697_10007426 3300025315 Bacteria 4890
179 Ga0207697_10027621 3300025315 Bacteria 2320
180 Ga0207653_10002703 3300025885 Bacteria 5635
181 Ga0207682_10000132 3300025893 Bacteria 33775
182 Ga0207688_10022408 3300025901 Bacteria 3457
183 Ga0207647_10078927 3300025904 Bacteria 1977
184 Ga0207699_10026380 3300025906 Bacteria 3202
185 Ga0207699_10033548 3300025906 Unclassified 2902
186 Ga0207645_10008196 3300025907 Bacteria 7312
187 Ga0207645_10031884 3300025907 Bacteria 3388
188 Ga0207643_10025057 3300025908 Bacteria 3295
189 Ga0207643_10028827 3300025908 Bacteria 3086
190 Ga0207684_10025368 3300025910 Bacteria 5051
191 Ga0207684_10054504 3300025910 Bacteria 3392
192 Ga0207707_10035035 3300025912 Unclassified 4390
193 Ga0207695_10003748 3300025913 Bacteria 21136
194 Ga0207695_10077201 3300025913 Bacteria 3384
195 Ga0207671_10010354 3300025914 Bacteria 7703
196 Ga0207693_10037825 3300025915 Bacteria 3803
197 Ga0207662_10001964 3300025918 Bacteria 10139
198 Ga0207662_10047095 3300025918 Bacteria 2553
199 Ga0207652_10027890 3300025921 Unclassified 4709
200 Ga0207681_10016981 3300025923 Bacteria 4565
201 Ga0207694_10082119 3300025924 Bacteria 2533
202 Ga0207650_10116432 3300025925 Bacteria 2075
203 Ga0207659_10000266 3300025926 Bacteria 31850
204 Ga0207659_10019064 3300025926 Bacteria 4507
205 Ga0207659_10058123 3300025926 Bacteria 2776
206 Ga0207700_10005919 3300025928 Bacteria 7357
207 Ga0207700_10022480 3300025928 Bacteria 4330
208 Ga0207700_10092816 3300025928 Unclassified 2387
209 Ga0207664_10131025 3300025929 Bacteria 2111
210 Ga0207644_10038699 3300025931 Bacteria 3362
211 Ga0207644_10074730 3300025931 Bacteria 2488
212 Ga0207706_10123245 3300025933 Bacteria 2280
213 Ga0207686_10020906 3300025934 Bacteria 3747
214 Ga0207704_10029191 3300025938 Bacteria 3071
215 Ga0207704_10067637 3300025938 Bacteria 2248
216 Ga0207665_10000526 3300025939 Bacteria 25799
217 Ga0207691_10047329 3300025940 Bacteria 3946
218 Ga0207691_10073751 3300025940 Bacteria 3078
219 Ga0207691_10112461 3300025940 Bacteria 2420
220 Ga0207691_10138051 3300025940 Bacteria 2149
221 Ga0207711_10020865 3300025941 Bacteria 5468
222 Ga0207711_10059694 3300025941 Unclassified 3284
223 Ga0207711_10063639 3300025941 Bacteria 3185
224 Ga0207689_10001958 3300025942 Bacteria 19459
225 Ga0207689_10002533 3300025942 Bacteria 16981
226 Ga0207689_10024752 3300025942 Bacteria 5033
227 Ga0207661_10000018 3300025944 Bacteria 242506
228 Ga0207661_10004097 3300025944 Bacteria 10188
229 Ga0207661_10055751 3300025944 Bacteria 3171
230 Ga0207679_10000879 3300025945 Bacteria 19184
231 Ga0207667_10015639 3300025949 Bacteria 8608
232 Ga0207651_10075732 3300025960 Bacteria 2402
233 Ga0207712_10006614 3300025961 Bacteria 7315
234 Ga0207640_10026727 3300025981 Bacteria 3508
235 Ga0207677_10060087 3300026023 Bacteria 2625
236 Ga0207677_10111219 3300026023 Unclassified 2040
237 Ga0207703_10004966 3300026035 Bacteria 10803
238 Ga0207703_10014303 3300026035 Bacteria 6189
239 Ga0207703_10075067 3300026035 Unclassified 2801
240 Ga0207703_10077090 3300026035 Bacteria 2766
241 Ga0207708_10001838 3300026075 Bacteria 15658
242 Ga0207708_10006080 3300026075 Bacteria 8953
243 Ga0207708_10009813 3300026075 Bacteria 7104
244 Ga0207641_10091545 3300026088 Bacteria 2661
245 Ga0207641_10182896 3300026088 Bacteria 1921
246 Ga0207648_10001102 3300026089 Bacteria 30237
247 Ga0207648_10011446 3300026089 Bacteria 8355
248 Ga0207648_10023318 3300026089 Bacteria 5547
249 Ga0207648_10055194 3300026089 Bacteria 3469
250 Ga0207676_10027206 3300026095 Bacteria 4259
251 Ga0207676_10048825 3300026095 Bacteria 3288
252 Ga0207676_10168349 3300026095 Bacteria 1906
253 Ga0207675_100008699 3300026118 Bacteria 9541
254 Ga0207675_100015253 3300026118 Bacteria 7167
255 Ga0207675_100066872 3300026118 Unclassified 3359
256 Ga0207675_100070105 3300026118 Bacteria 3276
257 Ga0207683_10002814 3300026121 Bacteria 15196
258 Ga0207683_10055383 3300026121 Bacteria 3477
259 Ga0207683_10062947 3300026121 Bacteria 3268
260 Ga0207428_10001358 3300027907 Bacteria 26062
261 Ga0207428_10002820 3300027907 Bacteria 17260
262 Ga0268266_10032283 3300028379 Bacteria 4449
263 Ga0268266_10098441 3300028379 Bacteria 2573
264 Ga0268266_10180547 3300028379 Bacteria 1921
265 Ga0268265_10024861 3300028380 Bacteria 4244
266 Ga0265338_10009142 3300028800 Bacteria 11896
267 Ga0265325_10002774 3300031241 Bacteria 11697
268 Ga0373926_0020908 3300035083 Unclassified 2263
269 Ga0373935_0073303 3300035692 Unclassified 2212
270 Ga0373927_0006914 3300035695 Bacteria 7708
271 Ga0373927_0032578 3300035695 Bacteria 3395
272 Ga0373927_0083226 3300035695 Bacteria 2075
273 Ga0373947_0001084 3300035725 Bacteria 16683
274 Ga0373937_0065526 3300036401 Bacteria 3344
275 Ga0373937_0107157 3300036401 Bacteria 2598
276 Ga0373937_0107432 3300036401 Bacteria 2595
277 Ga0373925_0000905 3300037068 Bacteria 27102
278 Ga0439435_0009307 3300042436 Bacteria 2303
279 Ga0495592_0086423 3300046454 Bacteria 2259
280 Ga0495603_0082283 3300046455 Bacteria 1886
281 Ga0495580_0003272 3300046472 Bacteria 13860
282 Ga0495580_0007790 3300046472 Bacteria 8583
283 Ga0495630_0040079 3300046517 Bacteria 3500
284 Ga0495586_0048239 3300046535 Bacteria 2301
285 Ga0495645_0066307 3300046543 Bacteria 2609
286 Ga0495658_0003574 3300046683 Bacteria 7697
287 Ga0495613_0015813 3300046689 Bacteria 5617
288 Ga0495600_0061437 3300046809 Bacteria 2454
289 Ga0495604_0029657 3300047317 Bacteria 4353
290 Ga0495674_0014470 3300047319 Bacteria 7385
291 Ga0495672_0000879 3300047320 Bacteria 31588
292 Ga0495680_0078259 3300047322 Bacteria 2503
293 Ga0495684_0001031 3300047471 Bacteria 22610
294 Ga0496101_0068713 3300048904 Bacteria 2591
295 Ga0496104_0003760 3300048907 Bacteria 13119
296 Ga0496105_0010309 3300048908 Bacteria 7347
297 Ga0496106_0007585 3300048909 Bacteria 8026
298 Ga0496106_0028694 3300048909 Bacteria 4145
299 Ga0496108_0021618 3300048911 Bacteria 5287
300 Ga0496108_0111083 3300048911 Bacteria 2344
301 Ga0496108_0135761 3300048911 Bacteria 2116
302 Ga0496109_0002987 3300048912 Bacteria 14127
303 Ga0496109_0016895 3300048912 Bacteria 6385
304 Ga0496109_0027159 3300048912 Bacteria 5109
305 Ga0496109_0138542 3300048912 Unclassified 2275
306 Ga0496110_0016593 3300048913 Bacteria 6150
307 Ga0496110_0019313 3300048913 Bacteria 5732
308 Ga0496111_0019994 3300048914 Bacteria 4658
309 Ga0496112_0001144 3300048915 Bacteria 19782
310 Ga0496112_0003315 3300048915 Bacteria 13287
311 Ga0496112_0045908 3300048915 Bacteria 4283
312 Ga0496115_0013169 3300048918 Bacteria 6248
313 Ga0496115_0065018 3300048918 Bacteria 2946
314 Ga0501031_0012512 3300049568 Bacteria 5539
315 Ga0501032_0033284 3300049569 Bacteria 3531
316 Ga0501032_0034807 3300049569 Bacteria 3445
317 Ga0501033_0003738 3300049570 Bacteria 12378
318 Ga0501033_0047832 3300049570 Bacteria 3179
319 Ga0501033_0067925 3300049570 Bacteria 2621
320 Ga0501034_0003611 3300049571 Bacteria 17555
321 Ga0501034_0031095 3300049571 Bacteria 5425
322 Ga0501036_0004474 3300049572 Bacteria 11298
323 Ga0501036_0122518 3300049572 Bacteria 2196
324 Ga0501037_0009460 3300049573 Bacteria 7154
325 Ga0501038_0008058 3300049574 Bacteria 9696
326 Ga0501038_0012477 3300049574 Bacteria 7764
327 Ga0501038_0023996 3300049574 Bacteria 5445
328 Ga0501039_0025647 3300049575 Bacteria 4531
329 Ga0501039_0046233 3300049575 Bacteria 3363
330 Ga0501039_0095675 3300049575 Bacteria 2315
331 Ga0501042_0027353 3300049578 Bacteria 4010
332 Ga0501043_0001499 3300049579 Bacteria 20382
333 Ga0501043_0001740 3300049579 Bacteria 18772
334 Ga0501043_0046296 3300049579 Bacteria 3420
335 Ga0501046_0005243 3300049580 Bacteria 11586
336 Ga0501046_0006578 3300049580 Bacteria 10272
337 Ga0501046_0041442 3300049580 Bacteria 3674
338 Ga0501046_0093709 3300049580 Bacteria 2308
339 Ga0501047_0006353 3300049581 Bacteria 11110
340 Ga0501047_0029186 3300049581 Bacteria 5319
341 Ga0501048_0001831 3300049582 Bacteria 16127
342 Ga0501048_0043495 3300049582 Bacteria 3215
343 Ga0501067_0015215 3300049583 Bacteria 4259
344 Ga0501067_0125330 3300049583 Bacteria 1429
345 Ga0501068_0011106 3300049584 Bacteria 5072
346 Ga0501070_0046706 3300049586 Bacteria 3601
347 Ga0501071_0009501 3300049587 Bacteria 6481
348 Ga0501072_0072655 3300049588 Bacteria 2719
349 Ga0501073_0016772 3300049589 Bacteria 5307
350 Ga0501073_0028924 3300049589 Bacteria 3959
351 Ga0501074_0021297 3300049590 Bacteria 4708
352 Ga0501075_0008774 3300049591 Bacteria 7045
353 Ga0501075_0020930 3300049591 Bacteria 4765
354 Ga0501075_0098682 3300049591 Bacteria 2217
355 Ga0501076_0002104 3300049592 Bacteria 13651
356 Ga0501076_0017976 3300049592 Bacteria 5379
357 Ga0501079_0012636 3300049741 Bacteria 6448
358 Ga0501079_0121361 3300049741 Bacteria 2033
359 Ga0501080_0013245 3300049742 Bacteria 7577
360 Ga0501080_0020288 3300049742 Bacteria 6151
361 Ga0501080_0061888 3300049742 Bacteria 3483
362 Ga0501080_0153387 3300049742 Bacteria 2128
363 Ga0501081_0074625 3300049743 Unclassified 2366
364 Ga0501081_0083047 3300049743 Bacteria 2245
365 Ga0501083_0031798 3300049744 Bacteria 3621
366 Ga0501083_0064190 3300049744 Bacteria 2447
367 Ga0501044_0027597 3300049823 Bacteria 5997
368 Ga0501044_0217842 3300049823 Bacteria 1860
369 Ga0501045_0007012 3300049824 Bacteria 7813
370 Ga0501045_0078913 3300049824 Bacteria 2427
371 Ga0501045_0093322 3300049824 Bacteria 2226
372 nmdc:mga09592_15250_c1 3300050508 Bacteria 6278
373 nmdc:mga0qj67_9819_c1 3300050509 Bacteria 7134
374 nmdc:mga06r32_129728_c1 3300050510 Bacteria 2492
375 nmdc:mga06r32_32939_c1 3300050510 Bacteria 4879
376 nmdc:mga06r32_8293_c1 3300050510 Bacteria 9353
377 nmdc:mga08y16_1632_c1 3300050511 Bacteria 22729
378 nmdc:mga08y16_8517_c1 3300050511 Bacteria 10742
379 nmdc:mga08y16_98754_c1 3300050511 Bacteria 3040
380 nmdc:mga0n895_40065_c1 3300050512 Bacteria 4550
381 nmdc:mga0n895_5965_c1 3300050512 Bacteria 10256
382 nmdc:mga0n895_64290_c1 3300050512 Bacteria 3629
383 nmdc:mga0n895_6589_c1 3300050512 Bacteria 9883
384 nmdc:mga0rr50_3334_c1 3300050513 Bacteria 9221
385 nmdc:mga08x19_15440_c1 3300050514 Bacteria 4648
386 nmdc:mga08x19_5279_c1 3300050514 Bacteria 7641
387 nmdc:mga08x19_5788_c1 3300050514 Bacteria 7308
388 nmdc:mga0a205_1302_c1 3300050515 Bacteria 9471
389 nmdc:mga0a205_21665_c1 3300050515 Bacteria 6075
390 nmdc:mga0a205_25512_c1 3300050515 Bacteria 5631
391 nmdc:mga0a205_26779_c1 3300050515 Bacteria 5502
392 nmdc:mga0a205_306_c1 3300050515 Bacteria 36284
393 nmdc:mga0a205_3623_c1 3300050515 Bacteria 13824
394 nmdc:mga0a205_624_c1 3300050515 Bacteria 28124
395 Ga0495601_0010511 3300053077 Bacteria 5511
396 Ga0495619_0001817 3300053085 Bacteria 14195
397 Ga0501084_0017313 3300054114 Bacteria 5988
398 Ga0501084_0020671 3300054114 Bacteria 5490
399 Ga0501084_0151036 3300054114 Bacteria 1958
400 Ga0590071_001192 3300059421 Bacteria 7035
401 Ga0590075_000067 3300059424 Bacteria 25816
402 Ga0590077_002417 3300059426 Bacteria 4007
403 Ga0501082_0003247 3300060353 Bacteria 14182
404 Ga0501082_0044307 3300060353 Bacteria 3837
405 Ga0501082_0219908 3300060353 Bacteria 1652
406 Ga0530510_0013713 3300061734 Bacteria 5705
407 Ga0207657_10040391
408 Ga0065712_10000476
409 Ga0065712_10068808
410 Ga0065715_10000209
411 Ga0065715_10091011
412 Ga0070683_100000013
413 Ga0070683_100058693
414 Ga0070683_100091147
415 Ga0070690_100008980
416 Ga0070690_100063928
417 Ga0070670_100006439
418 Ga0070670_100028062
419 Ga0070670_100034806
420 Ga0068869_100004645
421 Ga0068869_100018264
422 Ga0070666_10028832
423 Ga0068868_100018690
424 Ga0068868_100048730
425 Ga0070660_100152169
426 Ga0070661_100086797
427 Ga0070668_100007057
428 Ga0070669_100013066
429 Ga0070669_100042197
430 Ga0070675_100000107
431 Ga0070675_100007153
432 Ga0070675_100019506
433 Ga0070675_100070946
434 Ga0070675_100123603
435 Ga0070675_100165207
436 Ga0070674_100083586
437 Ga0070673_100012070
438 Ga0070673_100073212
439 Ga0070688_100003191
440 Ga0070667_100054641
441 Ga0070709_10040504
442 Ga0070713_100027258
443 Ga0070713_100042009
444 Ga0070713_100078921
445 Ga0070713_100093649
446 Ga0070701_10010606
447 Ga0070711_100018301
448 Ga0070705_100006952
449 Ga0070700_100033492
450 Ga0070700_100037565
451 Ga0070694_100009175
452 Ga0070708_100003613
453 Ga0070708_100074974
454 Ga0070708_100118608
455 Ga0070663_100042978
456 Ga0070678_100041657
457 Ga0070662_100066033
458 Ga0070681_10002981
459 Ga0070681_10005732
460 Ga0068867_100012776
461 Ga0068867_100037159
462 Ga0070685_10013384
463 Ga0070685_10029259
464 Ga0070706_100030239
465 Ga0070706_100045640
466 Ga0070699_100012511
467 Ga0070679_100004322
468 Ga0070684_100000015
469 Ga0070684_100001496
470 Ga0070672_100027554
471 Ga0070672_100028386
472 Ga0070672_100110363
473 Ga0070686_100002906
474 Ga0070695_100001515
475 Ga0070696_100003121
476 Ga0070696_100030406
477 Ga0070693_100000261
478 Ga0070665_100022885
479 Ga0070665_100033427
480 Ga0070665_100034542
481 Ga0070665_100065223
482 Ga0070704_100026769
483 Ga0070664_100000344
484 Ga0070664_100011909
485 Ga0068857_100120070
486 Ga0068854_100035106
487 Ga0068859_100010055
488 Ga0068859_100018342
489 Ga0068859_100062486
490 Ga0068859_100070526
491 Ga0068864_100007762
492 Ga0068861_100009426
493 Ga0068861_100151928
494 Ga0068870_10017828
495 Ga0068863_100005198
496 Ga0068858_100001422
497 Ga0068858_100002243
498 Ga0068858_100024831
499 Ga0068858_100030897
500 Ga0068858_100076511
501 Ga0068860_100067977
502 Ga0068862_100001134
503 Ga0068862_100014829
504 Ga0081540_1024170
505 Ga0081539_10001870
506 Ga0070717_10001835
507 Ga0075365_10065059
508 Ga0070716_100001794
509 Ga0070712_100006233
510 Ga0097621_100000181
511 Ga0097621_100000886
512 Ga0097621_100036050
513 Ga0097621_100055569
514 Ga0068871_100000311
515 Ga0068871_100001302
516 Ga0075428_100001772
517 Ga0075428_100002129
518 Ga0075428_100007985
519 Ga0075428_100076373
520 Ga0075430_100005827
521 Ga0075431_100003613
522 Ga0075431_100031572
523 Ga0075431_100047558
524 Ga0075431_100141820
525 Ga0075433_10001106
526 Ga0075433_10001887
527 Ga0075433_10008059
528 Ga0075433_10012752
529 Ga0075433_10020911
530 Ga0075433_10101000
531 Ga0075434_100000069
532 Ga0075434_100004675
533 Ga0075429_100004529
534 Ga0068865_100004076
535 Ga0075436_100001554
536 Ga0097620_100010055
537 Ga0097620_100018342
538 Ga0097620_100062486
539 Ga0097620_100070529
540 Ga0075435_100000420
541 Ga0099794_10003139
542 Ga0099794_10021589
543 Ga0105240_10011764
544 Ga0105240_10091076
545 Ga0111539_10004449
546 Ga0111539_10009562
547 Ga0111539_10013872
548 Ga0105245_10017519
549 Ga0114129_10021440
550 Ga0114129_10086520
551 Ga0105243_10010166
552 Ga0105242_10002485
553 Ga0105242_10048336
554 Ga0105248_10057079
555 Ga0105248_10068373
556 Ga0105248_10073857
557 Ga0105248_10106356
558 Ga0105237_10002215
559 Ga0105238_10000732
560 Ga0105238_10078659
561 Ga0105249_10019468
562 Ga0157369_10035006
563 Ga0157374_10009874
564 Ga0157374_10020859
565 Ga0157374_10040632
566 Ga0157378_10000162
567 Ga0163162_10006547
568 Ga0163162_10028067
569 Ga0163162_10098710
570 Ga0157375_10030850
571 Ga0157375_10046971
572 Ga0157375_10051976
573 Ga0163163_10029118
574 Ga0163163_10032851
575 Ga0163163_10070098
576 Ga0157380_10006872
577 Ga0157377_10001173
578 Ga0157377_10010823
579 Ga0157377_10032428
580 Ga0157376_10101331
581 Ga0163161_10020934
582 Ga0228598_1000927
583 Ga0207697_10002903
584 Ga0207697_10007426
585 Ga0207697_10027621
586 Ga0207653_10002703
587 Ga0207682_10000132
588 Ga0207688_10022408
589 Ga0207647_10078927
590 Ga0207699_10026380
591 Ga0207699_10033548
592 Ga0207645_10008196
593 Ga0207645_10031884
594 Ga0207643_10025057
595 Ga0207643_10028827
596 Ga0207684_10025368
597 Ga0207684_10054504
598 Ga0207707_10035035
599 Ga0207695_10003748
600 Ga0207695_10077201
601 Ga0207671_10010354
602 Ga0207693_10037825
603 Ga0207662_10001964
604 Ga0207662_10047095
605 Ga0207652_10027890
606 Ga0207681_10016981
607 Ga0207694_10082119
608 Ga0207650_10116432
609 Ga0207659_10000266
610 Ga0207659_10019064
611 Ga0207659_10058123
612 Ga0207700_10005919
613 Ga0207700_10022480
614 Ga0207700_10092816
615 Ga0207664_10131025
616 Ga0207644_10038699
617 Ga0207644_10074730
618 Ga0207706_10123245
619 Ga0207686_10020906
620 Ga0207704_10029191
621 Ga0207704_10067637
622 Ga0207665_10000526
623 Ga0207691_10047329
624 Ga0207691_10073751
625 Ga0207691_10112461
626 Ga0207691_10138051
627 Ga0207711_10020865
628 Ga0207711_10059694
629 Ga0207711_10063639
630 Ga0207689_10001958
631 Ga0207689_10002533
632 Ga0207689_10024752
633 Ga0207661_10000018
634 Ga0207661_10004097
635 Ga0207661_10055751
636 Ga0207679_10000879
637 Ga0207667_10015639
638 Ga0207651_10075732
639 Ga0207712_10006614
640 Ga0207640_10026727
641 Ga0207677_10060087
642 Ga0207677_10111219
643 Ga0207703_10004966
644 Ga0207703_10014303
645 Ga0207703_10075067
646 Ga0207703_10077090
647 Ga0207708_10001838
648 Ga0207708_10006080
649 Ga0207708_10009813
650 Ga0207641_10091545
651 Ga0207641_10182896
652 Ga0207648_10001102
653 Ga0207648_10011446
654 Ga0207648_10023318
655 Ga0207648_10055194
656 Ga0207676_10027206
657 Ga0207676_10048825
658 Ga0207676_10168349
659 Ga0207675_100008699
660 Ga0207675_100015253
661 Ga0207675_100066872
662 Ga0207675_100070105
663 Ga0207683_10002814
664 Ga0207683_10055383
665 Ga0207683_10062947
666 Ga0207428_10001358
667 Ga0207428_10002820
668 Ga0268266_10032283
669 Ga0268266_10098441
670 Ga0268266_10180547
671 Ga0268265_10024861
672 Ga0265338_10009142
673 Ga0265325_10002774
674 Ga0373926_0020908
675 Ga0373935_0073303
676 Ga0373927_0006914
677 Ga0373927_0032578
678 Ga0373927_0083226
679 Ga0373947_0001084
680 Ga0373937_0065526
681 Ga0373937_0107157
682 Ga0373937_0107432
683 Ga0373925_0000905
684 Ga0439435_0009307
685 Ga0495592_0086423
686 Ga0495603_0082283
687 Ga0495580_0003272
688 Ga0495580_0007790
689 Ga0495630_0040079
690 Ga0495586_0048239
691 Ga0495645_0066307
692 Ga0495658_0003574
693 Ga0495613_0015813
694 Ga0495600_0061437
695 Ga0495604_0029657
696 Ga0495674_0014470
697 Ga0495672_0000879
698 Ga0495680_0078259
699 Ga0495684_0001031
700 Ga0496101_0068713
701 Ga0496104_0003760
702 Ga0496105_0010309
703 Ga0496106_0007585
704 Ga0496106_0028694
705 Ga0496108_0021618
706 Ga0496108_0111083
707 Ga0496108_0135761
708 Ga0496109_0002987
709 Ga0496109_0016895
710 Ga0496109_0027159
711 Ga0496109_0138542
712 Ga0496110_0016593
713 Ga0496110_0019313
714 Ga0496111_0019994
715 Ga0496112_0001144
716 Ga0496112_0003315
717 Ga0496112_0045908
718 Ga0496115_0013169
719 Ga0496115_0065018
720 Ga0501031_0012512
721 Ga0501032_0033284
722 Ga0501032_0034807
723 Ga0501033_0003738
724 Ga0501033_0047832
725 Ga0501033_0067925
726 Ga0501034_0003611
727 Ga0501034_0031095
728 Ga0501036_0004474
729 Ga0501036_0122518
730 Ga0501037_0009460
731 Ga0501038_0008058
732 Ga0501038_0012477
733 Ga0501038_0023996
734 Ga0501039_0025647
735 Ga0501039_0046233
736 Ga0501039_0095675
737 Ga0501042_0027353
738 Ga0501043_0001499
739 Ga0501043_0001740
740 Ga0501043_0046296
741 Ga0501046_0005243
742 Ga0501046_0006578
743 Ga0501046_0041442
744 Ga0501046_0093709
745 Ga0501047_0006353
746 Ga0501047_0029186
747 Ga0501048_0001831
748 Ga0501048_0043495
749 Ga0501067_0015215
750 Ga0501067_0125330
751 Ga0501068_0011106
752 Ga0501070_0046706
753 Ga0501071_0009501
754 Ga0501072_0072655
755 Ga0501073_0016772
756 Ga0501073_0028924
757 Ga0501074_0021297
758 Ga0501075_0008774
759 Ga0501075_0020930
760 Ga0501075_0098682
761 Ga0501076_0002104
762 Ga0501076_0017976
763 Ga0501079_0012636
764 Ga0501079_0121361
765 Ga0501080_0013245
766 Ga0501080_0020288
767 Ga0501080_0061888
768 Ga0501080_0153387
769 Ga0501081_0074625
770 Ga0501081_0083047
771 Ga0501083_0031798
772 Ga0501083_0064190
773 Ga0501044_0027597
774 Ga0501044_0217842
775 Ga0501045_0007012
776 Ga0501045_0078913
777 Ga0501045_0093322
778 nmdc:mga09592_15250_c1
779 nmdc:mga0qj67_9819_c1
780 nmdc:mga06r32_129728_c1
781 nmdc:mga06r32_32939_c1
782 nmdc:mga06r32_8293_c1
783 nmdc:mga08y16_1632_c1
784 nmdc:mga08y16_8517_c1
785 nmdc:mga08y16_98754_c1
786 nmdc:mga0n895_40065_c1
787 nmdc:mga0n895_5965_c1
788 nmdc:mga0n895_64290_c1
789 nmdc:mga0n895_6589_c1
790 nmdc:mga0rr50_3334_c1
791 nmdc:mga08x19_15440_c1
792 nmdc:mga08x19_5279_c1
793 nmdc:mga08x19_5788_c1
794 nmdc:mga0a205_1302_c1
795 nmdc:mga0a205_21665_c1
796 nmdc:mga0a205_25512_c1
797 nmdc:mga0a205_26779_c1
798 nmdc:mga0a205_306_c1
799 nmdc:mga0a205_3623_c1
800 nmdc:mga0a205_624_c1
801 Ga0495601_0010511
802 Ga0495619_0001817
803 Ga0501084_0017313
804 Ga0501084_0020671
805 Ga0501084_0151036
806 Ga0590071_001192
807 Ga0590075_000067
808 Ga0590077_002417
809 Ga0501082_0003247
810 Ga0501082_0044307
811 Ga0501082_0219908
812 Ga0530510_0013713

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03746

LamB_YcsF

LamB/YcsF family

514

597

0.96

PF07593

UnbV_ASPIC

ASPIC and UnbV

460

527

0.95

PF13517

FG-GAP_3

FG-GAP-like repeat

179

247

0.88

PF13517

FG-GAP_3

FG-GAP-like repeat

66

138

0.86

PF13517

FG-GAP_3

FG-GAP-like repeat

236

303

0.85

PF13517

FG-GAP_3

FG-GAP-like repeat

292

358

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7e7u-assembly1.cif.gz_A crystal structure of rsl mutant in complex with sugar ligand 0.6281 54 419
7e7v-assembly3.cif.gz_C crystal structure of rsl mutant in complex with sugar ligand 0.6225 54 419
7e7n-assembly1.cif.gz_A crystal structure of rsl mutant-r17a/r108a/r199a in complex with r3f 0.6128 54 419
7e7v-assembly1.cif.gz_A crystal structure of rsl mutant in complex with sugar ligand 0.6108 55 419
7e7u-assembly1.cif.gz_A crystal structure of rsl mutant in complex with sugar ligand 0.6095 54 419
ID Description Score Start End Superfamily
af_A1XF92_202_447_2.130.10.130 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Integrin alpha, N-terminal 0.7058 193 419 2.130.10.130
af_A0A1D8PLN7_650_796_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6978 267 418 2.130.10.10
af_Q94CQ0_256_430_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6672 267 413 2.130.10.10
af_Q54JS5_2_151_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6221 279 413 2.130.10.10
af_A1XF92_202_447_2.130.10.130 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Integrin alpha, N-terminal 0.6218 193 419 2.130.10.130
ID Description Score Start End GO Terms
AF-A0A2V8TGT0-F1-model_v4 RNA-binding protein 0.9683 354 515
AF-A0A2V8C4U4-F1-model_v4 ASPIC/UnbV domain-containing protein 0.9593 265 513
AF-A0A2V8TGT0-F1-model_v4 RNA-binding protein 0.9567 354 515
AF-A0A2V8C4U4-F1-model_v4 ASPIC/UnbV domain-containing protein 0.9481 265 513
AF-A0A2V7XC84-F1-model_v4 RNA-binding protein 0.9438 351 515

Map