F435881

General Info

Members Datasets Scaffolds Average Seq Length
405 196 810 209

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100186733|Ga0070705_1001867331
Length 230
Sequence MEYSSSPWGYVHHKGQLMSDPAIKTNPDDDLLARLQAGEESALTDLAEAYSSKIYQLAFRYLRNKEDAEEVTQDVLFKVYRKVATFRGDAALSSWIYRITFNAAMSRLRTARYQRSQDEERHTSANEADGGTPSRRTPDVADWTGMADENVLRSQLRQRVFRAILALPAIYRAPVMLRDIQGMSTEEASAMLRVKDQTLKSRLHRGRLILRKQLADFAGGLALHRPIYGT

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
140 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
141 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
142 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
143 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
144 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
145 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
146 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
147 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
148 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
149 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
150 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
151 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
152 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
153 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
154 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
163 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.69
Rhizosphere 94.81
Stem 0
Stem Tuber 0
Unclassified 19.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_100186733 3300005440 Unclassified 1409
2 JGI24751J29686_10041450 3300002459 Unclassified 952
3 JGI25406J46586_10077433 3300003203 Unclassified 1027
4 Ga0065714_10127776 3300005288 Bacteria 1279
5 Ga0065712_10081509 3300005290 Bacteria 3001
6 Ga0065712_10086503 3300005290 Bacteria 2632
7 Ga0065715_10316981 3300005293 Unclassified 1009
8 Ga0065707_10196629 3300005295 Bacteria 1332
9 Ga0065707_10268462 3300005295 Bacteria 1076
10 Ga0070658_10090089 3300005327 Bacteria 2527
11 Ga0070683_100711172 3300005329 Bacteria 962
12 Ga0070690_100002909 3300005330 Bacteria 9237
13 Ga0070670_100108313 3300005331 Bacteria 2394
14 Ga0070670_100170225 3300005331 Bacteria 1889
15 Ga0070670_100286234 3300005331 Bacteria 1439
16 Ga0070670_100374184 3300005331 Bacteria 1254
17 Ga0070670_100470674 3300005331 Bacteria 1115
18 Ga0068869_100310075 3300005334 Bacteria 1277
19 Ga0070666_10178882 3300005335 Bacteria 1487
20 Ga0070666_10262806 3300005335 Bacteria 1224
21 Ga0070666_10812822 3300005335 Unclassified 689
22 Ga0070680_100196443 3300005336 Bacteria 1701
23 Ga0068868_100027831 3300005338 Bacteria 4314
24 Ga0068868_100388139 3300005338 Bacteria 1202
25 Ga0068868_100434412 3300005338 Unclassified 1139
26 Ga0070660_100012100 3300005339 Bacteria 6159
27 Ga0070689_100297786 3300005340 Bacteria 1342
28 Ga0070689_100702955 3300005340 Bacteria 883
29 Ga0070687_100188828 3300005343 Bacteria 1240
30 Ga0070687_100224190 3300005343 Unclassified 1153
31 Ga0070661_100294342 3300005344 Bacteria 1262
32 Ga0070661_100925076 3300005344 Unclassified 721
33 Ga0070692_10172681 3300005345 Bacteria 1247
34 Ga0070692_10641184 3300005345 Bacteria 708
35 Ga0070669_100761198 3300005353 Bacteria 821
36 Ga0070675_100004015 3300005354 Bacteria 11173
37 Ga0070675_100065566 3300005354 Bacteria 3003
38 Ga0070675_100587725 3300005354 Unclassified 1009
39 Ga0070675_100626077 3300005354 Bacteria 977
40 Ga0070671_100069324 3300005355 Bacteria 2941
41 Ga0070671_100074028 3300005355 Bacteria 2845
42 Ga0070671_100415464 3300005355 Bacteria 1152
43 Ga0070673_100032972 3300005364 Bacteria 3905
44 Ga0070673_100142258 3300005364 Unclassified 2025
45 Ga0070673_100150740 3300005364 Bacteria 1969
46 Ga0070673_100356888 3300005364 Unclassified 1299
47 Ga0070673_100372404 3300005364 Bacteria 1272
48 Ga0070667_100049280 3300005367 Bacteria 3547
49 Ga0070709_10642132 3300005434 Bacteria 821
50 Ga0070714_100008577 3300005435 Bacteria 7994
51 Ga0070713_100582974 3300005436 Bacteria 1061
52 Ga0070705_100056297 3300005440 Bacteria 2315
53 Ga0070694_100298935 3300005444 Unclassified 1233
54 Ga0070708_100016776 3300005445 Bacteria 6087
55 Ga0070708_100964030 3300005445 Unclassified 800
56 Ga0068867_100018057 3300005459 Bacteria 5013
57 Ga0068867_100575121 3300005459 Unclassified 979
58 Ga0070685_10227352 3300005466 Unclassified 1225
59 Ga0070706_100514675 3300005467 Bacteria 1113
60 Ga0070706_100818435 3300005467 Bacteria 862
61 Ga0070707_100319474 3300005468 Bacteria 1509
62 Ga0070707_100440333 3300005468 Bacteria 1264
63 Ga0070707_100446078 3300005468 Bacteria 1254
64 Ga0070698_100071871 3300005471 Bacteria 3469
65 Ga0070698_100825417 3300005471 Bacteria 871
66 Ga0070698_101158179 3300005471 Unclassified 722
67 Ga0070699_100508982 3300005518 Bacteria 1094
68 Ga0070679_100279091 3300005530 Bacteria 1623
69 Ga0070684_100589617 3300005535 Unclassified 1033
70 Ga0070697_100415832 3300005536 Bacteria 1168
71 Ga0068853_100141083 3300005539 Bacteria 2163
72 Ga0068853_100226050 3300005539 Bacteria 1711
73 Ga0070672_100037699 3300005543 Bacteria 3689
74 Ga0070686_100018964 3300005544 Bacteria 4047
75 Ga0070686_100143487 3300005544 Bacteria 1665
76 Ga0070695_100366743 3300005545 Unclassified 1083
77 Ga0070696_100060960 3300005546 Bacteria 2639
78 Ga0070696_100343125 3300005546 Bacteria 1155
79 Ga0070696_100751127 3300005546 Unclassified 799
80 Ga0070693_100025651 3300005547 Bacteria 3174
81 Ga0070693_100255128 3300005547 Bacteria 1164
82 Ga0070693_100288956 3300005547 Bacteria 1101
83 Ga0070693_100720609 3300005547 Unclassified 732
84 Ga0070665_100004450 3300005548 Bacteria 14719
85 Ga0070665_100825511 3300005548 Unclassified 940
86 Ga0068855_100059811 3300005563 Bacteria 4457
87 Ga0070664_100043019 3300005564 Bacteria 3811
88 Ga0070664_100340540 3300005564 Bacteria 1362
89 Ga0070664_100460104 3300005564 Bacteria 1169
90 Ga0068854_100012391 3300005578 Bacteria 5582
91 Ga0068856_100924415 3300005614 Unclassified 891
92 Ga0068852_100740008 3300005616 Bacteria 995
93 Ga0068859_100018181 3300005617 Bacteria 7065
94 Ga0068859_100207980 3300005617 Bacteria 2043
95 Ga0068859_100379111 3300005617 Unclassified 1510
96 Ga0068859_100715409 3300005617 Unclassified 1092
97 Ga0068864_100004643 3300005618 Bacteria 11264
98 Ga0068864_100123604 3300005618 Bacteria 2316
99 Ga0068866_10009753 3300005718 Bacteria 4089
100 Ga0068861_100580114 3300005719 Unclassified 1026
101 Ga0068863_100020067 3300005841 Bacteria 6393
102 Ga0068863_100410301 3300005841 Bacteria 1326
103 Ga0068863_100617762 3300005841 Bacteria 1073
104 Ga0068858_100071854 3300005842 Bacteria 3210
105 Ga0068858_100074799 3300005842 Bacteria 3146
106 Ga0068858_100185129 3300005842 Bacteria 1967
107 Ga0068858_100251593 3300005842 Bacteria 1678
108 Ga0068858_100929966 3300005842 Bacteria 851
109 Ga0068858_101138074 3300005842 Unclassified 766
110 Ga0068860_100072253 3300005843 Bacteria 3279
111 Ga0068860_101036584 3300005843 Bacteria 839
112 Ga0081455_10023525 3300005937 Bacteria 5731
113 Ga0081455_10058437 3300005937 Bacteria 3263
114 Ga0081455_10107088 3300005937 Bacteria 2229
115 Ga0081539_10024405 3300005985 Bacteria 3923
116 Ga0070715_10378600 3300006163 Bacteria 781
117 Ga0070716_100095458 3300006173 Bacteria 1810
118 Ga0097621_100000858 3300006237 Bacteria 21364
119 Ga0097621_100029051 3300006237 Bacteria 4364
120 Ga0097621_100031001 3300006237 Bacteria 4239
121 Ga0097621_100335453 3300006237 Bacteria 1342
122 Ga0097621_100355756 3300006237 Unclassified 1303
123 Ga0068871_100005083 3300006358 Bacteria 9187
124 Ga0068871_100050442 3300006358 Bacteria 3366
125 Ga0068871_100053257 3300006358 Bacteria 3279
126 Ga0075428_100125917 3300006844 Bacteria 2788
127 Ga0075428_100346497 3300006844 Bacteria 1595
128 Ga0075428_100463822 3300006844 Bacteria 1356
129 Ga0075433_10010436 3300006852 Bacteria 7455
130 Ga0075433_10080043 3300006852 Bacteria 2879
131 Ga0075433_10676168 3300006852 Bacteria 905
132 Ga0075434_100008420 3300006871 Bacteria 9592
133 Ga0075434_100076236 3300006871 Bacteria 3348
134 Ga0075434_100127579 3300006871 Bacteria 2561
135 Ga0075434_100469432 3300006871 Unclassified 1279
136 Ga0075434_100539676 3300006871 Unclassified 1186
137 Ga0075434_100787989 3300006871 Bacteria 967
138 Ga0075429_100629883 3300006880 Bacteria 940
139 Ga0068865_100010509 3300006881 Bacteria 5764
140 Ga0075436_100111311 3300006914 Bacteria 1911
141 Ga0075436_100433523 3300006914 Unclassified 955
142 Ga0075436_100474606 3300006914 Bacteria 913
143 Ga0097620_100018184 3300006931 Bacteria 7065
144 Ga0097620_100207968 3300006931 Bacteria 2043
145 Ga0097620_100379130 3300006931 Unclassified 1510
146 Ga0097620_100715388 3300006931 Unclassified 1092
147 Ga0075435_100037525 3300007076 Bacteria 3859
148 Ga0075435_100111380 3300007076 Bacteria 2277
149 Ga0075435_100123731 3300007076 Bacteria 2160
150 Ga0075435_100125290 3300007076 Bacteria 2146
151 Ga0075435_100233074 3300007076 Bacteria 1564
152 Ga0105251_10137096 3300009011 Bacteria 1108
153 Ga0105240_10181761 3300009093 Bacteria 2481
154 Ga0105240_10357368 3300009093 Bacteria 1656
155 Ga0105240_10367268 3300009093 Unclassified 1628
156 Ga0111539_10009286 3300009094 Bacteria 12419
157 Ga0111539_10055551 3300009094 Bacteria 4707
158 Ga0111539_10312516 3300009094 Bacteria 1829
159 Ga0105245_10249562 3300009098 Unclassified 1723
160 Ga0105245_10528706 3300009098 Bacteria 1199
161 Ga0105245_10664570 3300009098 Unclassified 1073
162 Ga0105247_10047458 3300009101 Bacteria 2637
163 Ga0114129_10001820 3300009147 Bacteria 29050
164 Ga0114129_10007330 3300009147 Bacteria 15702
165 Ga0114129_10015831 3300009147 Bacteria 10723
166 Ga0114129_10032186 3300009147 Bacteria 7413
167 Ga0114129_10060581 3300009147 Bacteria 5292
168 Ga0114129_10251409 3300009147 Bacteria 2373
169 Ga0114129_10499397 3300009147 Bacteria 1589
170 Ga0114129_10585695 3300009147 Bacteria 1447
171 Ga0105243_11363555 3300009148 Bacteria 728
172 Ga0105241_10785094 3300009174 Bacteria 876
173 Ga0105242_10001630 3300009176 Bacteria 17704
174 Ga0105242_10600593 3300009176 Bacteria 1063
175 Ga0105242_10625759 3300009176 Unclassified 1043
176 Ga0105248_10008069 3300009177 Bacteria 11556
177 Ga0105248_10009184 3300009177 Bacteria 10875
178 Ga0105248_10009873 3300009177 Bacteria 10511
179 Ga0105248_10077978 3300009177 Bacteria 3725
180 Ga0105248_10107002 3300009177 Bacteria 3153
181 Ga0105248_10136590 3300009177 Bacteria 2766
182 Ga0105248_10157790 3300009177 Bacteria 2560
183 Ga0105248_10188100 3300009177 Bacteria 2326
184 Ga0105248_10265994 3300009177 Bacteria 1930
185 Ga0105248_10312703 3300009177 Bacteria 1769
186 Ga0105248_10357554 3300009177 Unclassified 1644
187 Ga0105248_11060344 3300009177 Bacteria 916
188 Ga0105238_10059793 3300009551 Bacteria 3817
189 Ga0105238_10111208 3300009551 Bacteria 2720
190 Ga0105238_10265708 3300009551 Bacteria 1696
191 Ga0105238_10282734 3300009551 Bacteria 1641
192 Ga0105246_10151373 3300011119 Bacteria 1756
193 Ga0157370_10518919 3300013104 Bacteria 1094
194 Ga0157374_10607470 3300013296 Bacteria 1104
195 Ga0157378_10411229 3300013297 Bacteria 1335
196 Ga0163162_10012729 3300013306 Bacteria 8216
197 Ga0163162_10819118 3300013306 Bacteria 1047
198 Ga0157375_10119979 3300013308 Bacteria 2738
199 Ga0157375_10250118 3300013308 Bacteria 1933
200 Ga0157375_10431252 3300013308 Unclassified 1484
201 Ga0157375_11182850 3300013308 Bacteria 897
202 Ga0157375_11354971 3300013308 Bacteria 837
203 Ga0163163_10009838 3300014325 Bacteria 8568
204 Ga0163163_10013073 3300014325 Bacteria 7583
205 Ga0163163_10021725 3300014325 Bacteria 6061
206 Ga0163163_10032337 3300014325 Bacteria 5052
207 Ga0163163_10517609 3300014325 Bacteria 1255
208 Ga0163163_10765184 3300014325 Bacteria 1029
209 Ga0157380_10192252 3300014326 Unclassified 1803
210 Ga0157380_10223576 3300014326 Bacteria 1686
211 Ga0157380_10781771 3300014326 Bacteria 969
212 Ga0157377_10078938 3300014745 Unclassified 1919
213 Ga0157379_10114087 3300014968 Bacteria 2429
214 Ga0157379_10349043 3300014968 Bacteria 1354
215 Ga0157379_10434499 3300014968 Bacteria 1210
216 Ga0157376_10040925 3300014969 Bacteria 3791
217 Ga0157376_10182325 3300014969 Bacteria 1920
218 Ga0157376_10463123 3300014969 Bacteria 1239
219 Ga0213876_10040068 3300021384 Bacteria 2475
220 Ga0207713_1052193 3300025735 Unclassified 1621
221 Ga0207680_10091449 3300025903 Bacteria 1936
222 Ga0207680_10203855 3300025903 Bacteria 1349
223 Ga0207680_10565313 3300025903 Unclassified 812
224 Ga0207705_10122623 3300025909 Bacteria 1930
225 Ga0207684_10437174 3300025910 Bacteria 1124
226 Ga0207684_10874179 3300025910 Unclassified 757
227 Ga0207707_10453490 3300025912 Bacteria 1097
228 Ga0207695_10177215 3300025913 Bacteria 2054
229 Ga0207695_10742709 3300025913 Unclassified 862
230 Ga0207660_10670171 3300025917 Bacteria 846
231 Ga0207662_10003221 3300025918 Bacteria 8359
232 Ga0207662_10117652 3300025918 Unclassified 1663
233 Ga0207657_10004241 3300025919 Bacteria 15196
234 Ga0207657_10446100 3300025919 Bacteria 1015
235 Ga0207649_10275924 3300025920 Bacteria 1220
236 Ga0207649_10278105 3300025920 Bacteria 1216
237 Ga0207646_10266269 3300025922 Bacteria 1549
238 Ga0207694_10106763 3300025924 Bacteria 2224
239 Ga0207650_10409742 3300025925 Bacteria 1123
240 Ga0207659_10003457 3300025926 Bacteria 9469
241 Ga0207659_10248374 3300025926 Unclassified 1443
242 Ga0207664_10091111 3300025929 Bacteria 2499
243 Ga0207644_10244202 3300025931 Bacteria 1430
244 Ga0207644_10356359 3300025931 Bacteria 1189
245 Ga0207690_10678412 3300025932 Bacteria 846
246 Ga0207690_10715173 3300025932 Bacteria 824
247 Ga0207706_10052957 3300025933 Bacteria 3583
248 Ga0207686_10008639 3300025934 Bacteria 5500
249 Ga0207686_10332576 3300025934 Bacteria 1138
250 Ga0207665_10182558 3300025939 Bacteria 1520
251 Ga0207691_10048024 3300025940 Bacteria 3915
252 Ga0207711_10004786 3300025941 Bacteria 11491
253 Ga0207711_10068060 3300025941 Bacteria 3083
254 Ga0207711_10280130 3300025941 Unclassified 1535
255 Ga0207711_10368951 3300025941 Bacteria 1331
256 Ga0207711_10499891 3300025941 Bacteria 1133
257 Ga0207711_10591029 3300025941 Unclassified 1036
258 Ga0207711_10624444 3300025941 Unclassified 1005
259 Ga0207711_10755448 3300025941 Unclassified 906
260 Ga0207711_10846191 3300025941 Unclassified 851
261 Ga0207661_10448455 3300025944 Bacteria 1175
262 Ga0207679_10174334 3300025945 Bacteria 1773
263 Ga0207679_10270197 3300025945 Bacteria 1454
264 Ga0207667_10589911 3300025949 Bacteria 1121
265 Ga0207651_10147992 3300025960 Bacteria 1824
266 Ga0207651_10233598 3300025960 Bacteria 1494
267 Ga0207668_10622973 3300025972 Bacteria 942
268 Ga0207668_11035895 3300025972 Unclassified 734
269 Ga0207658_10042642 3300025986 Bacteria 3293
270 Ga0207703_10021948 3300026035 Bacteria 5000
271 Ga0207703_10104245 3300026035 Bacteria 2409
272 Ga0207703_10112481 3300026035 Bacteria 2326
273 Ga0207703_10176792 3300026035 Bacteria 1881
274 Ga0207703_10228868 3300026035 Bacteria 1666
275 Ga0207703_10271833 3300026035 Unclassified 1535
276 Ga0207703_10889468 3300026035 Bacteria 852
277 Ga0207703_10968789 3300026035 Unclassified 816
278 Ga0207639_10418775 3300026041 Bacteria 1210
279 Ga0207702_10820714 3300026078 Unclassified 920
280 Ga0207641_10157831 3300026088 Bacteria 2060
281 Ga0207641_10163554 3300026088 Bacteria 2025
282 Ga0207641_10613690 3300026088 Bacteria 1066
283 Ga0207648_10029864 3300026089 Bacteria 4834
284 Ga0207648_10108953 3300026089 Bacteria 2431
285 Ga0207648_10112205 3300026089 Bacteria 2394
286 Ga0207676_10077106 3300026095 Bacteria 2695
287 Ga0207676_10081447 3300026095 Bacteria 2630
288 Ga0207676_10600159 3300026095 Bacteria 1057
289 Ga0207674_10282924 3300026116 Bacteria 1606
290 Ga0207675_100362269 3300026118 Bacteria 1423
291 Ga0207675_100416381 3300026118 Unclassified 1326
292 Ga0207683_10069442 3300026121 Unclassified 3112
293 Ga0207683_10082169 3300026121 Bacteria 2861
294 Ga0207683_10569887 3300026121 Bacteria 1047
295 Ga0209998_10064042 3300027717 Unclassified 870
296 Ga0207428_10010365 3300027907 Bacteria 8332
297 Ga0207428_10416432 3300027907 Bacteria 982
298 Ga0268266_10015541 3300028379 Bacteria 6527
299 Ga0268266_10194577 3300028379 Bacteria 1853
300 Ga0268264_10146050 3300028381 Unclassified 2115
301 Ga0268264_10264110 3300028381 Bacteria 1605
302 Ga0265330_10060865 3300031235 Bacteria 1643
303 Ga0307413_10183846 3300031824 Bacteria 1493
304 Ga0373930_0084556 3300034816 Unclassified 737
305 Ga0373948_0009249 3300034817 Bacteria 1696
306 Ga0373950_0001437 3300034818 Bacteria 3112
307 Ga0373959_0014872 3300034820 Unclassified 1422
308 Ga0373929_0001368 3300035085 Bacteria 4672
309 Ga0373940_0021818 3300035088 Bacteria 1640
310 Ga0373944_0003264 3300035089 Bacteria 4172
311 Ga0373949_0004437 3300035090 Bacteria 3219
312 Ga0373951_0019954 3300035091 Unclassified 1532
313 Ga0373952_0001662 3300035092 Bacteria 4047
314 Ga0373939_0000857 3300035114 Bacteria 7528
315 Ga0373941_0037998 3300035115 Unclassified 1471
316 Ga0373941_0235977 3300035115 Bacteria 708
317 Ga0373960_0030746 3300035121 Unclassified 1497
318 Ga0373942_0002582 3300035207 Bacteria 4367
319 Ga0373942_0026277 3300035207 Unclassified 1506
320 Ga0373961_0000482 3300035241 Bacteria 15557
321 Ga0373961_0080548 3300035241 Bacteria 1024
322 Ga0373962_0037622 3300035242 Bacteria 1352
323 Ga0373931_0017388 3300035691 Bacteria 3556
324 Ga0373931_0124091 3300035691 Unclassified 1479
325 Ga0373931_0152337 3300035691 Bacteria 1349
326 Ga0373933_0424387 3300035724 Bacteria 869
327 Ga0436365_0197130 3300039437 Bacteria 2909
328 Ga0439446_0201728 3300042156 Unclassified 672
329 Ga0466957_0409486 3300044842 Bacteria 929
330 Ga0451576_0086105 3300045051 Bacteria 3268
331 Ga0451576_0250371 3300045051 Unclassified 1851
332 Ga0495580_0206464 3300046472 Unclassified 1353
333 Ga0495586_0249268 3300046535 Bacteria 1013
334 Ga0495586_0427422 3300046535 Unclassified 763
335 Ga0495586_0480926 3300046535 Unclassified 716
336 Ga0495633_0163799 3300046558 Bacteria 1025
337 Ga0495647_0027743 3300046681 Bacteria 2083
338 Ga0495647_0126929 3300046681 Bacteria 1077
339 Ga0495658_0024501 3300046683 Bacteria 3215
340 Ga0495658_0065004 3300046683 Bacteria 2103
341 Ga0495670_0170002 3300046691 Bacteria 1148
342 Ga0495684_0118948 3300047471 Bacteria 1991
343 Ga0495614_0268339 3300048089 Bacteria 784
344 Ga0496102_0194160 3300048905 Bacteria 1913
345 Ga0496102_1069176 3300048905 Bacteria 727
346 Ga0496103_0185095 3300048906 Bacteria 1339
347 Ga0496104_0054038 3300048907 Bacteria 3796
348 Ga0496105_0211252 3300048908 Bacteria 1582
349 Ga0496105_0600876 3300048908 Unclassified 854
350 Ga0496106_0309146 3300048909 Bacteria 1268
351 Ga0496106_0370950 3300048909 Bacteria 1150
352 Ga0496107_0304721 3300048910 Bacteria 1186
353 Ga0496108_0007098 3300048911 Bacteria 9072
354 Ga0496108_0326092 3300048911 Bacteria 1339
355 Ga0496109_0131200 3300048912 Bacteria 2339
356 Ga0496109_0281666 3300048912 Unclassified 1567
357 Ga0496112_0023415 3300048915 Bacteria 5900
358 Ga0496113_0081444 3300048916 Bacteria 2481
359 Ga0496114_0066200 3300048917 Unclassified 3029
360 Ga0496114_0141849 3300048917 Unclassified 2081
361 Ga0496114_0164822 3300048917 Bacteria 1929
362 Ga0496114_0168944 3300048917 Bacteria 1905
363 Ga0501034_0037699 3300049571 Bacteria 4896
364 Ga0501038_0682373 3300049574 Bacteria 771
365 Ga0501040_0478682 3300049576 Bacteria 897
366 Ga0501046_0308592 3300049580 Bacteria 1154
367 Ga0501047_0018175 3300049581 Bacteria 6737
368 Ga0501073_0221535 3300049589 Unclassified 1307
369 Ga0501080_0473690 3300049742 Bacteria 1121
370 Ga0501083_0304633 3300049744 Bacteria 1036
371 Ga0501035_0407547 3300049822 Bacteria 1130
372 Ga0501044_0004635 3300049823 Bacteria 15392
373 nmdc:mga05p37_147884_c1 3300050507 Bacteria 2875
374 nmdc:mga05p37_155899_c1 3300050507 Unclassified 2791
375 nmdc:mga05p37_160061_c1 3300050507 Bacteria 2750
376 nmdc:mga05p37_2105_c1 3300050507 Bacteria 23247
377 nmdc:mga05p37_315950_c1 3300050507 Bacteria 1850
378 nmdc:mga05p37_46426_c1 3300050507 Bacteria 5341
379 nmdc:mga05p37_7621_c1 3300050507 Bacteria 12776
380 nmdc:mga08y16_13408_c1 3300050511 Bacteria 8623
381 nmdc:mga08y16_184742_c1 3300050511 Bacteria 2164
382 nmdc:mga08y16_4349_c1 3300050511 Bacteria 14799
383 nmdc:mga08y16_488087_c1 3300050511 Bacteria 1253
384 nmdc:mga08y16_692852_c1 3300050511 Bacteria 1019
385 nmdc:mga0n895_165696_c1 3300050512 Unclassified 2242
386 nmdc:mga0n895_293305_c1 3300050512 Unclassified 1649
387 nmdc:mga0n895_388638_c1 3300050512 Bacteria 1411
388 nmdc:mga0n895_40662_c1 3300050512 Bacteria 4517
389 nmdc:mga0n895_682028_c1 3300050512 Bacteria 1024
390 nmdc:mga0n895_97461_c1 3300050512 Bacteria 2946
391 nmdc:mga0n895_97_c2 3300050512 Bacteria 37428
392 nmdc:mga0rr50_151792_c1 3300050513 Bacteria 1873
393 nmdc:mga0rr50_20_c1 3300050513 Bacteria 140799
394 nmdc:mga0rr50_283810_c1 3300050513 Bacteria 1382
395 nmdc:mga0rr50_36670_c1 3300050513 Bacteria 3533
396 nmdc:mga0rr50_528409_c1 3300050513 Bacteria 1004
397 nmdc:mga0rr50_5817_c1 3300050513 Bacteria 7409
398 nmdc:mga08x19_178_c1 3300050514 Bacteria 51286
399 nmdc:mga08x19_442306_c1 3300050514 Bacteria 914
400 nmdc:mga0a205_119706_c1 3300050515 Bacteria 2532
401 nmdc:mga0a205_267748_c1 3300050515 Bacteria 1586
402 nmdc:mga0a205_59858_c1 3300050515 Bacteria 3679
403 nmdc:mga0a205_633139_c1 3300050515 Unclassified 921
404 nmdc:mga0a205_651217_c1 3300050515 Bacteria 905
405 Ga0501082_0132228 3300060353 Bacteria 2165
406 Ga0070705_100186733
407 JGI24751J29686_10041450
408 JGI25406J46586_10077433
409 Ga0065714_10127776
410 Ga0065712_10081509
411 Ga0065712_10086503
412 Ga0065715_10316981
413 Ga0065707_10196629
414 Ga0065707_10268462
415 Ga0070658_10090089
416 Ga0070683_100711172
417 Ga0070690_100002909
418 Ga0070670_100108313
419 Ga0070670_100170225
420 Ga0070670_100286234
421 Ga0070670_100374184
422 Ga0070670_100470674
423 Ga0068869_100310075
424 Ga0070666_10178882
425 Ga0070666_10262806
426 Ga0070666_10812822
427 Ga0070680_100196443
428 Ga0068868_100027831
429 Ga0068868_100388139
430 Ga0068868_100434412
431 Ga0070660_100012100
432 Ga0070689_100297786
433 Ga0070689_100702955
434 Ga0070687_100188828
435 Ga0070687_100224190
436 Ga0070661_100294342
437 Ga0070661_100925076
438 Ga0070692_10172681
439 Ga0070692_10641184
440 Ga0070669_100761198
441 Ga0070675_100004015
442 Ga0070675_100065566
443 Ga0070675_100587725
444 Ga0070675_100626077
445 Ga0070671_100069324
446 Ga0070671_100074028
447 Ga0070671_100415464
448 Ga0070673_100032972
449 Ga0070673_100142258
450 Ga0070673_100150740
451 Ga0070673_100356888
452 Ga0070673_100372404
453 Ga0070667_100049280
454 Ga0070709_10642132
455 Ga0070714_100008577
456 Ga0070713_100582974
457 Ga0070705_100056297
458 Ga0070694_100298935
459 Ga0070708_100016776
460 Ga0070708_100964030
461 Ga0068867_100018057
462 Ga0068867_100575121
463 Ga0070685_10227352
464 Ga0070706_100514675
465 Ga0070706_100818435
466 Ga0070707_100319474
467 Ga0070707_100440333
468 Ga0070707_100446078
469 Ga0070698_100071871
470 Ga0070698_100825417
471 Ga0070698_101158179
472 Ga0070699_100508982
473 Ga0070679_100279091
474 Ga0070684_100589617
475 Ga0070697_100415832
476 Ga0068853_100141083
477 Ga0068853_100226050
478 Ga0070672_100037699
479 Ga0070686_100018964
480 Ga0070686_100143487
481 Ga0070695_100366743
482 Ga0070696_100060960
483 Ga0070696_100343125
484 Ga0070696_100751127
485 Ga0070693_100025651
486 Ga0070693_100255128
487 Ga0070693_100288956
488 Ga0070693_100720609
489 Ga0070665_100004450
490 Ga0070665_100825511
491 Ga0068855_100059811
492 Ga0070664_100043019
493 Ga0070664_100340540
494 Ga0070664_100460104
495 Ga0068854_100012391
496 Ga0068856_100924415
497 Ga0068852_100740008
498 Ga0068859_100018181
499 Ga0068859_100207980
500 Ga0068859_100379111
501 Ga0068859_100715409
502 Ga0068864_100004643
503 Ga0068864_100123604
504 Ga0068866_10009753
505 Ga0068861_100580114
506 Ga0068863_100020067
507 Ga0068863_100410301
508 Ga0068863_100617762
509 Ga0068858_100071854
510 Ga0068858_100074799
511 Ga0068858_100185129
512 Ga0068858_100251593
513 Ga0068858_100929966
514 Ga0068858_101138074
515 Ga0068860_100072253
516 Ga0068860_101036584
517 Ga0081455_10023525
518 Ga0081455_10058437
519 Ga0081455_10107088
520 Ga0081539_10024405
521 Ga0070715_10378600
522 Ga0070716_100095458
523 Ga0097621_100000858
524 Ga0097621_100029051
525 Ga0097621_100031001
526 Ga0097621_100335453
527 Ga0097621_100355756
528 Ga0068871_100005083
529 Ga0068871_100050442
530 Ga0068871_100053257
531 Ga0075428_100125917
532 Ga0075428_100346497
533 Ga0075428_100463822
534 Ga0075433_10010436
535 Ga0075433_10080043
536 Ga0075433_10676168
537 Ga0075434_100008420
538 Ga0075434_100076236
539 Ga0075434_100127579
540 Ga0075434_100469432
541 Ga0075434_100539676
542 Ga0075434_100787989
543 Ga0075429_100629883
544 Ga0068865_100010509
545 Ga0075436_100111311
546 Ga0075436_100433523
547 Ga0075436_100474606
548 Ga0097620_100018184
549 Ga0097620_100207968
550 Ga0097620_100379130
551 Ga0097620_100715388
552 Ga0075435_100037525
553 Ga0075435_100111380
554 Ga0075435_100123731
555 Ga0075435_100125290
556 Ga0075435_100233074
557 Ga0105251_10137096
558 Ga0105240_10181761
559 Ga0105240_10357368
560 Ga0105240_10367268
561 Ga0111539_10009286
562 Ga0111539_10055551
563 Ga0111539_10312516
564 Ga0105245_10249562
565 Ga0105245_10528706
566 Ga0105245_10664570
567 Ga0105247_10047458
568 Ga0114129_10001820
569 Ga0114129_10007330
570 Ga0114129_10015831
571 Ga0114129_10032186
572 Ga0114129_10060581
573 Ga0114129_10251409
574 Ga0114129_10499397
575 Ga0114129_10585695
576 Ga0105243_11363555
577 Ga0105241_10785094
578 Ga0105242_10001630
579 Ga0105242_10600593
580 Ga0105242_10625759
581 Ga0105248_10008069
582 Ga0105248_10009184
583 Ga0105248_10009873
584 Ga0105248_10077978
585 Ga0105248_10107002
586 Ga0105248_10136590
587 Ga0105248_10157790
588 Ga0105248_10188100
589 Ga0105248_10265994
590 Ga0105248_10312703
591 Ga0105248_10357554
592 Ga0105248_11060344
593 Ga0105238_10059793
594 Ga0105238_10111208
595 Ga0105238_10265708
596 Ga0105238_10282734
597 Ga0105246_10151373
598 Ga0157370_10518919
599 Ga0157374_10607470
600 Ga0157378_10411229
601 Ga0163162_10012729
602 Ga0163162_10819118
603 Ga0157375_10119979
604 Ga0157375_10250118
605 Ga0157375_10431252
606 Ga0157375_11182850
607 Ga0157375_11354971
608 Ga0163163_10009838
609 Ga0163163_10013073
610 Ga0163163_10021725
611 Ga0163163_10032337
612 Ga0163163_10517609
613 Ga0163163_10765184
614 Ga0157380_10192252
615 Ga0157380_10223576
616 Ga0157380_10781771
617 Ga0157377_10078938
618 Ga0157379_10114087
619 Ga0157379_10349043
620 Ga0157379_10434499
621 Ga0157376_10040925
622 Ga0157376_10182325
623 Ga0157376_10463123
624 Ga0213876_10040068
625 Ga0207713_1052193
626 Ga0207680_10091449
627 Ga0207680_10203855
628 Ga0207680_10565313
629 Ga0207705_10122623
630 Ga0207684_10437174
631 Ga0207684_10874179
632 Ga0207707_10453490
633 Ga0207695_10177215
634 Ga0207695_10742709
635 Ga0207660_10670171
636 Ga0207662_10003221
637 Ga0207662_10117652
638 Ga0207657_10004241
639 Ga0207657_10446100
640 Ga0207649_10275924
641 Ga0207649_10278105
642 Ga0207646_10266269
643 Ga0207694_10106763
644 Ga0207650_10409742
645 Ga0207659_10003457
646 Ga0207659_10248374
647 Ga0207664_10091111
648 Ga0207644_10244202
649 Ga0207644_10356359
650 Ga0207690_10678412
651 Ga0207690_10715173
652 Ga0207706_10052957
653 Ga0207686_10008639
654 Ga0207686_10332576
655 Ga0207665_10182558
656 Ga0207691_10048024
657 Ga0207711_10004786
658 Ga0207711_10068060
659 Ga0207711_10280130
660 Ga0207711_10368951
661 Ga0207711_10499891
662 Ga0207711_10591029
663 Ga0207711_10624444
664 Ga0207711_10755448
665 Ga0207711_10846191
666 Ga0207661_10448455
667 Ga0207679_10174334
668 Ga0207679_10270197
669 Ga0207667_10589911
670 Ga0207651_10147992
671 Ga0207651_10233598
672 Ga0207668_10622973
673 Ga0207668_11035895
674 Ga0207658_10042642
675 Ga0207703_10021948
676 Ga0207703_10104245
677 Ga0207703_10112481
678 Ga0207703_10176792
679 Ga0207703_10228868
680 Ga0207703_10271833
681 Ga0207703_10889468
682 Ga0207703_10968789
683 Ga0207639_10418775
684 Ga0207702_10820714
685 Ga0207641_10157831
686 Ga0207641_10163554
687 Ga0207641_10613690
688 Ga0207648_10029864
689 Ga0207648_10108953
690 Ga0207648_10112205
691 Ga0207676_10077106
692 Ga0207676_10081447
693 Ga0207676_10600159
694 Ga0207674_10282924
695 Ga0207675_100362269
696 Ga0207675_100416381
697 Ga0207683_10069442
698 Ga0207683_10082169
699 Ga0207683_10569887
700 Ga0209998_10064042
701 Ga0207428_10010365
702 Ga0207428_10416432
703 Ga0268266_10015541
704 Ga0268266_10194577
705 Ga0268264_10146050
706 Ga0268264_10264110
707 Ga0265330_10060865
708 Ga0307413_10183846
709 Ga0373930_0084556
710 Ga0373948_0009249
711 Ga0373950_0001437
712 Ga0373959_0014872
713 Ga0373929_0001368
714 Ga0373940_0021818
715 Ga0373944_0003264
716 Ga0373949_0004437
717 Ga0373951_0019954
718 Ga0373952_0001662
719 Ga0373939_0000857
720 Ga0373941_0037998
721 Ga0373941_0235977
722 Ga0373960_0030746
723 Ga0373942_0002582
724 Ga0373942_0026277
725 Ga0373961_0000482
726 Ga0373961_0080548
727 Ga0373962_0037622
728 Ga0373931_0017388
729 Ga0373931_0124091
730 Ga0373931_0152337
731 Ga0373933_0424387
732 Ga0436365_0197130
733 Ga0439446_0201728
734 Ga0466957_0409486
735 Ga0451576_0086105
736 Ga0451576_0250371
737 Ga0495580_0206464
738 Ga0495586_0249268
739 Ga0495586_0427422
740 Ga0495586_0480926
741 Ga0495633_0163799
742 Ga0495647_0027743
743 Ga0495647_0126929
744 Ga0495658_0024501
745 Ga0495658_0065004
746 Ga0495670_0170002
747 Ga0495684_0118948
748 Ga0495614_0268339
749 Ga0496102_0194160
750 Ga0496102_1069176
751 Ga0496103_0185095
752 Ga0496104_0054038
753 Ga0496105_0211252
754 Ga0496105_0600876
755 Ga0496106_0309146
756 Ga0496106_0370950
757 Ga0496107_0304721
758 Ga0496108_0007098
759 Ga0496108_0326092
760 Ga0496109_0131200
761 Ga0496109_0281666
762 Ga0496112_0023415
763 Ga0496113_0081444
764 Ga0496114_0066200
765 Ga0496114_0141849
766 Ga0496114_0164822
767 Ga0496114_0168944
768 Ga0501034_0037699
769 Ga0501038_0682373
770 Ga0501040_0478682
771 Ga0501046_0308592
772 Ga0501047_0018175
773 Ga0501073_0221535
774 Ga0501080_0473690
775 Ga0501083_0304633
776 Ga0501035_0407547
777 Ga0501044_0004635
778 nmdc:mga05p37_147884_c1
779 nmdc:mga05p37_155899_c1
780 nmdc:mga05p37_160061_c1
781 nmdc:mga05p37_2105_c1
782 nmdc:mga05p37_315950_c1
783 nmdc:mga05p37_46426_c1
784 nmdc:mga05p37_7621_c1
785 nmdc:mga08y16_13408_c1
786 nmdc:mga08y16_184742_c1
787 nmdc:mga08y16_4349_c1
788 nmdc:mga08y16_488087_c1
789 nmdc:mga08y16_692852_c1
790 nmdc:mga0n895_165696_c1
791 nmdc:mga0n895_293305_c1
792 nmdc:mga0n895_388638_c1
793 nmdc:mga0n895_40662_c1
794 nmdc:mga0n895_682028_c1
795 nmdc:mga0n895_97461_c1
796 nmdc:mga0n895_97_c2
797 nmdc:mga0rr50_151792_c1
798 nmdc:mga0rr50_20_c1
799 nmdc:mga0rr50_283810_c1
800 nmdc:mga0rr50_36670_c1
801 nmdc:mga0rr50_528409_c1
802 nmdc:mga0rr50_5817_c1
803 nmdc:mga08x19_178_c1
804 nmdc:mga08x19_442306_c1
805 nmdc:mga0a205_119706_c1
806 nmdc:mga0a205_267748_c1
807 nmdc:mga0a205_59858_c1
808 nmdc:mga0a205_633139_c1
809 nmdc:mga0a205_651217_c1
810 Ga0501082_0132228

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04542

Sigma70_r2

Sigma-70 region 2

46

113

0.96

PF08281

Sigma70_r4_2

Sigma-70, region 4

157

210

0.95

PF07638

Sigma70_ECF

ECF sigma factor

29

216

0.84

Map