F435561

General Info

Members Datasets Scaffolds Average Seq Length
403 320 134 409

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8005314921|8005320058
Length 458
Sequence GKSKCSRDRQRGGLMNAGTFTGKSLSKCINSIHDYRGNCMYSTELETTDIRDELIGRFFRYVAIESQSNTASASLPSSPGQLELARQLGQELRELGVEDVVIDEHAIVTGVKRGNQPGAPRIGFIAHLDTVDIGLSPVIRPQIIRFEGEDLCLNAQKDIWLRVAEHPEIRNWRGSDIIFGDGTSVLGADNKAAIAVIMTLLSRLEISQPRGDIFVAFVPDEEIGLLGAKALDLNRFPCEFAYTIDCCELGEVVVENFNAASGEIVFTGVSAHPMSAKGVLVNPLLMALDFVSHFERSETPECTQKREGYFWFKDLVANESKARLKVMIRDFDKAAFDTRKQRIADVADRIAKQYPSGTVRYQVADTYHNIADYLQDDNRPAELLFNALDRLGVEKKLTPMRGGTDGAALCVRGLPTPNFFTGAHNFHSRFEFLPVPAFQKSYETALMICILAAETRGC

Samples

Sample ID Description Type Environment
1 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
2 2506520008 Serratia plymuthica AS12 Isolate Unclassified
3 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
4 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
5 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
6 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
7 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
8 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
9 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
10 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
11 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
12 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
13 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
14 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
15 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
16 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
17 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
18 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
19 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
20 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
21 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
22 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
23 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
24 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
25 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
26 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
27 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
28 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
29 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
30 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
31 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
32 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
33 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
34 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
35 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
36 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
37 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
38 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
39 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
40 2643221557 Ensifer sp. Root558 Isolate Unclassified
41 2643221668 Ensifer sp. Root423 Isolate Unclassified
42 2643221733 Bosea sp. Root381 Isolate Unclassified
43 2643221734 Bosea sp. Root670 Isolate Unclassified
44 2643221736 Bosea sp. Root483D1 Isolate Unclassified
45 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
46 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
47 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
48 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
49 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
50 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
51 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
52 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
53 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
54 2751185917 Enterobacter sp. HK169 Isolate Unclassified
55 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
56 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
57 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
58 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
59 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
60 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
61 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
62 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
63 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
64 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
65 2818991467 Bosea vestrisii 3192 Isolate Unclassified
66 2821118458 Enterobacter asburiae 609 Isolate Unclassified
67 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
68 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
69 2841760612 Bosea sp. Tri-49 Isolate Nodule
70 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
71 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
72 2844104063 Bosea sp. Tri-39 Isolate Nodule
73 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
74 2851182111 Bosea sp. Tri-44 Isolate Nodule
75 2851246043 Bosea sp. Tri-54 Isolate Nodule
76 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
77 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
78 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
79 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
80 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
81 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
82 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
83 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
84 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
85 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
86 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
87 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
88 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
89 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
90 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
91 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
92 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
93 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
94 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
95 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
96 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
97 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
98 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
99 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
100 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
101 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
102 2919150387 Rahnella aceris 1817 Isolate Unclassified
103 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
104 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
105 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
106 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
107 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
108 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
109 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
110 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
111 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
112 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
113 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
114 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
115 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
116 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
117 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
118 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
119 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
120 2927143783 Rahnella sp. 2050 Isolate Unclassified
121 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
122 2932406140 Serratia sp. 2723 Isolate Rhizosphere
123 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
124 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
125 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
126 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
127 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
128 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
129 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
130 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
131 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
132 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
133 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
134 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
135 2937539931 Pantoea sp. LS15 Isolate Unclassified
136 2937967321 Serratia sp. YC16 Isolate Unclassified
137 2939577877 Serratia sp. 509 Isolate Rhizosphere
138 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
139 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
140 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
141 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
142 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
143 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
144 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
145 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
146 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
147 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
148 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
149 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
150 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
151 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
152 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
153 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
154 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
155 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
156 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
157 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
158 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
159 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
160 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
161 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
162 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
163 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
164 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
165 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
166 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
167 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
168 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
169 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
170 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
171 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
172 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
173 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
174 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
175 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
176 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
177 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
178 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
179 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
180 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
181 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
182 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
183 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
184 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
185 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
186 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
187 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
188 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
189 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
190 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
191 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
192 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
193 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
194 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
195 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
196 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
197 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
198 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
199 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
200 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
201 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
202 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
203 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
204 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
205 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
206 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
207 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
208 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
209 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
210 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
211 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
212 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
213 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
214 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
215 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
216 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
217 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
218 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
219 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
220 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
221 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
222 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
223 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
224 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
225 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
226 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
227 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
228 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
229 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
230 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
231 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
232 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
233 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
234 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
235 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
236 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
237 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
238 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
239 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
240 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
241 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
242 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
243 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
244 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
245 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
246 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
247 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
248 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
249 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
250 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
251 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
252 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
253 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
254 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
255 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
256 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
257 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
258 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
259 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
260 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
268 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
269 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
270 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
271 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
272 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
273 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
274 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
275 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
276 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
277 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
278 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
279 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
280 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
281 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
282 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
283 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
284 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
285 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
286 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
287 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
288 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
289 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
290 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
291 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
292 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
293 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
294 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
295 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
296 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
297 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
298 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
299 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
300 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
301 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
302 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
303 640753048 Serratia proteamaculans 568 Isolate Endosphere
304 641522639 Methylobacterium sp. 4-46 Isolate Nodule
305 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
306 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
307 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
308 8004592986 Serratia sp. S119 Isolate Unclassified
309 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
310 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
311 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
312 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
313 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
314 8018221730 Enterobacter sp. CM29 Isolate Unclassified
315 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
316 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
317 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
318 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
319 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
320 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 33.25
Metatranscriptomes 0
Isolates 66.75

Biome Distribution

Category Percentage (%)
Aerial Root 0.25
Bulb 0
Endosphere 10.92
Nodule 45.66
Rhizoplane 3.97
Rhizosphere 21.09
Stem 0
Stem Tuber 1.24
Unclassified 16.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1001494 3300002737 Bacteria 12194
2 JGI25152J39213_1000051 3300002773 Bacteria 79294
3 JGI25152J39213_1000347 3300002773 Bacteria 28995
4 JGI25151J46595_10000350 3300003187 Bacteria 49262
5 JGI25151J46595_10002067 3300003187 Bacteria 12521
6 JGI25165J46597_1000490 3300003214 Bacteria 38158
7 JGI25153J46596_10000134 3300003215 Bacteria 79294
8 rootL2_10011886 3300003322 Bacteria 21471
9 rootH1_10191137 3300003323 Bacteria 3237
10 Ga0055526_1000953 3300003771 Bacteria 21389
11 Ga0055526_1003392 3300003771 Bacteria 10146
12 Ga0055526_1005432 3300003771 Bacteria 7330
13 Ga0055524_1000104 3300003775 Bacteria 104549
14 Ga0055524_1000262 3300003775 Bacteria 53062
15 Ga0055528_1000040 3300003790 Bacteria 112553
16 Ga0065165_1000141 3300005262 Bacteria 125536
17 Ga0065703_1019052 3300005272 Bacteria 4188
18 Ga0068856_100057055 3300005614 Bacteria 3855
19 Ga0079104_1000975 3300006946 Bacteria 22358
20 Ga0079104_1002601 3300006946 Bacteria 9461
21 Ga0105251_10000329 3300009011 Bacteria 47651
22 Ga0105251_10000644 3300009011 Bacteria 32098
23 Ga0105251_10000779 3300009011 Bacteria 28970
24 Ga0105244_10001891 3300009036 Bacteria 16276
25 Ga0105247_10000166 3300009101 Bacteria 64598
26 Ga0105241_10000001 3300009174 Bacteria 879793
27 Ga0105237_10000384 3300009545 Bacteria 62866
28 Ga0105239_10000394 3300010375 Bacteria 64001
29 Ga0157373_10031271 3300013100 Bacteria 3831
30 Ga0157369_10004201 3300013105 Bacteria 17052
31 Ga0157372_10053292 3300013307 Bacteria 4508
32 Ga0182008_10006857 3300014497 Bacteria 6335
33 Ga0182008_10008818 3300014497 Bacteria 5475
34 Ga0182007_10001889 3300015262 Bacteria 10931
35 Ga0163161_10000003 3300017792 Bacteria 339847
36 Ga0228711_1028484 3300022739 Bacteria 3220
37 Ga0209437_100326 3300025233 Bacteria 60536
38 Ga0209129_1000166 3300025258 Bacteria 97875
39 Ga0209129_1000190 3300025258 Bacteria 84051
40 Ga0209233_1000384 3300025261 Bacteria 38210
41 Ga0209233_1000662 3300025261 Bacteria 16614
42 Ga0209673_1000222 3300025273 Bacteria 112605
43 Ga0209130_1000178 3300025284 Bacteria 90293
44 Ga0209130_1013238 3300025284 Unclassified 2121
45 Ga0209025_1000008 3300025294 Bacteria 1130876
46 Ga0209025_1000336 3300025294 Bacteria 103514
47 Ga0209025_1002196 3300025294 Bacteria 21605
48 Ga0209025_1010848 3300025294 Bacteria 6108
49 Ga0209564_1000015 3300025295 Bacteria 615324
50 Ga0209564_1000258 3300025295 Bacteria 112586
51 Ga0209564_1000730 3300025295 Bacteria 46914
52 Ga0209564_1000752 3300025295 Bacteria 45914
53 Ga0209758_1000316 3300025297 Bacteria 93634
54 Ga0209256_1000062 3300025299 Bacteria 253433
55 Ga0209256_1000202 3300025299 Bacteria 112605
56 Ga0209256_1000995 3300025299 Bacteria 33735
57 Ga0207426_1025514 3300025302 Unclassified 1989
58 Ga0207426_1029585 3300025302 Bacteria 1804
59 Ga0209051_1000604 3300025303 Bacteria 41873
60 Ga0207696_1000001 3300025711 Bacteria 2579611
61 Ga0207655_1000041 3300025728 Bacteria 333962
62 Ga0207713_1000029 3300025735 Bacteria 285054
63 Ga0207713_1000070 3300025735 Bacteria 186597
64 Ga0207713_1000072 3300025735 Bacteria 185652
65 Ga0207713_1002803 3300025735 Bacteria 12302
66 Ga0207710_10000051 3300025900 Bacteria 182751
67 Ga0207654_10000004 3300025911 Bacteria 902334
68 Ga0207671_10000379 3300025914 Bacteria 63039
69 Ga0207702_10116752 3300026078 Bacteria 2382
70 Ga0209281_1000038 3300027111 Bacteria 361154
71 Ga0209281_1002674 3300027111 Bacteria 6749
72 Ga0209282_1013293 3300027666 Bacteria 5245
73 Ga0209282_1020632 3300027666 Bacteria 4172
74 Ga0307409_100195017 3300031995 Bacteria 1807
75 Ga0315915_1000265 3300033464 Bacteria 48403
76 Ga0315915_1003360 3300033464 Bacteria 20328
77 Ga0439438_000419 3300041405 Bacteria 19185
78 Ga0495627_000044 3300046453 Bacteria 182964
79 Ga0495605_0017295 3300046474 Bacteria 3887
80 Ga0495583_0004332 3300046506 Bacteria 10243
81 Ga0495610_0071933 3300046512 Bacteria 1611
82 Ga0495620_0004223 3300046515 Bacteria 8131
83 Ga0495632_0000423 3300046519 Bacteria 40113
84 Ga0495632_0047530 3300046519 Bacteria 2128
85 Ga0495643_0003455 3300046522 Bacteria 11548
86 Ga0495643_0040864 3300046522 Bacteria 2531
87 Ga0495654_0000484 3300046530 Bacteria 32821
88 Ga0495654_0002563 3300046530 Bacteria 11625
89 Ga0495611_0021403 3300046648 Bacteria 2793
90 Ga0495649_0005981 3300046694 Bacteria 7623
91 Ga0495589_0000003 3300046794 Bacteria 453448
92 Ga0495660_0060034 3300046810 Bacteria 2044
93 Ga0495683_0001962 3300047323 Bacteria 12843
94 Ga0495687_010496 3300047443 Bacteria 5076
95 Ga0496100_0089384 3300048903 Bacteria 2098
96 Ga0496102_0000625 3300048905 Bacteria 36336
97 Ga0496103_0002632 3300048906 Bacteria 11243
98 Ga0496103_0032199 3300048906 Bacteria 3199
99 Ga0496116_0000007 3300048919 Bacteria 795464
100 Ga0496116_0000868 3300048919 Bacteria 37701
101 Ga0496117_0001345 3300048920 Bacteria 36055
102 Ga0496117_0014808 3300048920 Bacteria 6691
103 Ga0496118_0000524 3300048921 Bacteria 63074
104 Ga0496118_0009429 3300048921 Bacteria 9857
105 Ga0496118_0099907 3300048921 Bacteria 1964
106 Ga0496119_0000359 3300048922 Bacteria 63918
107 Ga0496119_0001060 3300048922 Bacteria 35062
108 Ga0496119_0019807 3300048922 Bacteria 4933
109 Ga0496119_0025753 3300048922 Bacteria 4100
110 Ga0496120_0000403 3300048923 Bacteria 69285
111 Ga0496120_0000492 3300048923 Bacteria 61827
112 Ga0496120_0001015 3300048923 Bacteria 37573
113 Ga0496120_0004821 3300048923 Bacteria 11041
114 Ga0496121_0001402 3300048924 Bacteria 40798
115 Ga0496122_0013246 3300048925 Bacteria 8086
116 Ga0496122_0034064 3300048925 Bacteria 4175
117 Ga0496122_0046559 3300048925 Bacteria 3357
118 Ga0496123_0008262 3300048926 Bacteria 9596
119 Ga0496123_0025673 3300048926 Bacteria 4433
120 Ga0496124_0000028 3300048927 Bacteria 357219
121 Ga0496124_0002253 3300048927 Bacteria 25627
122 Ga0496124_0016158 3300048927 Bacteria 7116
123 Ga0496124_0026890 3300048927 Bacteria 5179
124 Ga0496124_0101282 3300048927 Bacteria 2334
125 Ga0496125_0002037 3300048928 Bacteria 27348
126 Ga0496125_0041858 3300048928 Bacteria 3910
127 Ga0496126_0033889 3300048929 Bacteria 4803
128 Ga0496126_0287843 3300048929 Bacteria 1359
129 Ga0500618_000031 3300053125 Bacteria 129550
130 Ga0500618_001377 3300053125 Bacteria 10995
131 Ga0500622_0007494 3300053156 Bacteria 6195
132 Ga0500636_0002867 3300053177 Bacteria 9639
133 Ga0500636_0007349 3300053177 Bacteria 6367
134 Ga0500636_0095556 3300053177 Bacteria 1696

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025303 Ga0209051_1000604 Ga0209051_100060438 380
2 3300003771 Ga0055526_1000953 Ga0055526_10009538 382
3 3300025295 Ga0209564_1000730 Ga0209564_10007307 382
4 3300025299 Ga0209256_1000995 Ga0209256_10009957 382
5 iso_pu_bacteria 2937049772 2937051124 382
6 iso_pu_bacteria 2970040964 2970041874 382
7 3300009011 Ga0105251_10000779 Ga0105251_1000077928 386
8 3300009036 Ga0105244_10001891 Ga0105244_100018912 386
9 3300025728 Ga0207655_1000041 Ga0207655_100004118 386
10 3300048928 Ga0496125_0002037 Ga0496125_0002037_9589_10818 386
11 iso_pu_bacteria 2967686174 2967688190 387
12 iso_pu_bacteria 2551306085 2551686451 388
13 3300002773 JGI25152J39213_1000347 JGI25152J39213_100034710 389
14 3300003187 JGI25151J46595_10002067 JGI25151J46595_100020672 389
15 3300025258 Ga0209129_1000166 Ga0209129_100016634 389
16 3300025294 Ga0209025_1000336 Ga0209025_100033638 389
17 3300048903 Ga0496100_0089384 Ga0496100_0089384_902_2080 391
18 iso_pu_bacteria 2960680706 2960681676 391
19 3300048921 Ga0496118_0099907 Ga0496118_0099907_94_1419 393
20 3300048923 Ga0496120_0004821 Ga0496120_0004821_6204_7682 393
21 3300048925 Ga0496122_0034064 Ga0496122_0034064_1939_3366 393
22 3300048925 Ga0496122_0046559 Ga0496122_0046559_398_1699 393
23 3300048927 Ga0496124_0016158 Ga0496124_0016158_653_2050 393
24 3300048928 Ga0496125_0041858 Ga0496125_0041858_1757_3058 393
25 3300048929 Ga0496126_0287843 Ga0496126_0287843_48_1349 393
26 iso_pu_bacteria 2551306087 2551698335 394
27 iso_pu_bacteria 2960693952 2960695565 397
28 iso_pu_bacteria 2524023207 2524454698 398
29 3300046519 Ga0495632_0000423 Ga0495632_0000423_16474_17781 399
30 3300013105 Ga0157369_10004201 Ga0157369_1000420112 400
31 3300013307 Ga0157372_10053292 Ga0157372_100532923 400
32 iso_pu_bacteria 2996310559 2996315081 400
33 3300022739 Ga0228711_1028484 Ga0228711_10284842 401
34 3300027111 Ga0209281_1002674 Ga0209281_10026742 401
35 3300027666 Ga0209282_1013293 Ga0209282_10132932 401
36 3300027666 Ga0209282_1020632 Ga0209282_10206323 401
37 3300033464 Ga0315915_1000265 Ga0315915_10002652 401
38 3300033464 Ga0315915_1003360 Ga0315915_100336012 401
39 iso_pu_bacteria 2602042047 2603642358 401
40 iso_pu_bacteria 2551306090 2551721555 402
41 iso_pu_bacteria 2551306092 2551738840 402
42 iso_pu_bacteria 2643221668 2644379097 402
43 iso_pu_bacteria 2511231052 2511499667 403
44 iso_pu_bacteria 2513237086 2513588395 403
45 iso_pu_bacteria 2513237091 2513619974 403
46 iso_pu_bacteria 2513237143 2513906111 403
47 iso_pu_bacteria 2515154107 2515611831 403
48 iso_pu_bacteria 2516653046 2516896046 403
49 iso_pu_bacteria 2516653046 2516897224 403
50 iso_pu_bacteria 2524023207 2524454180 403
51 iso_pu_bacteria 2545555834 2545674245 403
52 iso_pu_bacteria 2551306084 2551682612 403
53 iso_pu_bacteria 2551306085 2551686574 403
54 iso_pu_bacteria 2551306085 2551688879 403
55 iso_pu_bacteria 2551306086 2551692688 403
56 iso_pu_bacteria 2551306086 2551694709 403
57 iso_pu_bacteria 2551306089 2551712276 403
58 iso_pu_bacteria 2551306090 2551718008 403
59 iso_pu_bacteria 2551306090 2551723905 403
60 iso_pu_bacteria 2551306092 2551731929 403
61 iso_pu_bacteria 2551306092 2551737934 403
62 iso_pu_bacteria 2551306093 2551741480 403
63 iso_pu_bacteria 2551306093 2551743980 403
64 iso_pu_bacteria 2582581867 2585399584 403
65 iso_pu_bacteria 2643221733 2644732725 403
66 iso_pu_bacteria 2643221734 2644736962 403
67 iso_pu_bacteria 2643221736 2644745392 403
68 iso_pu_bacteria 2818991467 2819719847 403
69 iso_pu_bacteria 2850079185 2850085782 403
70 iso_pu_bacteria 2851182111 2851187556 403
71 iso_pu_bacteria 2855825444 2855829092 403
72 iso_pu_bacteria 2855825444 2855830911 403
73 iso_pu_bacteria 2855839649 2855844209 403
74 iso_pu_bacteria 2855839649 2855845359 403
75 iso_pu_bacteria 2858800743 2858805007 403
76 iso_pu_bacteria 2858800743 2858806539 403
77 iso_pu_bacteria 2915986958 2915991957 403
78 iso_pu_bacteria 2916000859 2916001190 403
79 iso_pu_bacteria 2916007675 2916008927 403
80 iso_pu_bacteria 2916014648 2916015930 403
81 iso_pu_bacteria 2916014648 2916016268 403
82 iso_pu_bacteria 2916028427 2916029489 403
83 iso_pu_bacteria 2916035215 2916035943 403
84 iso_pu_bacteria 2916041962 2916047848 403
85 iso_pu_bacteria 2916048683 2916053320 403
86 iso_pu_bacteria 2916068649 2916075163 403
87 iso_pu_bacteria 2916076590 2916082682 403
88 iso_pu_bacteria 2917699015 2917702008 403
89 iso_pu_bacteria 2921201388 2921202347 403
90 iso_pu_bacteria 2921237296 2921238274 403
91 iso_pu_bacteria 2921244191 2921245395 403
92 iso_pu_bacteria 2921282425 2921286886 403
93 iso_pu_bacteria 2921289301 2921291077 403
94 iso_pu_bacteria 2924144063 2924145661 403
95 iso_pu_bacteria 2924150972 2924151970 403
96 iso_pu_bacteria 2924158325 2924163160 403
97 iso_pu_bacteria 2924165586 2924167272 403
98 iso_pu_bacteria 2924172951 2924173943 403
99 iso_pu_bacteria 2924179722 2924183237 403
100 iso_pu_bacteria 2924200457 2924204900 403
101 iso_pu_bacteria 2924207177 2924207659 403
102 iso_pu_bacteria 2924207177 2924212142 403
103 iso_pu_bacteria 2924214083 2924215523 403
104 iso_pu_bacteria 2924221636 2924222900 403
105 iso_pu_bacteria 2937002841 2937003643 403
106 iso_pu_bacteria 2937009748 2937012468 403
107 iso_pu_bacteria 2937016420 2937020205 403
108 iso_pu_bacteria 2937016420 2937022766 403
109 iso_pu_bacteria 2937023124 2937029437 403
110 iso_pu_bacteria 2937042894 2937044971 403
111 iso_pu_bacteria 2937042894 2937045122 403
112 iso_pu_bacteria 2937056579 2937058110 403
113 iso_pu_bacteria 2937063883 2937065031 403
114 iso_pu_bacteria 2937071275 2937076929 403
115 iso_pu_bacteria 2937098957 2937104869 403
116 iso_pu_bacteria 2937106411 2937108182 403
117 iso_pu_bacteria 2937113482 2937118942 403
118 iso_pu_bacteria 2937113482 2937119003 403
119 iso_pu_bacteria 2957382221 2957388542 403
120 iso_pu_bacteria 2957388812 2957393625 403
121 iso_pu_bacteria 2957395598 2957397093 403
122 iso_pu_bacteria 2957402308 2957408807 403
123 iso_pu_bacteria 2957408893 2957413544 403
124 iso_pu_bacteria 2957415311 2957416269 403
125 iso_pu_bacteria 2957422303 2957423059 403
126 iso_pu_bacteria 2957430029 2957433772 403
127 iso_pu_bacteria 2957443900 2957444550 403
128 iso_pu_bacteria 2957450854 2957454509 403
129 iso_pu_bacteria 2957464669 2957469746 403
130 iso_pu_bacteria 2957478035 2957484772 403
131 iso_pu_bacteria 2957505466 2957506911 403
132 iso_pu_bacteria 2960584000 2960589590 403
133 iso_pu_bacteria 2960597568 2960603844 403
134 iso_pu_bacteria 2960610863 2960611945 403
135 iso_pu_bacteria 2960617483 2960622662 403
136 iso_pu_bacteria 2960617483 2960622739 403
137 iso_pu_bacteria 2960637947 2960639714 403
138 iso_pu_bacteria 2960645483 2960646604 403
139 iso_pu_bacteria 2960652885 2960654811 403
140 iso_pu_bacteria 2960660292 2960661265 403
141 iso_pu_bacteria 2960667422 2960667963 403
142 iso_pu_bacteria 2960687367 2960690092 403
143 iso_pu_bacteria 2964607997 2964610667 403
144 iso_pu_bacteria 2964615318 2964616505 403
145 iso_pu_bacteria 2964621998 2964627304 403
146 iso_pu_bacteria 2964628898 2964629875 403
147 iso_pu_bacteria 2964643177 2964645397 403
148 iso_pu_bacteria 2964649959 2964654753 403
149 iso_pu_bacteria 2964656573 2964660612 403
150 iso_pu_bacteria 2964663802 2964664403 403
151 iso_pu_bacteria 2964670856 2964673891 403
152 iso_pu_bacteria 2964685014 2964689582 403
153 iso_pu_bacteria 2964698721 2964703926 403
154 iso_pu_bacteria 2967664464 2967670092 403
155 iso_pu_bacteria 2967678726 2967685749 403
156 iso_pu_bacteria 2967693043 2967698685 403
157 iso_pu_bacteria 2967699805 2967702618 403
158 iso_pu_bacteria 2967706974 2967709283 403
159 iso_pu_bacteria 2967714385 2967717209 403
160 iso_pu_bacteria 2967721400 2967726635 403
161 iso_pu_bacteria 2967742019 2967746249 403
162 iso_pu_bacteria 2967755722 2967756522 403
163 iso_pu_bacteria 2967762386 2967762833 403
164 iso_pu_bacteria 2967762386 2967762848 403
165 iso_pu_bacteria 2967769361 2967774129 403
166 iso_pu_bacteria 2970019648 2970026777 403
167 iso_pu_bacteria 2970033650 2970034482 403
168 iso_pu_bacteria 2970047711 2970048477 403
169 iso_pu_bacteria 2970047711 2970048735 403
170 iso_pu_bacteria 2970054988 2970059846 403
171 iso_pu_bacteria 2970061556 2970063150 403
172 iso_pu_bacteria 2970068827 2970069628 403
173 iso_pu_bacteria 2970082768 2970087033 403
174 iso_pu_bacteria 2970095765 2970096312 403
175 iso_pu_bacteria 2970102677 2970109026 403
176 iso_pu_bacteria 2970109326 2970115932 403
177 iso_pu_bacteria 2970109326 2970115946 403
178 iso_pu_bacteria 2970116247 2970122571 403
179 iso_pu_bacteria 2970129317 2970134715 403
180 iso_pu_bacteria 2970136068 2970137688 403
181 iso_pu_bacteria 2970136068 2970138462 403
182 iso_pu_bacteria 2970149975 2970156410 403
183 iso_pu_bacteria 2970156795 2970162351 403
184 iso_pu_bacteria 2970177841 2970183397 403
185 iso_pu_bacteria 2977516862 2977521478 403
186 iso_pu_bacteria 2977523885 2977527508 403
187 iso_pu_bacteria 2977523885 2977528901 403
188 iso_pu_bacteria 2977537788 2977543672 403
189 iso_pu_bacteria 2977551784 2977557035 403
190 iso_pu_bacteria 2977558990 2977563556 403
191 iso_pu_bacteria 2977565890 2977571928 403
192 iso_pu_bacteria 2977572785 2977573231 403
193 iso_pu_bacteria 2977579622 2977585685 403
194 iso_pu_bacteria 3005445848 3005452147 403
195 iso_pu_bacteria 641522639 641643779 403
196 iso_pu_bacteria 648276728 648738407 403
197 iso_pu_bacteria 648276728 648740887 403
198 iso_pu_bacteria 8003992118 8003996791 403
199 iso_pu_bacteria 2551306087 2551703615 404
200 iso_pu_bacteria 2841911363 2841912895 404
201 iso_pu_bacteria 2841917233 2841918642 404
202 iso_pu_bacteria 8005484373 8005488241 404
203 iso_pu_bacteria 8057529695 8057530877 404
204 iso_pu_bacteria 2506520007 2506579635 405
205 iso_pu_bacteria 2506520008 2506584774 405
206 iso_pu_bacteria 2508501071 2508853425 405
207 iso_pu_bacteria 2537561728 2538426864 405
208 iso_pu_bacteria 2551306084 2551675202 405
209 iso_pu_bacteria 2554235234 2555258039 405
210 iso_pu_bacteria 2582581308 2585281076 405
211 iso_pu_bacteria 2585427591 2585827712 405
212 iso_pu_bacteria 2585427592 2585835045 405
213 iso_pu_bacteria 2602042066 2603698515 405
214 iso_pu_bacteria 2602042067 2603702963 405
215 iso_pu_bacteria 2602042109 2603867031 405
216 iso_pu_bacteria 2654587920 2656276933 405
217 iso_pu_bacteria 2667528172 2671102871 405
218 iso_pu_bacteria 2667528173 2671107126 405
219 iso_pu_bacteria 2671180115 2671587531 405
220 iso_pu_bacteria 2681812866 2681997286 405
221 iso_pu_bacteria 2681812869 2682005412 405
222 iso_pu_bacteria 2687453601 2689446157 405
223 iso_pu_bacteria 2751185917 2753856011 405
224 iso_pu_bacteria 2765235842 2765588983 405
225 iso_pu_bacteria 2775506706 2775539032 405
226 iso_pu_bacteria 2791355010 2792313100 405
227 iso_pu_bacteria 2806310673 2807179652 405
228 iso_pu_bacteria 2821118458 2821119844 405
229 iso_pu_bacteria 2823373977 2823374774 405
230 iso_pu_bacteria 2839993093 2839996735 405
231 iso_pu_bacteria 2841760612 2841760906 405
232 iso_pu_bacteria 2844104063 2844106563 405
233 iso_pu_bacteria 2851246043 2851246919 405
234 iso_pu_bacteria 2852103415 2852107044 405
235 iso_pu_bacteria 2855195626 2855199262 405
236 iso_pu_bacteria 2858466076 2858467958 405
237 iso_pu_bacteria 2869551831 2869555506 405
238 iso_pu_bacteria 2871272651 2871275817 405
239 iso_pu_bacteria 2871282230 2871286510 405
240 iso_pu_bacteria 2891670763 2891671836 405
241 iso_pu_bacteria 2904474040 2904476050 405
242 iso_pu_bacteria 2919108558 2919109281 405
243 iso_pu_bacteria 2919150387 2919152219 405
244 iso_pu_bacteria 2923634449 2923634882 405
245 iso_pu_bacteria 2927143783 2927144888 405
246 iso_pu_bacteria 2932406140 2932409231 405
247 iso_pu_bacteria 2937539931 2937541634 405
248 iso_pu_bacteria 2939577877 2939580823 405
249 iso_pu_bacteria 2939607340 2939611133 405
250 iso_pu_bacteria 2971820967 2971823840 405
251 iso_pu_bacteria 2974310843 2974312089 405
252 iso_pu_bacteria 640753048 640938905 405
253 iso_pu_bacteria 8018221730 8018226321 405
254 iso_pu_bacteria 8018405270 8018407754 405
255 iso_pu_bacteria 8054844752 8054845767 405
256 iso_pu_bacteria 8054849141 8054850784 405
257 iso_pu_bacteria 8055087960 8055089282 405
258 iso_pu_bacteria 8055097453 8055098965 405
259 3300046519 Ga0495632_0047530 Ga0495632_0047530_809_2038 406
260 iso_pu_bacteria 2706794495 2707100572 406
261 iso_pu_bacteria 2854601825 2854604316 406
262 3300003187 JGI25151J46595_10000350 JGI25151J46595_1000035037 407
263 3300003771 Ga0055526_1003392 Ga0055526_10033921 407
264 3300003771 Ga0055526_1005432 Ga0055526_10054325 407
265 3300003775 Ga0055524_1000104 Ga0055524_100010446 407
266 3300003775 Ga0055524_1000262 Ga0055524_10002624 407
267 3300003790 Ga0055528_1000040 Ga0055528_100004060 407
268 3300025273 Ga0209673_1000222 Ga0209673_100022243 407
269 3300025284 Ga0209130_1013238 Ga0209130_10132381 407
270 3300025294 Ga0209025_1000008 Ga0209025_1000008238 407
271 3300025294 Ga0209025_1010848 Ga0209025_10108484 407
272 3300025295 Ga0209564_1000015 Ga0209564_1000015293 407
273 3300025295 Ga0209564_1000258 Ga0209564_100025843 407
274 3300025295 Ga0209564_1000752 Ga0209564_100075228 407
275 3300025299 Ga0209256_1000062 Ga0209256_1000062175 407
276 3300025299 Ga0209256_1000202 Ga0209256_100020243 407
277 3300025302 Ga0207426_1025514 Ga0207426_10255141 407
278 3300046474 Ga0495605_0017295 Ga0495605_0017295_2299_3558 407
279 3300046506 Ga0495583_0004332 Ga0495583_0004332_610_1869 407
280 3300046512 Ga0495610_0071933 Ga0495610_0071933_326_1585 407
281 3300046515 Ga0495620_0004223 Ga0495620_0004223_2754_4013 407
282 3300046522 Ga0495643_0003455 Ga0495643_0003455_5395_6654 407
283 3300046522 Ga0495643_0040864 Ga0495643_0040864_70_1296 407
284 3300046530 Ga0495654_0002563 Ga0495654_0002563_7787_9013 407
285 3300046648 Ga0495611_0021403 Ga0495611_0021403_1346_2605 407
286 3300046694 Ga0495649_0005981 Ga0495649_0005981_1005_2264 407
287 3300046810 Ga0495660_0060034 Ga0495660_0060034_613_1872 407
288 3300047323 Ga0495683_0001962 Ga0495683_0001962_1524_2783 407
289 3300047443 Ga0495687_010496 Ga0495687_010496_109_1368 407
290 3300048926 Ga0496123_0025673 Ga0496123_0025673_2436_3665 407
291 3300048929 Ga0496126_0033889 Ga0496126_0033889_1959_3188 407
292 3300053125 Ga0500618_000031 Ga0500618_000031_5388_6614 407
293 iso_pu_bacteria 2512875026 2512975135 407
294 iso_pu_bacteria 2513237156 2513987752 407
295 iso_pu_bacteria 2517487022 2517567779 407
296 iso_pu_bacteria 2802428860 2802734912 407
297 iso_pu_bacteria 2802428861 2802736693 407
298 iso_pu_bacteria 2802428862 2802747939 407
299 iso_pu_bacteria 2919171160 2919177173 407
300 iso_pu_bacteria 2970122695 2970123093 407
301 iso_pu_bacteria 2977530762 2977532375 407
302 iso_pu_bacteria 3003665799 3003666431 407
303 iso_pu_bacteria 8003999396 8004004550 407
304 iso_pu_bacteria 8003999396 8004005327 407
305 iso_pu_bacteria 8005682033 8005687165 407
306 iso_pu_bacteria 2772190666 2772440071 408
307 iso_pu_bacteria 2888366609 2888370164 408
308 iso_pu_bacteria 2919100787 2919107308 408
309 iso_pu_bacteria 2937967321 2937968695 408
310 iso_pu_bacteria 8004592986 8004596226 408
311 iso_pu_bacteria 8015394850 8015397866 408
312 3300005272 Ga0065703_1019052 Ga0065703_10190522 409
313 3300006946 Ga0079104_1000975 Ga0079104_10009758 409
314 3300006946 Ga0079104_1002601 Ga0079104_10026016 409
315 3300009011 Ga0105251_10000329 Ga0105251_1000032927 409
316 3300009011 Ga0105251_10000644 Ga0105251_100006444 409
317 3300009101 Ga0105247_10000166 Ga0105247_1000016652 409
318 3300009174 Ga0105241_10000001 Ga0105241_10000001743 409
319 3300013100 Ga0157373_10031271 Ga0157373_100312713 409
320 3300014497 Ga0182008_10008818 Ga0182008_100088183 409
321 3300017792 Ga0163161_10000003 Ga0163161_10000003136 409
322 3300025711 Ga0207696_1000001 Ga0207696_10000012383 409
323 3300025735 Ga0207713_1000029 Ga0207713_1000029212 409
324 3300025735 Ga0207713_1000070 Ga0207713_1000070137 409
325 3300025735 Ga0207713_1000072 Ga0207713_1000072140 409
326 3300025735 Ga0207713_1002803 Ga0207713_10028032 409
327 3300025900 Ga0207710_10000051 Ga0207710_1000005152 409
328 3300025911 Ga0207654_10000004 Ga0207654_10000004771 409
329 3300027111 Ga0209281_1000038 Ga0209281_1000038141 409
330 3300041405 Ga0439438_000419 Ga0439438_000419_12662_13891 409
331 3300046453 Ga0495627_000044 Ga0495627_000044_49313_50545 409
332 3300046530 Ga0495654_0000484 Ga0495654_0000484_9646_10878 409
333 3300046794 Ga0495589_0000003 Ga0495589_0000003_314220_315452 409
334 3300048906 Ga0496103_0032199 Ga0496103_0032199_313_1545 409
335 3300048919 Ga0496116_0000007 Ga0496116_0000007_349905_351137 409
336 3300048920 Ga0496117_0014808 Ga0496117_0014808_5260_6492 409
337 3300048921 Ga0496118_0009429 Ga0496118_0009429_3719_4951 409
338 3300048922 Ga0496119_0025753 Ga0496119_0025753_1751_2983 409
339 3300053156 Ga0500622_0007494 Ga0500622_0007494_3016_4254 409
340 iso_pu_bacteria 2984587000 2984587664 409
341 3300003322 rootL2_10011886 rootL2_1001188615 410
342 iso_pu_bacteria 2643221557 2643806742 410
343 3300003323 rootH1_10191137 rootH1_101911372 411
344 3300014497 Ga0182008_10006857 Ga0182008_100068572 412
345 3300015262 Ga0182007_10001889 Ga0182007_100018895 412
346 3300048922 Ga0496119_0000359 Ga0496119_0000359_39776_41023 412
347 3300048922 Ga0496119_0001060 Ga0496119_0001060_10941_12188 412
348 3300048923 Ga0496120_0000403 Ga0496120_0000403_51223_52470 412
349 3300048923 Ga0496120_0000492 Ga0496120_0000492_43753_45000 412
350 3300048927 Ga0496124_0000028 Ga0496124_0000028_122110_123357 412
351 3300053177 Ga0500636_0002867 Ga0500636_0002867_6535_7782 412
352 3300005262 Ga0065165_1000141 Ga0065165_100014145 413
353 3300025284 Ga0209130_1000178 Ga0209130_100017846 413
354 3300025302 Ga0207426_1029585 Ga0207426_10295852 413
355 3300002773 JGI25152J39213_1000051 JGI25152J39213_100005113 415
356 3300003215 JGI25153J46596_10000134 JGI25153J46596_1000013413 415
357 3300025258 Ga0209129_1000190 Ga0209129_100019060 415
358 3300025297 Ga0209758_1000316 Ga0209758_100031671 415
359 iso_pu_bacteria 2511231027 2511388665 415
360 iso_pu_bacteria 2937063883 2937065371 415
361 iso_pu_bacteria 2928521798 2928525527 417
362 iso_pu_bacteria 2954011201 2954012430 417
363 iso_pu_bacteria 2818991448 2819612165 419
364 iso_pu_bacteria 3005416602 3005420692 419
365 iso_pu_bacteria 8005314921 8005320058 419
366 iso_pu_bacteria 8005645114 8005648534 419
367 3300025294 Ga0209025_1002196 Ga0209025_100219610 420
368 iso_pu_bacteria 2582581308 2585281436 422
369 iso_pu_bacteria 2582581315 2585327094 422
370 iso_pu_bacteria 2585427527 2585533126 422
371 iso_pu_bacteria 2585427530 2585555117 422
372 iso_pu_bacteria 2599185236 2599723989 422
373 iso_pu_bacteria 2615840626 2616310837 422
374 3300048927 Ga0496124_0101282 Ga0496124_0101282_279_1592 423
375 3300031995 Ga0307409_100195017 Ga0307409_1001950172 424
376 iso_pu_bacteria 2582581316 2585336559 424
377 iso_pu_bacteria 2667528174 2671116945 424
378 iso_pu_bacteria 2818991453 2819642735 424
379 3300009545 Ga0105237_10000384 Ga0105237_1000038464 426
380 3300010375 Ga0105239_10000394 Ga0105239_1000039464 426
381 3300025261 Ga0209233_1000662 Ga0209233_10006625 426
382 3300025914 Ga0207671_10000379 Ga0207671_100003794 426
383 3300048905 Ga0496102_0000625 Ga0496102_0000625_1719_3002 426
384 3300048906 Ga0496103_0002632 Ga0496103_0002632_1708_2991 426
385 3300048919 Ga0496116_0000868 Ga0496116_0000868_34700_35983 426
386 3300048920 Ga0496117_0001345 Ga0496117_0001345_1719_3002 426
387 3300048921 Ga0496118_0000524 Ga0496118_0000524_1719_3002 426
388 3300048922 Ga0496119_0019807 Ga0496119_0019807_1719_3002 426
389 3300048923 Ga0496120_0001015 Ga0496120_0001015_1719_3002 426
390 3300048924 Ga0496121_0001402 Ga0496121_0001402_37797_39080 426
391 3300048925 Ga0496122_0013246 Ga0496122_0013246_5245_6528 426
392 3300048926 Ga0496123_0008262 Ga0496123_0008262_6576_7859 426
393 3300048927 Ga0496124_0002253 Ga0496124_0002253_8194_9477 426
394 3300053125 Ga0500618_001377 Ga0500618_001377_2025_3308 426
395 3300053177 Ga0500636_0007349 Ga0500636_0007349_4699_5991 426
396 3300053177 Ga0500636_0095556 Ga0500636_0095556_379_1662 426
397 3300002737 JGI25162J39368_1001494 JGI25162J39368_10014947 428
398 3300003214 JGI25165J46597_1000490 JGI25165J46597_10004908 428
399 3300005614 Ga0068856_100057055 Ga0068856_1000570554 428
400 3300025233 Ga0209437_100326 Ga0209437_10032631 428
401 3300025261 Ga0209233_1000384 Ga0209233_10003847 428
402 3300026078 Ga0207702_10116752 Ga0207702_101167522 428
403 3300048927 Ga0496124_0026890 Ga0496124_0026890_362_1648 428

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

175

449

0.89

PF07687

M20_dimer

Peptidase dimerisation domain

254

358

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fno-assembly1.cif.gz_A-2 peptidase t (tripeptidase) 0.95 13 414
1vix-assembly1.cif.gz_B crystal structure of a putative peptidase t 0.9388 12 414
1fno-assembly1.cif.gz_A-2 peptidase t (tripeptidase) 0.9342 13 414
1vix-assembly1.cif.gz_B crystal structure of a putative peptidase t 0.9212 12 414
3ife-assembly1.cif.gz_A-2 1.55 angstrom resolution crystal structure of peptidase t (pept-1) from bacillus anthracis str. 'ames ancestor'. 0.8574 6 414
ID Description Score Start End Superfamily
af_Q4D1I9_7_177_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9788 13 180 3.40.630.10
1vixA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9569 12 414 3.40.630.10
af_Q4D1I9_7_177_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9564 13 180 3.40.630.10
1vixA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9349 12 414 3.40.630.10
1fnoA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9225 221 328 3.30.70.360
ID Description Score Start End GO Terms
AF-A0A498FD91-F1-model_v4 Peptidase T (EC 3.4.11.4) 0.9833 254 406 GO:0045148
AF-A0A021WX35-F1-model_v4 Peptidase T-like protein (EC 3.4.11.-) 0.98 57 415 GO:0004177
GO:0006508
GO:0008237
AF-Q4D1I9-F1-model_v4 Peptidase T, putative 0.9792 10 180
AF-A0A350LL28-F1-model_v4 Peptidase T (EC 3.4.11.4) 0.9786 11 414 GO:0006508
GO:0006518
GO:0008237
GO:0008270
GO:0045148
AF-A0A1V2YKT7-F1-model_v4 Peptidase T (EC 3.4.11.4) 0.9714 9 414 GO:0006508
GO:0006518
GO:0008237
GO:0008270
GO:0045148

Feature Viewer

pLDDT pTM Quality
91.25 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map