F435366

General Info

Members Datasets Scaffolds Average Seq Length
403 228 305 600

Family's Representative Sequence

Representative Sequence 3300009092|Ga0105250_10001708|Ga0105250_100017082
Length 647
Sequence LRSVCAAVVQFIIRKTYYTSINYAVSSAYKNGTHFALLNSILYTSWNSLMASTFGFTLQDWQRSYQQNPQQITALLAAHLDAIDAQDNAWLYLATPAQLQAQIEPLLASYQRNPAALPLFGVPFAVKDNIDVAGWPTSAACPAFTYTAEADAFVVAQLKAAGAVVIGKTNLDQYATGLVGTRSPFGAVSNTFNPDYVSGGSSSGSASVLARGLVGFSLGTDTAGSGRVPAGFNNIVGLKPTKGWFSASGVVPACRLNDTISVFALTVEDAFAVATAAGGYDAGDAYSRSNPHTAPASFKAQPDFAIPATPEFFGDKQAEAAWLAALEQLQAGGATLHPIDFSLFHQLAEQLYYGPWVAERTVAVGEMIHRPEEMDPVVYGIVSSGLKYTAVEAYQAEYLRAELTRQIQQTLAQFDALLVPTSPTIHTLDEMQQEPVHYNSQFGTYTNFTNLADLSALALPAPFRADGLPAGITLIAPAWHDRALAGFGLRWQQQMALPLGATGKAAPAQSYALPISTDHVRVAVVGAHLTGMPLNFQLTTRQAVLVEETQTASHYRLFALLDGPIKKPGLLRGESGAAITVELWDIPLARFGEFVAEIPAPLGIGSLTLADGRIVKGFICEPAVLSQALEITEFGGWRNWLASLGSK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
5 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
6 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
7 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
8 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
9 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
10 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
11 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
12 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
13 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
14 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
15 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
16 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
17 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
18 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
19 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
20 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
21 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
22 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
23 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
24 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
25 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
26 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
27 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
28 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
29 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
30 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
31 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
32 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
33 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
34 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
35 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
36 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
37 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
38 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
39 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
40 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
41 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
42 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
43 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
44 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
45 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
46 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
47 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
48 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
49 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
50 2847085930 Erwinia persicina B64 Isolate Bulb
51 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
52 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
53 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
54 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
55 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
56 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
57 2858950400 Achromobacter sp. K91 Isolate Unclassified
58 2865014394 Pantoea sp. R-71966 Isolate Unclassified
59 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
60 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
61 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
62 2876601092 Pantoea endophytica 596 Isolate Unclassified
63 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
64 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
65 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
66 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
67 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
68 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
69 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
70 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
71 2904504865 Serratia marcescens 1822 Isolate Unclassified
72 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
73 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
74 2919150387 Rahnella aceris 1817 Isolate Unclassified
75 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
76 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
77 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
78 2927143783 Rahnella sp. 2050 Isolate Unclassified
79 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
80 2937967321 Serratia sp. YC16 Isolate Unclassified
81 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
82 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
83 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
84 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
85 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
86 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
87 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
88 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
89 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
90 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
91 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
92 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
93 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
94 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
95 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
96 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
97 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
98 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
99 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
100 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
101 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
102 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
103 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
104 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
105 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
106 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
107 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
108 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
109 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
110 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
111 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
112 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
113 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
114 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
115 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
116 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
130 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
138 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
139 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
141 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
154 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
155 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
156 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
157 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
158 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
159 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
160 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
161 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
162 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
163 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
164 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
165 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
166 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
167 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
168 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
169 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
170 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
171 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
172 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
175 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
176 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
177 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
178 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
179 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
180 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
181 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
185 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
186 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
187 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
188 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
191 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
199 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
200 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
201 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
202 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
203 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
204 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
205 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
210 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
216 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
217 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
218 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
219 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
220 640753048 Serratia proteamaculans 568 Isolate Endosphere
221 8004592986 Serratia sp. S119 Isolate Unclassified
222 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
223 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
224 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
225 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
226 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
227 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
228 8055092621 Silvania confinis H4N4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.68
Metatranscriptomes 0
Isolates 24.32

Biome Distribution

Category Percentage (%)
Aerial Root 0.5
Bulb 0.25
Endosphere 6.7
Nodule 1.49
Rhizoplane 4.47
Rhizosphere 61.29
Stem 0
Stem Tuber 1.24
Unclassified 24.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_285204 2162886007 Bacteria 3541
2 JGI25162J39368_1000007 3300002737 Bacteria 403947
3 JGI25162J39368_1004459 3300002737 Bacteria 3229
4 JGI25163J39215_1000410 3300002771 Bacteria 13470
5 JGI25164J39214_1000010 3300002772 Bacteria 288863
6 JGI25164J39214_1000016 3300002772 Bacteria 202035
7 Ga0055538_1000006 3300003751 Bacteria 403947
8 Ga0055539_1000010 3300003752 Bacteria 403947
9 Ga0055533_1000013 3300003756 Bacteria 403947
10 Ga0055525_1000015 3300003759 Bacteria 403947
11 Ga0055541_1000007 3300003841 Bacteria 403947
12 Ga0058692_1000010 3300003856 Bacteria 326761
13 Ga0058692_1000154 3300003856 Bacteria 43640
14 Ga0058692_1000299 3300003856 Bacteria 25458
15 Ga0058692_1000420 3300003856 Bacteria 19522
16 Ga0058692_1001366 3300003856 Bacteria 9055
17 Ga0065703_1019316 3300005272 Bacteria 3218
18 Ga0065704_10000667 3300005289 Bacteria 21743
19 Ga0065704_10088329 3300005289 Bacteria 2945
20 Ga0065704_10092254 3300005289 Bacteria 2665
21 Ga0070661_100000053 3300005344 Bacteria 89030
22 Ga0070671_100076342 3300005355 Bacteria 2799
23 Ga0070662_100020138 3300005457 Bacteria 4539
24 Ga0068853_100000005 3300005539 Bacteria 366404
25 Ga0070665_100013569 3300005548 Bacteria 8196
26 Ga0070664_100000030 3300005564 Bacteria 89030
27 Ga0068858_100005788 3300005842 Bacteria 12076
28 Ga0075364_10003334 3300006051 Bacteria 9112
29 Ga0075364_10052142 3300006051 Bacteria 2673
30 Ga0079104_1000083 3300006946 Bacteria 137254
31 Ga0079104_1000448 3300006946 Bacteria 46655
32 Ga0079104_1001008 3300006946 Bacteria 21846
33 Ga0105251_10000016 3300009011 Bacteria 146400
34 Ga0105251_10000058 3300009011 Bacteria 103857
35 Ga0105251_10000715 3300009011 Bacteria 30569
36 Ga0105251_10002907 3300009011 Bacteria 12871
37 Ga0105251_10003295 3300009011 Bacteria 11819
38 Ga0105251_10012111 3300009011 Bacteria 4895
39 Ga0105251_10021101 3300009011 Bacteria 3408
40 Ga0105244_10000026 3300009036 Bacteria 216056
41 Ga0105244_10000137 3300009036 Bacteria 75679
42 Ga0105244_10000704 3300009036 Bacteria 29004
43 Ga0105244_10002484 3300009036 Bacteria 13880
44 Ga0105244_10002875 3300009036 Bacteria 12746
45 Ga0105244_10003517 3300009036 Bacteria 11134
46 Ga0105244_10011561 3300009036 Bacteria 5279
47 Ga0105244_10011596 3300009036 Bacteria 5270
48 Ga0105244_10012030 3300009036 Bacteria 5145
49 Ga0105244_10017125 3300009036 Bacteria 4106
50 Ga0105244_10017759 3300009036 Bacteria 4011
51 Ga0105250_10000020 3300009092 Bacteria 242010
52 Ga0105250_10000889 3300009092 Bacteria 17674
53 Ga0105250_10001708 3300009092 Bacteria 11611
54 Ga0105250_10002067 3300009092 Bacteria 10306
55 Ga0105250_10003063 3300009092 Bacteria 8067
56 Ga0105250_10006576 3300009092 Bacteria 5061
57 Ga0105250_10008603 3300009092 Bacteria 4327
58 Ga0105250_10010174 3300009092 Bacteria 3926
59 Ga0105250_10012746 3300009092 Bacteria 3463
60 Ga0105247_10000443 3300009101 Bacteria 35032
61 Ga0105247_10000630 3300009101 Bacteria 28152
62 Ga0105243_10000053 3300009148 Bacteria 137373
63 Ga0105241_10000004 3300009174 Bacteria 803007
64 Ga0105242_10003203 3300009176 Bacteria 12746
65 Ga0105237_10001925 3300009545 Bacteria 26498
66 Ga0105249_10001356 3300009553 Bacteria 21405
67 Ga0105246_10035196 3300011119 Bacteria 3345
68 Ga0157373_10000818 3300013100 Bacteria 24099
69 Ga0157373_10034954 3300013100 Bacteria 3610
70 Ga0157371_10000044 3300013102 Bacteria 194689
71 Ga0157371_10000267 3300013102 Bacteria 71120
72 Ga0157371_10000589 3300013102 Bacteria 43110
73 Ga0157371_10000766 3300013102 Bacteria 37124
74 Ga0157371_10031922 3300013102 Bacteria 3792
75 Ga0157370_10000276 3300013104 Bacteria 65208
76 Ga0157370_10199108 3300013104 Bacteria 1858
77 Ga0157369_10002704 3300013105 Bacteria 21151
78 Ga0157369_10010851 3300013105 Bacteria 10376
79 Ga0163162_10039659 3300013306 Bacteria 4707
80 Ga0157372_10050173 3300013307 Bacteria 4642
81 Ga0157372_10064670 3300013307 Bacteria 4104
82 Ga0157375_10099539 3300013308 Bacteria 2987
83 Ga0182008_10001594 3300014497 Bacteria 15094
84 Ga0182008_10009560 3300014497 Bacteria 5224
85 Ga0182006_1000013 3300015261 Bacteria 363224
86 Ga0182006_1012228 3300015261 Bacteria 3756
87 Ga0182007_10006297 3300015262 Bacteria 5104
88 Ga0163161_10000001 3300017792 Bacteria 2041488
89 Ga0163161_10002687 3300017792 Bacteria 12643
90 Ga0163161_10004040 3300017792 Bacteria 10266
91 Ga0209760_100034 3300025207 Bacteria 135933
92 Ga0209784_100022 3300025224 Bacteria 403999
93 Ga0209566_100021 3300025225 Bacteria 403999
94 Ga0209674_100038 3300025226 Bacteria 403999
95 Ga0209563_100042 3300025230 Bacteria 403999
96 Ga0207427_100027 3300025231 Bacteria 403999
97 Ga0209437_100049 3300025233 Bacteria 403999
98 Ga0209437_100063 3300025233 Bacteria 335477
99 Ga0209677_100025 3300025253 Bacteria 403999
100 Ga0209233_1005285 3300025261 Bacteria 4303
101 Ga0207696_1000001 3300025711 Bacteria 2579611
102 Ga0207696_1000036 3300025711 Bacteria 337736
103 Ga0207696_1000453 3300025711 Bacteria 35831
104 Ga0207696_1000952 3300025711 Bacteria 17674
105 Ga0207696_1001410 3300025711 Bacteria 13120
106 Ga0207696_1002790 3300025711 Bacteria 8300
107 Ga0207696_1007742 3300025711 Bacteria 4175
108 Ga0207696_1010303 3300025711 Bacteria 3433
109 Ga0207655_1000011 3300025728 Bacteria 643321
110 Ga0207655_1000057 3300025728 Bacteria 273598
111 Ga0207655_1000112 3300025728 Bacteria 170624
112 Ga0207655_1000181 3300025728 Bacteria 112734
113 Ga0207655_1000218 3300025728 Bacteria 98543
114 Ga0207655_1000788 3300025728 Bacteria 34605
115 Ga0207655_1000875 3300025728 Bacteria 31869
116 Ga0207655_1009713 3300025728 Bacteria 5938
117 Ga0207655_1010898 3300025728 Bacteria 5466
118 Ga0207655_1012969 3300025728 Bacteria 4820
119 Ga0207655_1023434 3300025728 Bacteria 3062
120 Ga0207713_1000007 3300025735 Bacteria 564979
121 Ga0207713_1000024 3300025735 Bacteria 339156
122 Ga0207713_1000026 3300025735 Bacteria 319032
123 Ga0207713_1000060 3300025735 Bacteria 213145
124 Ga0207713_1002303 3300025735 Bacteria 14042
125 Ga0207713_1003113 3300025735 Bacteria 11502
126 Ga0207713_1003357 3300025735 Bacteria 10983
127 Ga0207713_1036054 3300025735 Bacteria 2126
128 Ga0207710_10000009 3300025900 Bacteria 485205
129 Ga0207710_10000049 3300025900 Bacteria 186492
130 Ga0207654_10000006 3300025911 Bacteria 815027
131 Ga0207671_10004590 3300025914 Bacteria 13123
132 Ga0207649_10000070 3300025920 Bacteria 89018
133 Ga0207709_10000001 3300025935 Bacteria 2228154
134 Ga0207679_10000021 3300025945 Bacteria 221630
135 Ga0207712_10027695 3300025961 Bacteria 3785
136 Ga0207703_10004138 3300026035 Bacteria 11964
137 Ga0207639_10000010 3300026041 Bacteria 415264
138 Ga0209281_1000008 3300027111 Bacteria 867470
139 Ga0209281_1000050 3300027111 Bacteria 320102
140 Ga0209281_1000130 3300027111 Bacteria 191756
141 Ga0209371_1000002 3300027312 Bacteria 1551985
142 Ga0209371_1000006 3300027312 Bacteria 1055642
143 Ga0209371_1000017 3300027312 Bacteria 625776
144 Ga0209371_1000053 3300027312 Bacteria 264616
145 Ga0209371_1000057 3300027312 Bacteria 238850
146 Ga0209371_1000412 3300027312 Bacteria 44123
147 Ga0209371_1000945 3300027312 Bacteria 22636
148 Ga0209371_1001132 3300027312 Bacteria 19583
149 Ga0209371_1001738 3300027312 Bacteria 13726
150 Ga0209371_1005884 3300027312 Bacteria 4718
151 Ga0209371_1006614 3300027312 Bacteria 4251
152 Ga0209371_1007332 3300027312 Bacteria 3865
153 Ga0268256_1000002 3300030500 Bacteria 1535763
154 Ga0268256_1000007 3300030500 Bacteria 1055326
155 Ga0268256_1000053 3300030500 Bacteria 264616
156 Ga0268256_1000091 3300030500 Bacteria 148069
157 Ga0268256_1000798 3300030500 Bacteria 22636
158 Ga0268256_1004093 3300030500 Bacteria 6233
159 Ga0268256_1005873 3300030500 Bacteria 4700
160 Ga0268256_1007523 3300030500 Bacteria 3865
161 Ga0439436_0000073 3300041404 Bacteria 25935
162 Ga0439438_000003 3300041405 Bacteria 464587
163 Ga0439438_001119 3300041405 Bacteria 11922
164 Ga0439438_001814 3300041405 Bacteria 9369
165 Ga0439447_000341 3300041407 Bacteria 16808
166 Ga0439447_000361 3300041407 Bacteria 16505
167 Ga0439447_000968 3300041407 Bacteria 10478
168 Ga0439447_004775 3300041407 Bacteria 4611
169 Ga0439466_0000002 3300041411 Bacteria 494198
170 Ga0439466_0006008 3300041411 Bacteria 4621
171 Ga0439432_002404 3300042006 Bacteria 7061
172 Ga0439432_008611 3300042006 Bacteria 3580
173 Ga0439432_022407 3300042006 Bacteria 2086
174 Ga0439452_000004 3300042010 Bacteria 764268
175 Ga0439452_000013 3300042010 Bacteria 364058
176 Ga0439452_001346 3300042010 Bacteria 10230
177 Ga0439452_001445 3300042010 Bacteria 9707
178 Ga0439463_000452 3300042016 Bacteria 11448
179 Ga0450904_000514 3300042139 Bacteria 7449
180 Ga0450907_000495 3300042146 Bacteria 10884
181 Ga0439434_0010265 3300042435 Bacteria 2760
182 Ga0439464_0003621 3300042439 Bacteria 3915
183 Ga0450893_0000327 3300042532 Bacteria 6642
184 Ga0495627_000028 3300046453 Bacteria 234737
185 Ga0495591_000124 3300046458 Bacteria 84206
186 Ga0495650_0000039 3300046471 Bacteria 375501
187 Ga0495650_0000113 3300046471 Bacteria 196536
188 Ga0495607_0000106 3300046501 Bacteria 88081
189 Ga0495607_0010125 3300046501 Bacteria 6345
190 Ga0495607_0012378 3300046501 Bacteria 5637
191 Ga0495607_0033711 3300046501 Bacteria 3114
192 Ga0495583_0000131 3300046506 Bacteria 125393
193 Ga0495583_0001159 3300046506 Bacteria 28688
194 Ga0495606_0000032 3300046507 Bacteria 248690
195 Ga0495606_0000794 3300046507 Bacteria 48239
196 Ga0495606_0001088 3300046507 Bacteria 38905
197 Ga0495610_0016711 3300046512 Bacteria 4213
198 Ga0495620_0002491 3300046515 Bacteria 10683
199 Ga0495631_0004526 3300046518 Bacteria 7387
200 Ga0495637_0001643 3300046520 Bacteria 12931
201 Ga0495643_0060568 3300046522 Bacteria 2009
202 Ga0495648_0022021 3300046524 Bacteria 4398
203 Ga0495648_0026403 3300046524 Bacteria 3910
204 Ga0495648_0030666 3300046524 Bacteria 3551
205 Ga0495654_0000031 3300046530 Bacteria 206800
206 Ga0495654_0000119 3300046530 Bacteria 88217
207 Ga0495654_0000578 3300046530 Bacteria 29450
208 Ga0495654_0010988 3300046530 Bacteria 4916
209 Ga0495654_0011570 3300046530 Bacteria 4771
210 Ga0495654_0027023 3300046530 Bacteria 2945
211 Ga0495597_0001564 3300046542 Bacteria 16162
212 Ga0495668_0003975 3300046616 Bacteria 10775
213 Ga0495625_0003804 3300046660 Bacteria 14607
214 Ga0495661_0001936 3300046665 Bacteria 16465
215 Ga0495649_0005514 3300046694 Bacteria 8023
216 Ga0495589_0000002 3300046794 Bacteria 758846
217 Ga0495589_0000763 3300046794 Bacteria 20550
218 Ga0495589_0009120 3300046794 Bacteria 5158
219 Ga0495660_0000023 3300046810 Bacteria 272605
220 Ga0495660_0000034 3300046810 Bacteria 201261
221 Ga0495672_0000029 3300047320 Bacteria 305231
222 Ga0495672_0000054 3300047320 Bacteria 230777
223 Ga0495672_0000084 3300047320 Bacteria 156238
224 Ga0495676_0000002 3300047321 Bacteria 373918
225 Ga0495679_000024 3300047446 Bacteria 205864
226 Ga0495679_000255 3300047446 Bacteria 44133
227 Ga0495679_001008 3300047446 Bacteria 17324
228 Ga0495673_0000292 3300047469 Bacteria 67107
229 Ga0495673_0001194 3300047469 Bacteria 21723
230 Ga0495686_0025888 3300047472 Bacteria 3842
231 Ga0496100_0029695 3300048903 Bacteria 3384
232 Ga0496101_0003408 3300048904 Bacteria 9915
233 Ga0496102_0003134 3300048905 Bacteria 14021
234 Ga0496104_0000208 3300048907 Bacteria 52252
235 Ga0496105_0004102 3300048908 Bacteria 10920
236 Ga0496116_0000023 3300048919 Bacteria 475792
237 Ga0496116_0000112 3300048919 Bacteria 181946
238 Ga0496116_0000715 3300048919 Bacteria 42503
239 Ga0496116_0001156 3300048919 Bacteria 31157
240 Ga0496116_0074850 3300048919 Bacteria 2128
241 Ga0496117_0000100 3300048920 Bacteria 194307
242 Ga0496117_0000103 3300048920 Bacteria 189316
243 Ga0496117_0000238 3300048920 Bacteria 104303
244 Ga0496117_0002870 3300048920 Bacteria 20944
245 Ga0496117_0016258 3300048920 Bacteria 6287
246 Ga0496117_0018547 3300048920 Bacteria 5757
247 Ga0496118_0000046 3300048921 Bacteria 271783
248 Ga0496118_0000454 3300048921 Bacteria 67788
249 Ga0496118_0000959 3300048921 Bacteria 45037
250 Ga0496118_0001062 3300048921 Bacteria 42938
251 Ga0496118_0012003 3300048921 Bacteria 8371
252 Ga0496118_0018950 3300048921 Bacteria 6171
253 Ga0496118_0024831 3300048921 Bacteria 5161
254 Ga0496119_0000031 3300048922 Bacteria 239685
255 Ga0496119_0000374 3300048922 Bacteria 61884
256 Ga0496119_0002749 3300048922 Bacteria 18923
257 Ga0496119_0004318 3300048922 Bacteria 14197
258 Ga0496119_0004731 3300048922 Bacteria 13378
259 Ga0496119_0008560 3300048922 Bacteria 8972
260 Ga0496119_0011573 3300048922 Bacteria 7282
261 Ga0496119_0024745 3300048922 Bacteria 4214
262 Ga0496120_0000017 3300048923 Bacteria 269222
263 Ga0496120_0000084 3300048923 Bacteria 156678
264 Ga0496120_0000275 3300048923 Bacteria 86166
265 Ga0496120_0000317 3300048923 Bacteria 79762
266 Ga0496120_0000491 3300048923 Bacteria 61896
267 Ga0496120_0000806 3300048923 Bacteria 45060
268 Ga0496120_0001442 3300048923 Bacteria 28529
269 Ga0496120_0001680 3300048923 Bacteria 25410
270 Ga0496120_0004679 3300048923 Bacteria 11297
271 Ga0496121_0001130 3300048924 Bacteria 46848
272 Ga0496121_0088113 3300048924 Bacteria 2434
273 Ga0496121_0093948 3300048924 Bacteria 2334
274 Ga0496122_0000067 3300048925 Bacteria 231365
275 Ga0496122_0007703 3300048925 Bacteria 11865
276 Ga0496122_0011010 3300048925 Bacteria 9241
277 Ga0496123_0000056 3300048926 Bacteria 231365
278 Ga0496123_0001657 3300048926 Bacteria 29899
279 Ga0496123_0026197 3300048926 Bacteria 4376
280 Ga0496123_0030124 3300048926 Bacteria 3978
281 Ga0496124_0000007 3300048927 Bacteria 883534
282 Ga0496124_0000017 3300048927 Bacteria 444389
283 Ga0496124_0000338 3300048927 Bacteria 85856
284 Ga0496124_0000362 3300048927 Bacteria 82902
285 Ga0496124_0000965 3300048927 Bacteria 45797
286 Ga0496124_0069253 3300048927 Bacteria 2929
287 Ga0496125_0000183 3300048928 Bacteria 137652
288 Ga0496125_0000245 3300048928 Bacteria 111310
289 Ga0496125_0010371 3300048928 Bacteria 9425
290 Ga0496125_0016151 3300048928 Bacteria 7180
291 Ga0496126_0006344 3300048929 Bacteria 13188
292 Ga0496126_0018190 3300048929 Bacteria 6972
293 Ga0496126_0052322 3300048929 Bacteria 3712
294 Ga0496126_0128877 3300048929 Bacteria 2188
295 Ga0495678_000607 3300049459 Bacteria 33697
296 Ga0495682_0000003 3300049460 Bacteria 515787
297 Ga0501034_0016688 3300049571 Bacteria 7529
298 Ga0501047_0003432 3300049581 Bacteria 14984
299 Ga0501035_0070691 3300049822 Bacteria 3091
300 Ga0501044_0005080 3300049823 Bacteria 14681
301 Ga0501226_000032 3300049853 Bacteria 73400
302 Ga0500566_0009776 3300053094 Bacteria 5663
303 Ga0500621_000006 3300053126 Bacteria 245480
304 Ga0500622_0001406 3300053156 Bacteria 19394
305 Ga0500634_0000284 3300053161 Bacteria 16228

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053094 Ga0500566_0009776 Ga0500566_0009776_919_2484 500
2 3300005355 Ga0070671_100076342 Ga0070671_1000763422 515
3 3300005842 Ga0068858_100005788 Ga0068858_1000057885 515
4 3300026035 Ga0207703_10004138 Ga0207703_100041387 515
5 iso_pu_bacteria 2945951305 2945954335 519
6 3300042139 Ga0450904_000514 Ga0450904_000514_3349_5145 545
7 3300049853 Ga0501226_000032 Ga0501226_000032_8193_9989 567
8 3300005539 Ga0068853_100000005 Ga0068853_1000000055 570
9 3300026041 Ga0207639_10000010 Ga0207639_10000010289 570
10 3300048922 Ga0496119_0024745 Ga0496119_0024745_1781_3616 571
11 3300049571 Ga0501034_0016688 Ga0501034_0016688_2930_4765 572
12 3300049581 Ga0501047_0003432 Ga0501047_0003432_12413_14248 572
13 3300049822 Ga0501035_0070691 Ga0501035_0070691_141_1976 572
14 3300049823 Ga0501044_0005080 Ga0501044_0005080_8206_10041 572
15 3300048922 Ga0496119_0004318 Ga0496119_0004318_7496_9325 576
16 3300048923 Ga0496120_0000084 Ga0496120_0000084_65028_66857 576
17 3300048927 Ga0496124_0000017 Ga0496124_0000017_352689_354518 576
18 3300048921 Ga0496118_0024831 Ga0496118_0024831_3404_5137 577
19 3300002737 JGI25162J39368_1004459 JGI25162J39368_10044592 578
20 3300006051 Ga0075364_10052142 Ga0075364_100521422 578
21 3300009011 Ga0105251_10012111 Ga0105251_100121111 578
22 3300009092 Ga0105250_10010174 Ga0105250_100101742 578
23 3300013105 Ga0157369_10010851 Ga0157369_100108515 578
24 3300013307 Ga0157372_10064670 Ga0157372_100646701 578
25 3300025233 Ga0209437_100063 Ga0209437_100063132 578
26 3300025728 Ga0207655_1010898 Ga0207655_10108982 578
27 3300025735 Ga0207713_1000007 Ga0207713_1000007177 578
28 3300048905 Ga0496102_0003134 Ga0496102_0003134_7552_9348 578
29 3300048920 Ga0496117_0000103 Ga0496117_0000103_73678_75474 578
30 3300048921 Ga0496118_0000046 Ga0496118_0000046_156145_157941 578
31 3300048922 Ga0496119_0004731 Ga0496119_0004731_4054_5883 578
32 3300048923 Ga0496120_0000275 Ga0496120_0000275_6456_8285 578
33 3300048925 Ga0496122_0007703 Ga0496122_0007703_9014_10810 578
34 3300048927 Ga0496124_0069253 Ga0496124_0069253_928_2724 578
35 3300046530 Ga0495654_0000578 Ga0495654_0000578_9144_10892 579
36 3300048919 Ga0496116_0001156 Ga0496116_0001156_11150_12949 579
37 3300048922 Ga0496119_0002749 Ga0496119_0002749_16870_18669 579
38 3300048923 Ga0496120_0000317 Ga0496120_0000317_422_2221 579
39 3300053156 Ga0500622_0001406 Ga0500622_0001406_11374_13185 580
40 iso_pu_bacteria 2639762793 2640733800 580
41 3300048920 Ga0496117_0000238 Ga0496117_0000238_66482_68278 582
42 iso_pu_bacteria 2916699645 2916701608 583
43 3300003856 Ga0058692_1001366 Ga0058692_10013668 584
44 3300005548 Ga0070665_100013569 Ga0070665_1000135692 584
45 3300011119 Ga0105246_10035196 Ga0105246_100351962 584
46 3300013102 Ga0157371_10000766 Ga0157371_100007665 584
47 3300014497 Ga0182008_10009560 Ga0182008_100095602 584
48 3300015261 Ga0182006_1012228 Ga0182006_10122281 584
49 3300027312 Ga0209371_1005884 Ga0209371_10058842 584
50 3300041407 Ga0439447_000968 Ga0439447_000968_8526_10322 584
51 3300041411 Ga0439466_0000002 Ga0439466_0000002_365605_367401 584
52 3300047320 Ga0495672_0000054 Ga0495672_0000054_23760_25556 584
53 3300048908 Ga0496105_0004102 Ga0496105_0004102_2252_4048 584
54 3300048921 Ga0496118_0001062 Ga0496118_0001062_17369_19165 584
55 3300048922 Ga0496119_0011573 Ga0496119_0011573_625_2421 584
56 3300048923 Ga0496120_0000806 Ga0496120_0000806_4861_6657 584
57 3300048927 Ga0496124_0000965 Ga0496124_0000965_23821_25617 584
58 3300005457 Ga0070662_100020138 Ga0070662_1000201382 585
59 3300009036 Ga0105244_10000704 Ga0105244_100007044 585
60 3300013104 Ga0157370_10000276 Ga0157370_1000027619 585
61 3300025711 Ga0207696_1007742 Ga0207696_10077421 585
62 3300025728 Ga0207655_1012969 Ga0207655_10129692 585
63 3300042010 Ga0439452_000004 Ga0439452_000004_554239_556032 585
64 3300042010 Ga0439452_001346 Ga0439452_001346_3146_4942 585
65 3300042146 Ga0450907_000495 Ga0450907_000495_4940_6736 585
66 3300046524 Ga0495648_0026403 Ga0495648_0026403_1876_3672 585
67 3300048919 Ga0496116_0000715 Ga0496116_0000715_7432_9225 585
68 3300048920 Ga0496117_0002870 Ga0496117_0002870_1428_3221 585
69 3300048921 Ga0496118_0000959 Ga0496118_0000959_30363_32156 585
70 3300048924 Ga0496121_0001130 Ga0496121_0001130_21259_23055 585
71 3300048928 Ga0496125_0010371 Ga0496125_0010371_3234_5030 585
72 3300003856 Ga0058692_1000154 Ga0058692_100015417 586
73 3300027312 Ga0209371_1000053 Ga0209371_1000053160 586
74 3300030500 Ga0268256_1000053 Ga0268256_100005374 586
75 iso_pu_bacteria 2928515477 2928518849 586
76 iso_pu_bacteria 8033232454 8033233145 586
77 3300048903 Ga0496100_0029695 Ga0496100_0029695_420_2216 587
78 iso_pu_bacteria 2551306352 2552747245 587
79 iso_pu_bacteria 2675903507 2678230781 587
80 iso_pu_bacteria 2773857761 2774388663 587
81 iso_pu_bacteria 2773857770 2774438677 587
82 iso_pu_bacteria 2919182534 2919183689 587
83 3300015261 Ga0182006_1000013 Ga0182006_1000013200 588
84 3300015262 Ga0182007_10006297 Ga0182007_100062971 588
85 3300048929 Ga0496126_0018190 Ga0496126_0018190_722_2518 588
86 3300009011 Ga0105251_10000016 Ga0105251_10000016112 589
87 3300013102 Ga0157371_10000589 Ga0157371_1000058941 589
88 3300013307 Ga0157372_10050173 Ga0157372_100501732 589
89 3300025735 Ga0207713_1000060 Ga0207713_1000060173 589
90 3300041405 Ga0439438_000003 Ga0439438_000003_199260_201059 589
91 3300041407 Ga0439447_000341 Ga0439447_000341_6417_8216 589
92 3300042006 Ga0439432_008611 Ga0439432_008611_857_2656 589
93 3300003856 Ga0058692_1000010 Ga0058692_1000010112 590
94 3300005272 Ga0065703_1019316 Ga0065703_10193162 590
95 3300005289 Ga0065704_10088329 Ga0065704_100883292 590
96 3300005289 Ga0065704_10092254 Ga0065704_100922543 590
97 3300009011 Ga0105251_10003295 Ga0105251_1000329510 590
98 3300009011 Ga0105251_10021101 Ga0105251_100211013 590
99 3300009036 Ga0105244_10003517 Ga0105244_100035174 590
100 3300009036 Ga0105244_10011561 Ga0105244_100115615 590
101 3300009036 Ga0105244_10011596 Ga0105244_100115964 590
102 3300009036 Ga0105244_10012030 Ga0105244_100120304 590
103 3300009092 Ga0105250_10006576 Ga0105250_100065764 590
104 3300009092 Ga0105250_10008603 Ga0105250_100086033 590
105 3300009092 Ga0105250_10012746 Ga0105250_100127462 590
106 3300009101 Ga0105247_10000443 Ga0105247_100004438 590
107 3300009148 Ga0105243_10000053 Ga0105243_10000053130 590
108 3300009553 Ga0105249_10001356 Ga0105249_1000135619 590
109 3300013100 Ga0157373_10034954 Ga0157373_100349543 590
110 3300013104 Ga0157370_10199108 Ga0157370_101991081 590
111 3300017792 Ga0163161_10002687 Ga0163161_100026877 590
112 3300017792 Ga0163161_10004040 Ga0163161_100040406 590
113 3300025711 Ga0207696_1001410 Ga0207696_10014108 590
114 3300025711 Ga0207696_1002790 Ga0207696_10027905 590
115 3300025711 Ga0207696_1010303 Ga0207696_10103032 590
116 3300025728 Ga0207655_1000112 Ga0207655_1000112160 590
117 3300025728 Ga0207655_1000181 Ga0207655_100018196 590
118 3300025728 Ga0207655_1000788 Ga0207655_100078833 590
119 3300025735 Ga0207713_1003113 Ga0207713_10031138 590
120 3300025735 Ga0207713_1003357 Ga0207713_10033578 590
121 3300025735 Ga0207713_1036054 Ga0207713_10360542 590
122 3300025900 Ga0207710_10000009 Ga0207710_1000000912 590
123 3300025935 Ga0207709_10000001 Ga0207709_100000011538 590
124 3300025961 Ga0207712_10027695 Ga0207712_100276952 590
125 3300027312 Ga0209371_1000006 Ga0209371_1000006684 590
126 3300030500 Ga0268256_1000007 Ga0268256_1000007684 590
127 3300046501 Ga0495607_0010125 Ga0495607_0010125_4336_6159 590
128 3300048929 Ga0496126_0128877 Ga0496126_0128877_195_1997 590
129 iso_pu_bacteria 2881609920 2881613739 591
130 3300003856 Ga0058692_1000420 Ga0058692_100042011 592
131 3300048922 Ga0496119_0000374 Ga0496119_0000374_55228_57024 592
132 3300048923 Ga0496120_0000491 Ga0496120_0000491_55240_57036 592
133 iso_pu_bacteria 2687453129 2687580462 592
134 3300046501 Ga0495607_0000106 Ga0495607_0000106_8491_10401 593
135 iso_pu_bacteria 2599185299 2599928135 593
136 iso_pu_bacteria 2648501693 2650900209 593
137 iso_pu_bacteria 2684622997 2686354448 593
138 iso_pu_bacteria 2711768156 2712470075 593
139 iso_pu_bacteria 2847797336 2847801301 593
140 iso_pu_bacteria 2978975091 2978976820 593
141 iso_pu_bacteria 2984494565 2984498132 593
142 iso_pu_bacteria 2990261002 2990265170 593
143 3300006946 Ga0079104_1001008 Ga0079104_100100814 594
144 3300027111 Ga0209281_1000050 Ga0209281_1000050267 594
145 3300046507 Ga0495606_0000032 Ga0495606_0000032_203034_204860 594
146 iso_pu_bacteria 2511231025 2511381912 594
147 iso_pu_bacteria 2511231035 2511432748 594
148 iso_pu_bacteria 2599185288 2599880370 594
149 iso_pu_bacteria 2599185303 2599946949 594
150 iso_pu_bacteria 2608642108 2608670528 594
151 iso_pu_bacteria 2619619299 2621300056 594
152 iso_pu_bacteria 2671180115 2671585904 594
153 iso_pu_bacteria 2738541265 2738670058 594
154 iso_pu_bacteria 2738541282 2738748451 594
155 iso_pu_bacteria 2738541294 2738806594 594
156 iso_pu_bacteria 2738541303 2738857493 594
157 iso_pu_bacteria 2738541309 2738893954 594
158 iso_pu_bacteria 2808606385 2808979284 594
159 iso_pu_bacteria 2808606388 2808994832 594
160 iso_pu_bacteria 2808606414 2809124264 594
161 iso_pu_bacteria 2816332298 2817491396 594
162 iso_pu_bacteria 2844528606 2844532604 594
163 iso_pu_bacteria 2852612431 2852614268 594
164 iso_pu_bacteria 2852667396 2852667994 594
165 iso_pu_bacteria 2865014394 2865018610 594
166 iso_pu_bacteria 2876601092 2876605747 594
167 iso_pu_bacteria 2891670763 2891672489 594
168 iso_pu_bacteria 2939602548 2939606623 594
169 iso_pu_bacteria 8016733728 8016737276 594
170 iso_pu_bacteria 8019499862 8019502477 594
171 iso_pu_bacteria 8054849141 8054850932 594
172 3300003856 Ga0058692_1000299 Ga0058692_100029915 595
173 3300027312 Ga0209371_1000945 Ga0209371_100094512 595
174 3300030500 Ga0268256_1000798 Ga0268256_10007988 595
175 iso_pu_bacteria 2847085930 2847089126 595
176 iso_pu_bacteria 2945961074 2945964011 595
177 3300048919 Ga0496116_0074850 Ga0496116_0074850_23_1960 596
178 iso_pu_bacteria 2537561728 2538427482 596
179 iso_pu_bacteria 2600255257 2601539770 596
180 iso_pu_bacteria 2600255310 2601758119 596
181 iso_pu_bacteria 2600255311 2601763629 596
182 iso_pu_bacteria 2791355275 2793404194 596
183 iso_pu_bacteria 2811995292 2813728554 596
184 iso_pu_bacteria 2814123068 2814696068 596
185 iso_pu_bacteria 2855195626 2855197163 596
186 iso_pu_bacteria 2858466076 2858468674 596
187 iso_pu_bacteria 2871272651 2871274466 596
188 iso_pu_bacteria 2871282230 2871286131 596
189 iso_pu_bacteria 2884086401 2884090234 596
190 iso_pu_bacteria 2900051742 2900051769 596
191 iso_pu_bacteria 2908669403 2908673100 596
192 iso_pu_bacteria 3000376612 3000379382 596
193 iso_pu_bacteria 3007252601 3007254503 596
194 iso_pu_bacteria 8055087960 8055091308 596
195 iso_pu_bacteria 8055092621 8055094943 596
196 3300013102 Ga0157371_10031922 Ga0157371_100319221 597
197 3300041404 Ga0439436_0000073 Ga0439436_0000073_1816_3624 597
198 3300041405 Ga0439438_001814 Ga0439438_001814_1398_3206 597
199 3300041407 Ga0439447_000361 Ga0439447_000361_7255_9063 597
200 3300041411 Ga0439466_0006008 Ga0439466_0006008_1443_3251 597
201 3300042006 Ga0439432_002404 Ga0439432_002404_2216_4024 597
202 3300042010 Ga0439452_000013 Ga0439452_000013_46917_48710 597
203 3300042010 Ga0439452_001445 Ga0439452_001445_6330_8138 597
204 3300042435 Ga0439434_0010265 Ga0439434_0010265_81_1889 597
205 3300042439 Ga0439464_0003621 Ga0439464_0003621_324_2120 597
206 3300048926 Ga0496123_0030124 Ga0496123_0030124_1910_3706 597
207 iso_pu_bacteria 2744054655 2745160986 597
208 3300005344 Ga0070661_100000053 Ga0070661_10000005370 598
209 3300005564 Ga0070664_100000030 Ga0070664_10000003068 598
210 3300009036 Ga0105244_10002484 Ga0105244_1000248411 598
211 3300009036 Ga0105244_10017759 Ga0105244_100177592 598
212 3300009092 Ga0105250_10001708 Ga0105250_100017082 598
213 3300009176 Ga0105242_10003203 Ga0105242_100032033 598
214 3300009545 Ga0105237_10001925 Ga0105237_1000192514 598
215 3300013100 Ga0157373_10000818 Ga0157373_1000081814 598
216 3300013102 Ga0157371_10000267 Ga0157371_1000026729 598
217 3300013105 Ga0157369_10002704 Ga0157369_100027047 598
218 3300013308 Ga0157375_10099539 Ga0157375_100995392 598
219 3300025711 Ga0207696_1000453 Ga0207696_10004538 598
220 3300025728 Ga0207655_1000875 Ga0207655_100087512 598
221 3300025728 Ga0207655_1023434 Ga0207655_10234342 598
222 3300025914 Ga0207671_10004590 Ga0207671_1000459011 598
223 3300025920 Ga0207649_10000070 Ga0207649_1000007011 598
224 3300025945 Ga0207679_10000021 Ga0207679_1000002167 598
225 3300027312 Ga0209371_1000017 Ga0209371_1000017544 598
226 3300027312 Ga0209371_1001132 Ga0209371_100113210 598
227 3300027312 Ga0209371_1001738 Ga0209371_10017383 598
228 3300030500 Ga0268256_1000091 Ga0268256_1000091145 598
229 3300041405 Ga0439438_001119 Ga0439438_001119_2412_4208 598
230 3300041407 Ga0439447_004775 Ga0439447_004775_345_2141 598
231 3300046458 Ga0495591_000124 Ga0495591_000124_5388_7307 598
232 3300046512 Ga0495610_0016711 Ga0495610_0016711_1217_3013 598
233 3300046518 Ga0495631_0004526 Ga0495631_0004526_908_2704 598
234 3300046524 Ga0495648_0030666 Ga0495648_0030666_875_2671 598
235 3300046530 Ga0495654_0000031 Ga0495654_0000031_59086_60984 598
236 3300046616 Ga0495668_0003975 Ga0495668_0003975_4176_6074 598
237 3300046665 Ga0495661_0001936 Ga0495661_0001936_3333_5129 598
238 3300047446 Ga0495679_000255 Ga0495679_000255_9093_10889 598
239 3300048904 Ga0496101_0003408 Ga0496101_0003408_5065_7008 598
240 3300048922 Ga0496119_0008560 Ga0496119_0008560_2308_4227 598
241 3300048923 Ga0496120_0001442 Ga0496120_0001442_5487_7406 598
242 3300048924 Ga0496121_0088113 Ga0496121_0088113_25_1950 598
243 3300048925 Ga0496122_0011010 Ga0496122_0011010_3147_5090 598
244 3300048926 Ga0496123_0001657 Ga0496123_0001657_10588_12531 598
245 3300053161 Ga0500634_0000284 Ga0500634_0000284_3201_4997 598
246 iso_pu_bacteria 2508501071 2508851390 598
247 iso_pu_bacteria 2772190666 2772437960 598
248 iso_pu_bacteria 2791354903 2791921328 598
249 iso_pu_bacteria 2888366609 2888367961 598
250 iso_pu_bacteria 2937967321 2937969701 598
251 iso_pu_bacteria 640753048 640936950 598
252 iso_pu_bacteria 8004592986 8004594832 598
253 iso_pu_bacteria 8015394850 8015394969 598
254 3300009011 Ga0105251_10000715 Ga0105251_1000071530 599
255 3300009036 Ga0105244_10000137 Ga0105244_1000013735 599
256 3300009092 Ga0105250_10003063 Ga0105250_100030634 599
257 3300009101 Ga0105247_10000630 Ga0105247_1000063028 599
258 3300025711 Ga0207696_1000001 Ga0207696_1000001247 599
259 3300025728 Ga0207655_1000218 Ga0207655_100021829 599
260 3300025735 Ga0207713_1000024 Ga0207713_1000024142 599
261 3300025900 Ga0207710_10000049 Ga0207710_1000004914 599
262 3300027312 Ga0209371_1007332 Ga0209371_10073322 599
263 3300030500 Ga0268256_1007523 Ga0268256_10075232 599
264 3300048919 Ga0496116_0000023 Ga0496116_0000023_132344_134215 599
265 3300048921 Ga0496118_0012003 Ga0496118_0012003_6086_7954 599
266 3300048922 Ga0496119_0000031 Ga0496119_0000031_123195_124994 599
267 3300048923 Ga0496120_0000017 Ga0496120_0000017_227564_229363 599
268 3300048927 Ga0496124_0000007 Ga0496124_0000007_642280_644205 599
269 iso_pu_bacteria 2888373701 2888374396 599
270 3300006946 Ga0079104_1000083 Ga0079104_100008317 600
271 3300027111 Ga0209281_1000130 Ga0209281_100013017 600
272 3300027312 Ga0209371_1000002 Ga0209371_1000002842 600
273 3300027312 Ga0209371_1000057 Ga0209371_1000057160 600
274 3300027312 Ga0209371_1006614 Ga0209371_10066143 600
275 3300030500 Ga0268256_1000002 Ga0268256_1000002621 600
276 3300030500 Ga0268256_1005873 Ga0268256_10058733 600
277 3300046471 Ga0495650_0000113 Ga0495650_0000113_53575_55377 600
278 3300046501 Ga0495607_0012378 Ga0495607_0012378_853_2655 600
279 3300046507 Ga0495606_0001088 Ga0495606_0001088_4471_6273 600
280 3300046524 Ga0495648_0022021 Ga0495648_0022021_1703_3505 600
281 3300046530 Ga0495654_0010988 Ga0495654_0010988_1045_2847 600
282 3300046694 Ga0495649_0005514 Ga0495649_0005514_4668_6470 600
283 3300046794 Ga0495589_0009120 Ga0495589_0009120_1192_2994 600
284 3300046810 Ga0495660_0000034 Ga0495660_0000034_99962_101764 600
285 3300047320 Ga0495672_0000029 Ga0495672_0000029_63450_65252 600
286 3300047469 Ga0495673_0001194 Ga0495673_0001194_19565_21367 600
287 3300049459 Ga0495678_000607 Ga0495678_000607_27280_29082 600
288 3300049460 Ga0495682_0000003 Ga0495682_0000003_230214_232016 600
289 3300053126 Ga0500621_000006 Ga0500621_000006_220491_222293 600
290 iso_pu_bacteria 2599185307 2599970787 600
291 iso_pu_bacteria 2811994881 2812367436 600
292 iso_pu_bacteria 2923519811 2923521484 600
293 iso_pu_bacteria 2990196909 2990198112 600
294 3300006946 Ga0079104_1000448 Ga0079104_100044841 601
295 3300009011 Ga0105251_10002907 Ga0105251_100029078 601
296 3300009036 Ga0105244_10002875 Ga0105244_100028756 601
297 3300014497 Ga0182008_10001594 Ga0182008_100015946 601
298 3300025728 Ga0207655_1000011 Ga0207655_1000011464 601
299 3300025735 Ga0207713_1002303 Ga0207713_10023039 601
300 3300027111 Ga0209281_1000008 Ga0209281_1000008205 601
301 3300046530 Ga0495654_0027023 Ga0495654_0027023_434_2263 601
302 3300046794 Ga0495589_0000002 Ga0495589_0000002_434623_436452 601
303 3300048920 Ga0496117_0018547 Ga0496117_0018547_3581_5410 601
304 iso_pu_bacteria 2919506607 2919507108 601
305 iso_pu_bacteria 3007315729 3007316703 601
306 3300046506 Ga0495583_0000131 Ga0495583_0000131_115485_117293 602
307 3300046530 Ga0495654_0000119 Ga0495654_0000119_10126_11934 602
308 3300048928 Ga0496125_0016151 Ga0496125_0016151_616_2424 602
309 iso_pu_bacteria 2506520007 2506577452 602
310 iso_pu_bacteria 2506520008 2506582590 602
311 iso_pu_bacteria 2654587920 2656278367 602
312 iso_pu_bacteria 2687453601 2689443930 602
313 iso_pu_bacteria 2858950400 2858953726 602
314 iso_pu_bacteria 2869551831 2869553305 602
315 iso_pu_bacteria 2891633521 2891636905 602
316 3300046501 Ga0495607_0033711 Ga0495607_0033711_578_2389 603
317 3300046507 Ga0495606_0000794 Ga0495606_0000794_28882_30693 603
318 3300046522 Ga0495643_0060568 Ga0495643_0060568_52_1863 603
319 3300046794 Ga0495589_0000763 Ga0495589_0000763_640_2451 603
320 3300047446 Ga0495679_001008 Ga0495679_001008_15012_16823 603
321 3300047472 Ga0495686_0025888 Ga0495686_0025888_1960_3771 603
322 3300048923 Ga0496120_0001680 Ga0496120_0001680_7877_9688 603
323 3300048926 Ga0496123_0026197 Ga0496123_0026197_1774_3585 603
324 3300048927 Ga0496124_0000338 Ga0496124_0000338_39984_41795 603
325 3300048928 Ga0496125_0000245 Ga0496125_0000245_33243_35054 603
326 3300048929 Ga0496126_0052322 Ga0496126_0052322_1562_3373 603
327 3300046506 Ga0495583_0001159 Ga0495583_0001159_11981_13795 604
328 3300009011 Ga0105251_10000058 Ga0105251_1000005859 605
329 3300009174 Ga0105241_10000004 Ga0105241_10000004590 605
330 3300017792 Ga0163161_10000001 Ga0163161_10000001161 605
331 3300025735 Ga0207713_1000026 Ga0207713_1000026196 605
332 3300025911 Ga0207654_10000006 Ga0207654_10000006608 605
333 3300027312 Ga0209371_1000412 Ga0209371_10004122 605
334 3300030500 Ga0268256_1004093 Ga0268256_10040932 605
335 3300042006 Ga0439432_022407 Ga0439432_022407_184_2055 605
336 3300046453 Ga0495627_000028 Ga0495627_000028_60360_62228 605
337 iso_pu_bacteria 2857542790 2857544336 605
338 3300009036 Ga0105244_10017125 Ga0105244_100171252 607
339 3300009092 Ga0105250_10002067 Ga0105250_100020672 607
340 3300046530 Ga0495654_0011570 Ga0495654_0011570_1091_2932 607
341 3300046542 Ga0495597_0001564 Ga0495597_0001564_9139_10980 607
342 3300046660 Ga0495625_0003804 Ga0495625_0003804_5307_7148 607
343 3300047320 Ga0495672_0000084 Ga0495672_0000084_113957_115798 607
344 3300047446 Ga0495679_000024 Ga0495679_000024_135191_137032 607
345 iso_pu_bacteria 2600255283 2601625053 607
346 iso_pu_bacteria 2904504865 2904508169 607
347 3300006051 Ga0075364_10003334 Ga0075364_100033345 608
348 3300042016 Ga0439463_000452 Ga0439463_000452_5068_6894 608
349 3300046515 Ga0495620_0002491 Ga0495620_0002491_3473_5299 608
350 3300046520 Ga0495637_0001643 Ga0495637_0001643_5101_6927 608
351 3300047469 Ga0495673_0000292 Ga0495673_0000292_5525_7351 608
352 3300047321 Ga0495676_0000002 Ga0495676_0000002_344774_346603 609
353 3300048920 Ga0496117_0000100 Ga0496117_0000100_112220_114052 609
354 3300048921 Ga0496118_0018950 Ga0496118_0018950_3406_5241 609
355 3300048924 Ga0496121_0093948 Ga0496121_0093948_149_1981 609
356 3300009092 Ga0105250_10000020 Ga0105250_10000020141 611
357 3300025711 Ga0207696_1000036 Ga0207696_1000036188 611
358 iso_pu_bacteria 2585427591 2585826557 611
359 iso_pu_bacteria 2585427592 2585832662 611
360 3300009036 Ga0105244_10000026 Ga0105244_1000002672 612
361 3300025728 Ga0207655_1000057 Ga0207655_1000057102 612
362 iso_pu_bacteria 2667528173 2671109221 612
363 iso_pu_bacteria 2904474040 2904477500 612
364 iso_pu_bacteria 2919150387 2919153791 612
365 iso_pu_bacteria 2927143783 2927147193 612
366 3300013102 Ga0157371_10000044 Ga0157371_1000004488 615
367 3300048920 Ga0496117_0016258 Ga0496117_0016258_3591_5438 615
368 3300048921 Ga0496118_0000454 Ga0496118_0000454_60594_62441 615
369 2162886007 SwRhRL2b_contig_285204 SwRhRL2b_0418.00000320 616
370 3300002737 JGI25162J39368_1000007 JGI25162J39368_1000007124 616
371 3300002771 JGI25163J39215_1000410 JGI25163J39215_10004104 616
372 3300002772 JGI25164J39214_1000010 JGI25164J39214_1000010252 616
373 3300002772 JGI25164J39214_1000016 JGI25164J39214_100001666 616
374 3300003751 Ga0055538_1000006 Ga0055538_1000006124 616
375 3300003752 Ga0055539_1000010 Ga0055539_1000010124 616
376 3300003756 Ga0055533_1000013 Ga0055533_1000013124 616
377 3300003759 Ga0055525_1000015 Ga0055525_1000015124 616
378 3300003841 Ga0055541_1000007 Ga0055541_1000007251 616
379 3300005289 Ga0065704_10000667 Ga0065704_1000066710 616
380 3300009092 Ga0105250_10000889 Ga0105250_100008898 616
381 3300013306 Ga0163162_10039659 Ga0163162_100396592 616
382 3300025207 Ga0209760_100034 Ga0209760_1000348 616
383 3300025224 Ga0209784_100022 Ga0209784_100022247 616
384 3300025225 Ga0209566_100021 Ga0209566_100021247 616
385 3300025226 Ga0209674_100038 Ga0209674_100038247 616
386 3300025230 Ga0209563_100042 Ga0209563_100042247 616
387 3300025231 Ga0207427_100027 Ga0207427_100027247 616
388 3300025233 Ga0209437_100049 Ga0209437_100049247 616
389 3300025253 Ga0209677_100025 Ga0209677_100025247 616
390 3300025261 Ga0209233_1005285 Ga0209233_10052854 616
391 3300025711 Ga0207696_1000952 Ga0207696_10009528 616
392 3300025728 Ga0207655_1009713 Ga0207655_10097136 616
393 3300042532 Ga0450893_0000327 Ga0450893_0000327_2036_3886 616
394 3300046471 Ga0495650_0000039 Ga0495650_0000039_283593_285443 616
395 3300046810 Ga0495660_0000023 Ga0495660_0000023_136749_138599 616
396 3300048907 Ga0496104_0000208 Ga0496104_0000208_33211_35061 616
397 3300048919 Ga0496116_0000112 Ga0496116_0000112_109474_111324 616
398 3300048923 Ga0496120_0004679 Ga0496120_0004679_7238_9088 616
399 3300048925 Ga0496122_0000067 Ga0496122_0000067_102132_103982 616
400 3300048926 Ga0496123_0000056 Ga0496123_0000056_127384_129234 616
401 3300048927 Ga0496124_0000362 Ga0496124_0000362_58196_60046 616
402 3300048928 Ga0496125_0000183 Ga0496125_0000183_80880_82730 616
403 3300048929 Ga0496126_0006344 Ga0496126_0006344_5650_7500 616

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21986

AH_C

Allophanate hydrolase C-terminal domain

520

642

0.98

PF01425

Amidase

Amidase

71

485

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cp8-assembly2.cif.gz_D structure of the amidase domain of allophanate hydrolase from pseudomonas sp strain adp 0.9576 16 454
5c5z-assembly1.cif.gz_B crystal structure analysis of c4763, a uropathogenic e. coli-specific protein 0.9478 484 607
4cp8-assembly2.cif.gz_D structure of the amidase domain of allophanate hydrolase from pseudomonas sp strain adp 0.9388 16 454
4gyr-assembly1.cif.gz_B granulibacter bethesdensis allophanate hydrolase apo 0.9281 16 470
5c5z-assembly1.cif.gz_B crystal structure analysis of c4763, a uropathogenic e. coli-specific protein 0.9048 484 607
ID Description Score Start End Superfamily
4cp8A00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.961 16 454 3.90.1300.10
4issB03 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.9528 484 609 3.10.490.10
5c5zB00 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.9403 484 607 3.10.490.10
4cp8A00 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.94 16 454 3.90.1300.10
4istB01 Alpha Beta;Alpha-Beta Complex;Amidase signature (AS) enzymes;Amidase signature (AS) domain 0.9283 1 473 3.90.1300.10
ID Description Score Start End GO Terms
AF-A0A074YUG5-F1-model_v4 Allophanate hydrolase C-terminal domain-containing protein 0.9882 486 608
AF-A0A4Q5WQT4-F1-model_v4 deleted 0.9859 83 451
AF-A0A377N6T3-F1-model_v4 Glutamyl-tRNA(Gln) amidotransferase subunit A (EC 6.3.5.-) 0.98 1 193 GO:0016740
GO:0016874
AF-A0A0K0STS0-F1-model_v4 Amidase 0.9791 484 610
AF-S6TR78-F1-model_v4 Allophanate hydrolase 0.9777 299 462 GO:0016787

Feature Viewer

pLDDT pTM Quality
91.39 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map