F435325

General Info

Members Datasets Scaffolds Average Seq Length
403 206 806 264

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100021566|Ga0070698_1000215663
Length 287
Sequence MLQAFVITLREGLEAFLIVAISLAYLRKSGRAALTTAVHWGIAVAALVSALGGYLLYHAANQEWLEGPLAMIAAVSVTWMVVHMWRTGRRMKSAIEVRLQSSSVRPGAAAFTGIFLFTLLMVSREGIETALLLMQLRETVHLVLGAAAGVLGAAGVAWLWSRYGHRVNLGLFFQATAIFLFVFVVQLVIQGGHEMAEQGFLPYSDLIHRKTESWGPDSAFGHLLTYLLVILPLAWVLLKGVFSRRPVFQPVLSEIALRQAQGERVEGPRVPAAWIADRDQPSPAYKR

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
136 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
137 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
138 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
139 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
140 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
141 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
142 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
143 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
144 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
145 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
150 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
151 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
152 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
166 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
169 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
170 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
175 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
184 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
204 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.73
Rhizosphere 97.27
Stem 0
Stem Tuber 0
Unclassified 27.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100021566 3300005471 Bacteria 6747
2 Ga0065712_10110792 3300005290 Bacteria 1829
3 Ga0065715_10156278 3300005293 Bacteria 1674
4 Ga0070676_10197962 3300005328 Bacteria 1315
5 Ga0070676_10469979 3300005328 Bacteria 888
6 Ga0070683_100019927 3300005329 Bacteria 5963
7 Ga0070690_100020121 3300005330 Unclassified 4062
8 Ga0070690_100133748 3300005330 Bacteria 1677
9 Ga0070670_100011254 3300005331 Bacteria 7648
10 Ga0070670_100533159 3300005331 Bacteria 1046
11 Ga0070666_10007954 3300005335 Bacteria 6555
12 Ga0070666_10049802 3300005335 Bacteria 2817
13 Ga0070680_100244508 3300005336 Bacteria 1517
14 Ga0070682_100096673 3300005337 Bacteria 1942
15 Ga0068868_100026392 3300005338 Bacteria 4427
16 Ga0068868_100032766 3300005338 Bacteria 3998
17 Ga0068868_100041404 3300005338 Bacteria 3589
18 Ga0068868_100074344 3300005338 Bacteria 2714
19 Ga0070661_100198710 3300005344 Bacteria 1531
20 Ga0070692_10067459 3300005345 Bacteria 1899
21 Ga0070692_10152029 3300005345 Bacteria 1319
22 Ga0070692_10175395 3300005345 Bacteria 1239
23 Ga0070671_100029769 3300005355 Bacteria 4504
24 Ga0070671_100342301 3300005355 Bacteria 1276
25 Ga0070674_100137926 3300005356 Bacteria 1827
26 Ga0070673_100015117 3300005364 Bacteria 5407
27 Ga0070673_100031231 3300005364 Bacteria 3995
28 Ga0070673_100073181 3300005364 Bacteria 2758
29 Ga0070673_100111220 3300005364 Bacteria 2272
30 Ga0070673_100640700 3300005364 Bacteria 972
31 Ga0070688_100024232 3300005365 Bacteria 3578
32 Ga0070688_100029675 3300005365 Unclassified 3277
33 Ga0070659_100026453 3300005366 Bacteria 4466
34 Ga0070667_100010894 3300005367 Bacteria 7521
35 Ga0070709_10024089 3300005434 Bacteria 3581
36 Ga0070709_10120962 3300005434 Unclassified 1774
37 Ga0070714_100264325 3300005435 Unclassified 1594
38 Ga0070713_100005709 3300005436 Bacteria 8543
39 Ga0070713_100069492 3300005436 Unclassified 2970
40 Ga0070701_10174539 3300005438 Bacteria 1254
41 Ga0070705_100000092 3300005440 Bacteria 50020
42 Ga0070705_100013854 3300005440 Bacteria 4133
43 Ga0070700_100206812 3300005441 Bacteria 1382
44 Ga0070694_100023579 3300005444 Bacteria 3960
45 Ga0070694_100034492 3300005444 Bacteria 3338
46 Ga0070708_100244742 3300005445 Bacteria 1684
47 Ga0070708_100349179 3300005445 Bacteria 1394
48 Ga0070678_100010586 3300005456 Bacteria 5644
49 Ga0070678_100198704 3300005456 Bacteria 1653
50 Ga0070662_100179986 3300005457 Unclassified 1666
51 Ga0070681_10001922 3300005458 Bacteria 18745
52 Ga0070681_10331198 3300005458 Bacteria 1432
53 Ga0068867_100077130 3300005459 Unclassified 2503
54 Ga0070685_10092043 3300005466 Unclassified 1837
55 Ga0070706_100028334 3300005467 Bacteria 5157
56 Ga0070706_100223511 3300005467 Unclassified 1757
57 Ga0070707_100064576 3300005468 Unclassified 3515
58 Ga0070707_100167282 3300005468 Bacteria 2143
59 Ga0070698_100013673 3300005471 Bacteria 8593
60 Ga0070698_100150472 3300005471 Bacteria 2275
61 Ga0070698_100586675 3300005471 Bacteria 1055
62 Ga0070699_100014499 3300005518 Bacteria 6777
63 Ga0070699_100031690 3300005518 Bacteria 4564
64 Ga0070699_100097729 3300005518 Unclassified 2572
65 Ga0070699_100528515 3300005518 Bacteria 1073
66 Ga0070679_100070093 3300005530 Bacteria 3498
67 Ga0070679_100230671 3300005530 Bacteria 1811
68 Ga0070684_100112334 3300005535 Unclassified 2444
69 Ga0070697_100029615 3300005536 Bacteria 4391
70 Ga0070697_100415888 3300005536 Unclassified 1168
71 Ga0070672_100006559 3300005543 Bacteria 7828
72 Ga0070672_100087789 3300005543 Bacteria 2503
73 Ga0070672_100263052 3300005543 Bacteria 1455
74 Ga0070686_100002486 3300005544 Bacteria 10150
75 Ga0070695_100000002 3300005545 Bacteria 128335
76 Ga0070695_100376038 3300005545 Unclassified 1071
77 Ga0070696_100000679 3300005546 Bacteria 21808
78 Ga0070696_100027288 3300005546 Bacteria 3889
79 Ga0070696_100061147 3300005546 Bacteria 2634
80 Ga0070665_100010183 3300005548 Bacteria 9510
81 Ga0070665_100015165 3300005548 Bacteria 7737
82 Ga0070704_100000924 3300005549 Bacteria 14800
83 Ga0070704_100034486 3300005549 Bacteria 3433
84 Ga0070704_100099168 3300005549 Bacteria 2190
85 Ga0070704_100229567 3300005549 Bacteria 1513
86 Ga0070664_100024399 3300005564 Bacteria 5001
87 Ga0068857_100460802 3300005577 Bacteria 1190
88 Ga0068854_100004254 3300005578 Bacteria 9013
89 Ga0070702_100008819 3300005615 Bacteria 4903
90 Ga0068852_100059295 3300005616 Unclassified 3319
91 Ga0068859_100121473 3300005617 Unclassified 2679
92 Ga0068859_100280772 3300005617 Bacteria 1758
93 Ga0068859_100283371 3300005617 Bacteria 1750
94 Ga0068859_100421083 3300005617 Bacteria 1432
95 Ga0068864_100006759 3300005618 Bacteria 9393
96 Ga0068864_100074911 3300005618 Unclassified 2954
97 Ga0068864_100133842 3300005618 Bacteria 2230
98 Ga0068861_100258504 3300005719 Bacteria 1490
99 Ga0068870_10142025 3300005840 Bacteria 1406
100 Ga0068870_10439478 3300005840 Bacteria 858
101 Ga0068863_100019777 3300005841 Bacteria 6440
102 Ga0068863_100482208 3300005841 Unclassified 1220
103 Ga0068858_100006178 3300005842 Bacteria 11683
104 Ga0068858_100010010 3300005842 Bacteria 9006
105 Ga0068858_100106058 3300005842 Bacteria 2623
106 Ga0068858_100183066 3300005842 Bacteria 1979
107 Ga0068860_100020582 3300005843 Bacteria 6391
108 Ga0068860_100105687 3300005843 Unclassified 2688
109 Ga0081455_10053981 3300005937 Bacteria 3429
110 Ga0081455_10062206 3300005937 Unclassified 3138
111 Ga0081539_10079116 3300005985 Bacteria 1733
112 Ga0070717_10029786 3300006028 Bacteria 4383
113 Ga0070715_10155331 3300006163 Bacteria 1125
114 Ga0097621_100005116 3300006237 Bacteria 9213
115 Ga0097621_100037195 3300006237 Unclassified 3898
116 Ga0097621_100070074 3300006237 Bacteria 2895
117 Ga0097621_100078460 3300006237 Bacteria 2743
118 Ga0097621_100230074 3300006237 Bacteria 1618
119 Ga0068871_100000337 3300006358 Bacteria 32470
120 Ga0068871_100012578 3300006358 Bacteria 6248
121 Ga0068871_100026225 3300006358 Bacteria 4546
122 Ga0068871_100038253 3300006358 Bacteria 3830
123 Ga0068871_100379339 3300006358 Unclassified 1256
124 Ga0075428_100001571 3300006844 Bacteria 24485
125 Ga0075428_100187666 3300006844 Bacteria 2236
126 Ga0075428_100406584 3300006844 Bacteria 1459
127 Ga0075433_10023335 3300006852 Bacteria 5206
128 Ga0075433_10068947 3300006852 Unclassified 3105
129 Ga0075434_100029986 3300006871 Bacteria 5355
130 Ga0075434_100054761 3300006871 Unclassified 3963
131 Ga0075434_100091586 3300006871 Bacteria 3042
132 Ga0075434_100099549 3300006871 Bacteria 2913
133 Ga0075434_100284059 3300006871 Bacteria 1674
134 Ga0075434_100493862 3300006871 Unclassified 1245
135 Ga0075429_100055066 3300006880 Bacteria 3461
136 Ga0068865_100145955 3300006881 Bacteria 1789
137 Ga0075436_100014816 3300006914 Bacteria 5342
138 Ga0075436_100015619 3300006914 Bacteria 5198
139 Ga0075436_100109925 3300006914 Unclassified 1923
140 Ga0075436_100229633 3300006914 Unclassified 1318
141 Ga0097620_100121477 3300006931 Unclassified 2679
142 Ga0097620_100280782 3300006931 Bacteria 1758
143 Ga0097620_100283379 3300006931 Bacteria 1750
144 Ga0097620_100421065 3300006931 Bacteria 1432
145 Ga0075435_100000538 3300007076 Bacteria 23197
146 Ga0075435_100000749 3300007076 Bacteria 20129
147 Ga0075435_100006222 3300007076 Bacteria 8424
148 Ga0075435_100015149 3300007076 Bacteria 5788
149 Ga0075435_100029955 3300007076 Bacteria 4276
150 Ga0075435_100038744 3300007076 Bacteria 3801
151 Ga0075435_100072173 3300007076 Unclassified 2820
152 Ga0075435_100116051 3300007076 Bacteria 2230
153 Ga0075435_100225963 3300007076 Bacteria 1590
154 Ga0105240_10026242 3300009093 Bacteria 7642
155 Ga0105240_10389388 3300009093 Unclassified 1572
156 Ga0111539_10328450 3300009094 Bacteria 1780
157 Ga0111539_10690825 3300009094 Unclassified 1188
158 Ga0105245_10022013 3300009098 Bacteria 5594
159 Ga0105245_10066504 3300009098 Unclassified 3263
160 Ga0105245_10383014 3300009098 Unclassified 1401
161 Ga0105247_10002709 3300009101 Bacteria 11878
162 Ga0114129_10030711 3300009147 Bacteria 7599
163 Ga0114129_10055981 3300009147 Bacteria 5526
164 Ga0114129_10247720 3300009147 Bacteria 2393
165 Ga0105243_10152988 3300009148 Bacteria 1981
166 Ga0105243_10325630 3300009148 Unclassified 1402
167 Ga0105241_10083107 3300009174 Unclassified 2512
168 Ga0105241_10513962 3300009174 Bacteria 1070
169 Ga0105242_10000939 3300009176 Bacteria 22726
170 Ga0105242_10078497 3300009176 Bacteria 2756
171 Ga0105242_10635409 3300009176 Unclassified 1036
172 Ga0105248_10003179 3300009177 Bacteria 18204
173 Ga0105248_10019205 3300009177 Bacteria 7561
174 Ga0105248_10145750 3300009177 Bacteria 2672
175 Ga0105248_10240957 3300009177 Unclassified 2036
176 Ga0105237_10731800 3300009545 Unclassified 996
177 Ga0157369_10251120 3300013105 Bacteria 1846
178 Ga0157374_10271888 3300013296 Bacteria 1671
179 Ga0157378_10012898 3300013297 Bacteria 7317
180 Ga0157378_10390265 3300013297 Bacteria 1369
181 Ga0163162_10059955 3300013306 Bacteria 3839
182 Ga0163162_10103123 3300013306 Bacteria 2946
183 Ga0163162_10131578 3300013306 Unclassified 2610
184 Ga0157372_10512918 3300013307 Unclassified 1398
185 Ga0157372_11171054 3300013307 Unclassified 889
186 Ga0157375_10023141 3300013308 Bacteria 5728
187 Ga0157375_10033165 3300013308 Bacteria 4904
188 Ga0157375_10138757 3300013308 Bacteria 2557
189 Ga0157375_10291186 3300013308 Unclassified 1796
190 Ga0163163_10007871 3300014325 Bacteria 9417
191 Ga0163163_10052899 3300014325 Bacteria 4007
192 Ga0163163_10632143 3300014325 Bacteria 1134
193 Ga0163163_10685533 3300014325 Bacteria 1088
194 Ga0157377_10048479 3300014745 Bacteria 2383
195 Ga0157379_10012221 3300014968 Bacteria 7500
196 Ga0157379_10029640 3300014968 Unclassified 4865
197 Ga0157379_10220904 3300014968 Unclassified 1717
198 Ga0157376_10007720 3300014969 Bacteria 7706
199 Ga0157376_10023104 3300014969 Bacteria 4861
200 Ga0157376_10046726 3300014969 Unclassified 3572
201 Ga0157376_10142373 3300014969 Bacteria 2153
202 Ga0157376_10200090 3300014969 Bacteria 1837
203 Ga0157376_10334660 3300014969 Bacteria 1444
204 Ga0207653_10090145 3300025885 Unclassified 1073
205 Ga0207680_10024474 3300025903 Bacteria 3314
206 Ga0207680_10028684 3300025903 Unclassified 3117
207 Ga0207680_10096794 3300025903 Unclassified 1889
208 Ga0207685_10073275 3300025905 Bacteria 1395
209 Ga0207685_10111471 3300025905 Bacteria 1186
210 Ga0207699_10347774 3300025906 Unclassified 1046
211 Ga0207645_10338497 3300025907 Bacteria 1005
212 Ga0207643_10010346 3300025908 Bacteria 5023
213 Ga0207684_10114666 3300025910 Bacteria 2308
214 Ga0207684_10560973 3300025910 Bacteria 977
215 Ga0207654_10078566 3300025911 Unclassified 1980
216 Ga0207707_10024555 3300025912 Bacteria 5275
217 Ga0207707_10339718 3300025912 Bacteria 1295
218 Ga0207695_10032127 3300025913 Bacteria 5748
219 Ga0207671_10422012 3300025914 Bacteria 1061
220 Ga0207660_10392801 3300025917 Bacteria 1116
221 Ga0207652_10181446 3300025921 Bacteria 1892
222 Ga0207652_10295170 3300025921 Bacteria 1463
223 Ga0207646_10141247 3300025922 Unclassified 2169
224 Ga0207646_10143195 3300025922 Bacteria 2154
225 Ga0207646_10245507 3300025922 Bacteria 1617
226 Ga0207650_10030480 3300025925 Bacteria 3886
227 Ga0207659_10185194 3300025926 Bacteria 1653
228 Ga0207687_10002729 3300025927 Bacteria 11955
229 Ga0207687_10027291 3300025927 Unclassified 3830
230 Ga0207644_10010732 3300025931 Bacteria 6041
231 Ga0207644_10549003 3300025931 Unclassified 956
232 Ga0207690_10025787 3300025932 Bacteria 3696
233 Ga0207706_10082866 3300025933 Bacteria 2819
234 Ga0207706_10228420 3300025933 Unclassified 1629
235 Ga0207706_10502504 3300025933 Bacteria 1046
236 Ga0207686_10018931 3300025934 Bacteria 3906
237 Ga0207709_10172358 3300025935 Bacteria 1520
238 Ga0207709_10220741 3300025935 Unclassified 1367
239 Ga0207670_10174855 3300025936 Bacteria 1613
240 Ga0207670_10357273 3300025936 Bacteria 1158
241 Ga0207704_10353891 3300025938 Bacteria 1144
242 Ga0207691_10013435 3300025940 Bacteria 7839
243 Ga0207691_10097915 3300025940 Bacteria 2621
244 Ga0207691_10321341 3300025940 Bacteria 1327
245 Ga0207711_10011246 3300025941 Bacteria 7436
246 Ga0207711_10039751 3300025941 Bacteria 4001
247 Ga0207711_10063445 3300025941 Bacteria 3189
248 Ga0207711_10070789 3300025941 Unclassified 3025
249 Ga0207711_10627287 3300025941 Unclassified 1003
250 Ga0207689_10175264 3300025942 Unclassified 1768
251 Ga0207661_10018515 3300025944 Bacteria 5175
252 Ga0207679_10244426 3300025945 Unclassified 1522
253 Ga0207651_10020883 3300025960 Bacteria 3965
254 Ga0207651_10021759 3300025960 Bacteria 3905
255 Ga0207651_10091617 3300025960 Bacteria 2226
256 Ga0207651_10363114 3300025960 Unclassified 1223
257 Ga0207640_10037118 3300025981 Unclassified 3063
258 Ga0207640_10066534 3300025981 Bacteria 2408
259 Ga0207658_10057835 3300025986 Bacteria 2883
260 Ga0207677_10010948 3300026023 Bacteria 5152
261 Ga0207677_10121213 3300026023 Bacteria 1968
262 Ga0207677_10140507 3300026023 Bacteria 1848
263 Ga0207677_10159618 3300026023 Bacteria 1750
264 Ga0207703_10016304 3300026035 Bacteria 5792
265 Ga0207703_10082774 3300026035 Bacteria 2679
266 Ga0207703_10116314 3300026035 Bacteria 2289
267 Ga0207703_10154110 3300026035 Bacteria 2006
268 Ga0207703_10243112 3300026035 Bacteria 1619
269 Ga0207641_10010251 3300026088 Bacteria 7706
270 Ga0207641_10174992 3300026088 Unclassified 1962
271 Ga0207648_10048983 3300026089 Unclassified 3699
272 Ga0207676_10009672 3300026095 Bacteria 6857
273 Ga0207676_10071994 3300026095 Bacteria 2777
274 Ga0207676_10080436 3300026095 Unclassified 2645
275 Ga0207676_10462386 3300026095 Bacteria 1198
276 Ga0207674_10069972 3300026116 Bacteria 3528
277 Ga0207674_10182979 3300026116 Unclassified 2046
278 Ga0207675_100228406 3300026118 Bacteria 1795
279 Ga0207675_100965543 3300026118 Bacteria 870
280 Ga0207683_10006992 3300026121 Bacteria 9675
281 Ga0207683_10099972 3300026121 Bacteria 2589
282 Ga0207698_10872549 3300026142 Bacteria 906
283 Ga0268266_10004122 3300028379 Bacteria 14041
284 Ga0268266_10010038 3300028379 Bacteria 8304
285 Ga0268266_10224112 3300028379 Bacteria 1729
286 Ga0268265_10212535 3300028380 Bacteria 1687
287 Ga0268264_10068390 3300028381 Unclassified 3001
288 Ga0268264_10121030 3300028381 Bacteria 2306
289 Ga0268264_10201240 3300028381 Unclassified 1822
290 Ga0265332_10028965 3300031238 Bacteria 2422
291 Ga0265314_10144269 3300031711 Bacteria 1468
292 Ga0373930_0005250 3300034816 Unclassified 2146
293 Ga0373950_0000159 3300034818 Bacteria 9864
294 Ga0373938_0014006 3300034957 Unclassified 1532
295 Ga0373928_0002211 3300035084 Unclassified 3786
296 Ga0373951_0002807 3300035091 Bacteria 4340
297 Ga0373952_0008036 3300035092 Unclassified 1992
298 Ga0373932_0034387 3300035112 Unclassified 1427
299 Ga0373939_0030330 3300035114 Unclassified 1554
300 Ga0373960_0015885 3300035121 Unclassified 1928
301 Ga0373943_0005334 3300035170 Bacteria 5779
302 Ga0373946_0013793 3300035171 Unclassified 3042
303 Ga0373955_0017868 3300035172 Bacteria 3516
304 Ga0373942_0000705 3300035207 Bacteria 9274
305 Ga0373961_0005082 3300035241 Unclassified 3164
306 Ga0373962_0001142 3300035242 Bacteria 6198
307 Ga0373962_0013962 3300035242 Bacteria 2042
308 Ga0373924_0005236 3300035410 Unclassified 4582
309 Ga0373924_0050200 3300035410 Bacteria 1728
310 Ga0373933_0174216 3300035724 Bacteria 1370
311 Ga0373947_0024759 3300035725 Unclassified 3500
312 Ga0373937_0025822 3300036401 Bacteria 5305
313 Ga0373937_0058923 3300036401 Bacteria 3528
314 Ga0373937_0150516 3300036401 Bacteria 2180
315 Ga0373925_0019711 3300037068 Unclassified 4909
316 Ga0451576_0010034 3300045051 Bacteria 10906
317 Ga0451576_0018241 3300045051 Bacteria 7696
318 Ga0466967_0138029 3300045976 Unclassified 2269
319 Ga0495592_0119443 3300046454 Unclassified 1856
320 Ga0495653_0144957 3300046463 Unclassified 1666
321 Ga0495580_0030367 3300046472 Unclassified 3914
322 Ga0495618_0070566 3300046514 Unclassified 2222
323 Ga0495628_0096685 3300046516 Unclassified 2281
324 Ga0495628_0174699 3300046516 Bacteria 1628
325 Ga0495630_0010100 3300046517 Bacteria 6803
326 Ga0495663_0079120 3300046525 Unclassified 1057
327 Ga0495642_0005444 3300046528 Bacteria 4890
328 Ga0495652_0054967 3300046529 Unclassified 3388
329 Ga0495587_0049081 3300046536 Unclassified 2499
330 Ga0495609_0041994 3300046538 Bacteria 2054
331 Ga0495621_0040840 3300046539 Bacteria 1627
332 Ga0495621_0043911 3300046539 Unclassified 1578
333 Ga0495645_0012759 3300046543 Bacteria 5929
334 Ga0495634_0036096 3300046642 Unclassified 3382
335 Ga0495635_0108502 3300046663 Bacteria 1897
336 Ga0495659_0039462 3300046664 Bacteria 1679
337 Ga0495659_0057696 3300046664 Bacteria 1427
338 Ga0495623_0215355 3300046679 Unclassified 1097
339 Ga0495658_0028233 3300046683 Bacteria 3027
340 Ga0495669_0119914 3300046684 Bacteria 1232
341 Ga0495669_0134174 3300046684 Unclassified 1167
342 Ga0495613_0000927 3300046689 Bacteria 22499
343 Ga0495670_0115058 3300046691 Bacteria 1394
344 Ga0495604_0059171 3300047317 Unclassified 2938
345 Ga0495636_0113570 3300047318 Unclassified 1194
346 Ga0495636_0180204 3300047318 Archaea 958
347 Ga0495674_0005735 3300047319 Bacteria 11901
348 Ga0495677_0102927 3300047445 Unclassified 1082
349 Ga0495685_089695 3300047447 Archaea 1020
350 Ga0495684_0000048 3300047471 Bacteria 89243
351 Ga0495684_0110570 3300047471 Unclassified 2074
352 Ga0496104_0234249 3300048907 Bacteria 1748
353 Ga0496105_0148863 3300048908 Bacteria 1925
354 Ga0496107_0087042 3300048910 Unclassified 2281
355 Ga0496108_0016755 3300048911 Bacteria 5987
356 Ga0496108_0029582 3300048911 Bacteria 4538
357 Ga0496110_0064155 3300048913 Bacteria 3246
358 Ga0496112_0001090 3300048915 Bacteria 20076
359 Ga0496113_0188621 3300048916 Unclassified 1636
360 Ga0496113_0213467 3300048916 Bacteria 1537
361 Ga0496114_0008820 3300048917 Bacteria 7994
362 Ga0496114_0144213 3300048917 Bacteria 2064
363 Ga0501034_0094105 3300049571 Bacteria 2993
364 Ga0501080_0508642 3300049742 Bacteria 1076
365 nmdc:mga05p37_188808_c1 3300050507 Unclassified 2503
366 nmdc:mga05p37_31000_c1 3300050507 Bacteria 6529
367 nmdc:mga05p37_33748_c1 3300050507 Bacteria 6268
368 nmdc:mga05p37_592383_c1 3300050507 Bacteria 1253
369 nmdc:mga05p37_6031_c1 3300050507 Bacteria 14275
370 nmdc:mga05p37_800_c1 3300050507 Bacteria 35071
371 nmdc:mga09592_184685_c1 3300050508 Bacteria 1804
372 nmdc:mga09592_866027_c1 3300050508 Bacteria 761
373 nmdc:mga08y16_580254_c1 3300050511 Unclassified 1132
374 nmdc:mga08y16_89876_c1 3300050511 Unclassified 3201
375 nmdc:mga0n895_13022_c1 3300050512 Bacteria 7482
376 nmdc:mga0n895_244302_c1 3300050512 Unclassified 1822
377 nmdc:mga0n895_401_c1 3300050512 Bacteria 29147
378 nmdc:mga0n895_417413_c1 3300050512 Unclassified 1357
379 nmdc:mga0n895_504262_c1 3300050512 Unclassified 1219
380 nmdc:mga0n895_555822_c1 3300050512 Bacteria 1153
381 nmdc:mga0n895_859_c1 3300050512 Bacteria 21838
382 nmdc:mga0n895_934701_c1 3300050512 Unclassified 851
383 nmdc:mga0n895_98922_c1 3300050512 Bacteria 2925
384 nmdc:mga0rr50_109_c1 3300050513 Bacteria 46163
385 nmdc:mga0rr50_190388_c1 3300050513 Unclassified 1681
386 nmdc:mga0rr50_24331_c1 3300050513 Bacteria 4193
387 nmdc:mga0rr50_31279_c1 3300050513 Bacteria 3778
388 nmdc:mga0rr50_403696_c1 3300050513 Unclassified 1155
389 nmdc:mga0rr50_63790_c1 3300050513 Bacteria 2783
390 nmdc:mga0rr50_8046_c1 3300050513 Bacteria 6540
391 nmdc:mga08x19_14652_c1 3300050514 Bacteria 4760
392 nmdc:mga08x19_224_c1 3300050514 Bacteria 43344
393 nmdc:mga08x19_257729_c1 3300050514 Unclassified 1205
394 nmdc:mga08x19_283090_c1 3300050514 Bacteria 1149
395 nmdc:mga08x19_42755_c1 3300050514 Unclassified 2890
396 nmdc:mga08x19_9036_c1 3300050514 Bacteria 5950
397 nmdc:mga0a205_101590_c1 3300050515 Bacteria 2774
398 nmdc:mga0a205_16322_c1 3300050515 Bacteria 6953
399 nmdc:mga0a205_394220_c1 3300050515 Unclassified 1248
400 Ga0495601_0009781 3300053077 Bacteria 5672
401 Ga0495595_0047141 3300053084 Bacteria 1987
402 Ga0495619_0001582 3300053085 Bacteria 14969
403 Ga0501084_0714114 3300054114 Bacteria 845
404 Ga0070698_100021566
405 Ga0065712_10110792
406 Ga0065715_10156278
407 Ga0070676_10197962
408 Ga0070676_10469979
409 Ga0070683_100019927
410 Ga0070690_100020121
411 Ga0070690_100133748
412 Ga0070670_100011254
413 Ga0070670_100533159
414 Ga0070666_10007954
415 Ga0070666_10049802
416 Ga0070680_100244508
417 Ga0070682_100096673
418 Ga0068868_100026392
419 Ga0068868_100032766
420 Ga0068868_100041404
421 Ga0068868_100074344
422 Ga0070661_100198710
423 Ga0070692_10067459
424 Ga0070692_10152029
425 Ga0070692_10175395
426 Ga0070671_100029769
427 Ga0070671_100342301
428 Ga0070674_100137926
429 Ga0070673_100015117
430 Ga0070673_100031231
431 Ga0070673_100073181
432 Ga0070673_100111220
433 Ga0070673_100640700
434 Ga0070688_100024232
435 Ga0070688_100029675
436 Ga0070659_100026453
437 Ga0070667_100010894
438 Ga0070709_10024089
439 Ga0070709_10120962
440 Ga0070714_100264325
441 Ga0070713_100005709
442 Ga0070713_100069492
443 Ga0070701_10174539
444 Ga0070705_100000092
445 Ga0070705_100013854
446 Ga0070700_100206812
447 Ga0070694_100023579
448 Ga0070694_100034492
449 Ga0070708_100244742
450 Ga0070708_100349179
451 Ga0070678_100010586
452 Ga0070678_100198704
453 Ga0070662_100179986
454 Ga0070681_10001922
455 Ga0070681_10331198
456 Ga0068867_100077130
457 Ga0070685_10092043
458 Ga0070706_100028334
459 Ga0070706_100223511
460 Ga0070707_100064576
461 Ga0070707_100167282
462 Ga0070698_100013673
463 Ga0070698_100150472
464 Ga0070698_100586675
465 Ga0070699_100014499
466 Ga0070699_100031690
467 Ga0070699_100097729
468 Ga0070699_100528515
469 Ga0070679_100070093
470 Ga0070679_100230671
471 Ga0070684_100112334
472 Ga0070697_100029615
473 Ga0070697_100415888
474 Ga0070672_100006559
475 Ga0070672_100087789
476 Ga0070672_100263052
477 Ga0070686_100002486
478 Ga0070695_100000002
479 Ga0070695_100376038
480 Ga0070696_100000679
481 Ga0070696_100027288
482 Ga0070696_100061147
483 Ga0070665_100010183
484 Ga0070665_100015165
485 Ga0070704_100000924
486 Ga0070704_100034486
487 Ga0070704_100099168
488 Ga0070704_100229567
489 Ga0070664_100024399
490 Ga0068857_100460802
491 Ga0068854_100004254
492 Ga0070702_100008819
493 Ga0068852_100059295
494 Ga0068859_100121473
495 Ga0068859_100280772
496 Ga0068859_100283371
497 Ga0068859_100421083
498 Ga0068864_100006759
499 Ga0068864_100074911
500 Ga0068864_100133842
501 Ga0068861_100258504
502 Ga0068870_10142025
503 Ga0068870_10439478
504 Ga0068863_100019777
505 Ga0068863_100482208
506 Ga0068858_100006178
507 Ga0068858_100010010
508 Ga0068858_100106058
509 Ga0068858_100183066
510 Ga0068860_100020582
511 Ga0068860_100105687
512 Ga0081455_10053981
513 Ga0081455_10062206
514 Ga0081539_10079116
515 Ga0070717_10029786
516 Ga0070715_10155331
517 Ga0097621_100005116
518 Ga0097621_100037195
519 Ga0097621_100070074
520 Ga0097621_100078460
521 Ga0097621_100230074
522 Ga0068871_100000337
523 Ga0068871_100012578
524 Ga0068871_100026225
525 Ga0068871_100038253
526 Ga0068871_100379339
527 Ga0075428_100001571
528 Ga0075428_100187666
529 Ga0075428_100406584
530 Ga0075433_10023335
531 Ga0075433_10068947
532 Ga0075434_100029986
533 Ga0075434_100054761
534 Ga0075434_100091586
535 Ga0075434_100099549
536 Ga0075434_100284059
537 Ga0075434_100493862
538 Ga0075429_100055066
539 Ga0068865_100145955
540 Ga0075436_100014816
541 Ga0075436_100015619
542 Ga0075436_100109925
543 Ga0075436_100229633
544 Ga0097620_100121477
545 Ga0097620_100280782
546 Ga0097620_100283379
547 Ga0097620_100421065
548 Ga0075435_100000538
549 Ga0075435_100000749
550 Ga0075435_100006222
551 Ga0075435_100015149
552 Ga0075435_100029955
553 Ga0075435_100038744
554 Ga0075435_100072173
555 Ga0075435_100116051
556 Ga0075435_100225963
557 Ga0105240_10026242
558 Ga0105240_10389388
559 Ga0111539_10328450
560 Ga0111539_10690825
561 Ga0105245_10022013
562 Ga0105245_10066504
563 Ga0105245_10383014
564 Ga0105247_10002709
565 Ga0114129_10030711
566 Ga0114129_10055981
567 Ga0114129_10247720
568 Ga0105243_10152988
569 Ga0105243_10325630
570 Ga0105241_10083107
571 Ga0105241_10513962
572 Ga0105242_10000939
573 Ga0105242_10078497
574 Ga0105242_10635409
575 Ga0105248_10003179
576 Ga0105248_10019205
577 Ga0105248_10145750
578 Ga0105248_10240957
579 Ga0105237_10731800
580 Ga0157369_10251120
581 Ga0157374_10271888
582 Ga0157378_10012898
583 Ga0157378_10390265
584 Ga0163162_10059955
585 Ga0163162_10103123
586 Ga0163162_10131578
587 Ga0157372_10512918
588 Ga0157372_11171054
589 Ga0157375_10023141
590 Ga0157375_10033165
591 Ga0157375_10138757
592 Ga0157375_10291186
593 Ga0163163_10007871
594 Ga0163163_10052899
595 Ga0163163_10632143
596 Ga0163163_10685533
597 Ga0157377_10048479
598 Ga0157379_10012221
599 Ga0157379_10029640
600 Ga0157379_10220904
601 Ga0157376_10007720
602 Ga0157376_10023104
603 Ga0157376_10046726
604 Ga0157376_10142373
605 Ga0157376_10200090
606 Ga0157376_10334660
607 Ga0207653_10090145
608 Ga0207680_10024474
609 Ga0207680_10028684
610 Ga0207680_10096794
611 Ga0207685_10073275
612 Ga0207685_10111471
613 Ga0207699_10347774
614 Ga0207645_10338497
615 Ga0207643_10010346
616 Ga0207684_10114666
617 Ga0207684_10560973
618 Ga0207654_10078566
619 Ga0207707_10024555
620 Ga0207707_10339718
621 Ga0207695_10032127
622 Ga0207671_10422012
623 Ga0207660_10392801
624 Ga0207652_10181446
625 Ga0207652_10295170
626 Ga0207646_10141247
627 Ga0207646_10143195
628 Ga0207646_10245507
629 Ga0207650_10030480
630 Ga0207659_10185194
631 Ga0207687_10002729
632 Ga0207687_10027291
633 Ga0207644_10010732
634 Ga0207644_10549003
635 Ga0207690_10025787
636 Ga0207706_10082866
637 Ga0207706_10228420
638 Ga0207706_10502504
639 Ga0207686_10018931
640 Ga0207709_10172358
641 Ga0207709_10220741
642 Ga0207670_10174855
643 Ga0207670_10357273
644 Ga0207704_10353891
645 Ga0207691_10013435
646 Ga0207691_10097915
647 Ga0207691_10321341
648 Ga0207711_10011246
649 Ga0207711_10039751
650 Ga0207711_10063445
651 Ga0207711_10070789
652 Ga0207711_10627287
653 Ga0207689_10175264
654 Ga0207661_10018515
655 Ga0207679_10244426
656 Ga0207651_10020883
657 Ga0207651_10021759
658 Ga0207651_10091617
659 Ga0207651_10363114
660 Ga0207640_10037118
661 Ga0207640_10066534
662 Ga0207658_10057835
663 Ga0207677_10010948
664 Ga0207677_10121213
665 Ga0207677_10140507
666 Ga0207677_10159618
667 Ga0207703_10016304
668 Ga0207703_10082774
669 Ga0207703_10116314
670 Ga0207703_10154110
671 Ga0207703_10243112
672 Ga0207641_10010251
673 Ga0207641_10174992
674 Ga0207648_10048983
675 Ga0207676_10009672
676 Ga0207676_10071994
677 Ga0207676_10080436
678 Ga0207676_10462386
679 Ga0207674_10069972
680 Ga0207674_10182979
681 Ga0207675_100228406
682 Ga0207675_100965543
683 Ga0207683_10006992
684 Ga0207683_10099972
685 Ga0207698_10872549
686 Ga0268266_10004122
687 Ga0268266_10010038
688 Ga0268266_10224112
689 Ga0268265_10212535
690 Ga0268264_10068390
691 Ga0268264_10121030
692 Ga0268264_10201240
693 Ga0265332_10028965
694 Ga0265314_10144269
695 Ga0373930_0005250
696 Ga0373950_0000159
697 Ga0373938_0014006
698 Ga0373928_0002211
699 Ga0373951_0002807
700 Ga0373952_0008036
701 Ga0373932_0034387
702 Ga0373939_0030330
703 Ga0373960_0015885
704 Ga0373943_0005334
705 Ga0373946_0013793
706 Ga0373955_0017868
707 Ga0373942_0000705
708 Ga0373961_0005082
709 Ga0373962_0001142
710 Ga0373962_0013962
711 Ga0373924_0005236
712 Ga0373924_0050200
713 Ga0373933_0174216
714 Ga0373947_0024759
715 Ga0373937_0025822
716 Ga0373937_0058923
717 Ga0373937_0150516
718 Ga0373925_0019711
719 Ga0451576_0010034
720 Ga0451576_0018241
721 Ga0466967_0138029
722 Ga0495592_0119443
723 Ga0495653_0144957
724 Ga0495580_0030367
725 Ga0495618_0070566
726 Ga0495628_0096685
727 Ga0495628_0174699
728 Ga0495630_0010100
729 Ga0495663_0079120
730 Ga0495642_0005444
731 Ga0495652_0054967
732 Ga0495587_0049081
733 Ga0495609_0041994
734 Ga0495621_0040840
735 Ga0495621_0043911
736 Ga0495645_0012759
737 Ga0495634_0036096
738 Ga0495635_0108502
739 Ga0495659_0039462
740 Ga0495659_0057696
741 Ga0495623_0215355
742 Ga0495658_0028233
743 Ga0495669_0119914
744 Ga0495669_0134174
745 Ga0495613_0000927
746 Ga0495670_0115058
747 Ga0495604_0059171
748 Ga0495636_0113570
749 Ga0495636_0180204
750 Ga0495674_0005735
751 Ga0495677_0102927
752 Ga0495685_089695
753 Ga0495684_0000048
754 Ga0495684_0110570
755 Ga0496104_0234249
756 Ga0496105_0148863
757 Ga0496107_0087042
758 Ga0496108_0016755
759 Ga0496108_0029582
760 Ga0496110_0064155
761 Ga0496112_0001090
762 Ga0496113_0188621
763 Ga0496113_0213467
764 Ga0496114_0008820
765 Ga0496114_0144213
766 Ga0501034_0094105
767 Ga0501080_0508642
768 nmdc:mga05p37_188808_c1
769 nmdc:mga05p37_31000_c1
770 nmdc:mga05p37_33748_c1
771 nmdc:mga05p37_592383_c1
772 nmdc:mga05p37_6031_c1
773 nmdc:mga05p37_800_c1
774 nmdc:mga09592_184685_c1
775 nmdc:mga09592_866027_c1
776 nmdc:mga08y16_580254_c1
777 nmdc:mga08y16_89876_c1
778 nmdc:mga0n895_13022_c1
779 nmdc:mga0n895_244302_c1
780 nmdc:mga0n895_401_c1
781 nmdc:mga0n895_417413_c1
782 nmdc:mga0n895_504262_c1
783 nmdc:mga0n895_555822_c1
784 nmdc:mga0n895_859_c1
785 nmdc:mga0n895_934701_c1
786 nmdc:mga0n895_98922_c1
787 nmdc:mga0rr50_109_c1
788 nmdc:mga0rr50_190388_c1
789 nmdc:mga0rr50_24331_c1
790 nmdc:mga0rr50_31279_c1
791 nmdc:mga0rr50_403696_c1
792 nmdc:mga0rr50_63790_c1
793 nmdc:mga0rr50_8046_c1
794 nmdc:mga08x19_14652_c1
795 nmdc:mga08x19_224_c1
796 nmdc:mga08x19_257729_c1
797 nmdc:mga08x19_283090_c1
798 nmdc:mga08x19_42755_c1
799 nmdc:mga08x19_9036_c1
800 nmdc:mga0a205_101590_c1
801 nmdc:mga0a205_16322_c1
802 nmdc:mga0a205_394220_c1
803 Ga0495601_0009781
804 Ga0495595_0047141
805 Ga0495619_0001582
806 Ga0501084_0714114

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03239

FTR1

Iron permease FTR1 family

1

229

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ob6-assembly2.cif.gz_B human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.4837 4 213
6ob6-assembly1.cif.gz_A human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.463 4 213
8jtc-assembly1.cif.gz_A human vmat2 complex with reserpine 0.4276 4 202
6ob6-assembly2.cif.gz_B human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.3926 4 213
6ob6-assembly1.cif.gz_A human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.381 4 213
ID Description Score Start End Superfamily
af_A0A0P0XML3_2_199_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5605 1 162 1.20.1250.20
af_P9WJX3_18_194_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5601 7 212 1.20.1250.20
af_Q55CH3_10_188_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5527 4 185 1.20.1250.20
af_C0RSI9_6_184_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5519 4 238 1.20.1250.20
af_Q54G39_12_190_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5476 5 185 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2P5L9N7-F1-model_v4 Iron permease FTR1 0.8298 1 244 GO:0015093
GO:0033573
GO:0046872
GO:0051537
AF-A0A1F2Z0S7-F1-model_v4 Iron permease FTR1 0.8217 1 244 GO:0015093
GO:0033573
AF-A0A2H5VLP0-F1-model_v4 Ferrous iron permease EfeU 0.7978 1 244 GO:0015093
GO:0033573
AF-A0A1F2Z0S7-F1-model_v4 Iron permease FTR1 0.7825 1 244 GO:0015093
GO:0033573
AF-A0A2V7YWK9-F1-model_v4 Iron permease 0.7814 3 244 GO:0015093
GO:0033573

Map