F435233

General Info

Members Datasets Scaffolds Average Seq Length
402 194 804 314

Family's Representative Sequence

Representative Sequence 3300050513|nmdc:mga0rr50_224255_c1|nmdc:mga0rr50_224255_c1_353_1381
Length 342
Sequence MAGLQAVANQPRSIRHVSKPAVLVTRKLPSSVLDKLRATADVDVYAGAAAIPAAELVARVADKDALVSLPADAVDRAVIDAAPKLKVIANVAVAFDNIDVAYAASRGIAVTNTPDVLTESVADFTWALILAITRRLPEGERLVRRGEWKGSTFDLLLGSEVRGKQLGLVGVGRVGRAVAARAATFGMTVAYSSRRDVDLPAALPMSLDRLLLTSDVVSLHVPLTSDTRHLIDKRALTRMKRSAYLVNTSCGPVIDEEALAWALQQHLLAGAALDVYEHEPAVHRDLLKLENVLLVPHLASATTDTRTAMADLAAANVLAVLAGRPPVTPVPAPLTRRGNLES

Samples

Sample ID Description Type Environment
1 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
131 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
132 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
133 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
134 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
136 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
137 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
141 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
145 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
146 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
194 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.98
Rhizosphere 95.77
Stem 0
Stem Tuber 0
Unclassified 9.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0rr50_224255_c1 3300050513 Bacteria 1553
2 Ga0065712_10078676 3300005290 Bacteria 3314
3 Ga0070658_10196252 3300005327 Unclassified 1702
4 Ga0070676_10005258 3300005328 Bacteria 6882
5 Ga0070676_10070181 3300005328 Unclassified 2101
6 Ga0070683_100202065 3300005329 Unclassified 1887
7 Ga0070690_100003042 3300005330 Bacteria 9103
8 Ga0070690_100161888 3300005330 Bacteria 1534
9 Ga0070670_100190205 3300005331 Archaea 1783
10 Ga0070670_100322098 3300005331 Unclassified 1354
11 Ga0070677_10024842 3300005333 Bacteria 2232
12 Ga0068869_100286919 3300005334 Bacteria 1325
13 Ga0070666_10009409 3300005335 Bacteria 6090
14 Ga0070666_10352541 3300005335 Bacteria 1053
15 Ga0070680_100255107 3300005336 Unclassified 1483
16 Ga0070682_100138672 3300005337 Bacteria 1655
17 Ga0068868_100097604 3300005338 Bacteria 2375
18 Ga0068868_100300804 3300005338 Bacteria 1363
19 Ga0070689_100362817 3300005340 Bacteria 1217
20 Ga0070687_100013322 3300005343 Bacteria 3662
21 Ga0070687_100176784 3300005343 Bacteria 1275
22 Ga0070692_10106753 3300005345 Bacteria 1543
23 Ga0070669_100004492 3300005353 Bacteria 10060
24 Ga0070669_100037369 3300005353 Bacteria 3522
25 Ga0070671_100375129 3300005355 Unclassified 1215
26 Ga0070674_100003729 3300005356 Bacteria 8591
27 Ga0070674_100101446 3300005356 Bacteria 2098
28 Ga0070688_100003218 3300005365 Bacteria 8369
29 Ga0070659_100107585 3300005366 Unclassified 2249
30 Ga0070667_100035342 3300005367 Bacteria 4185
31 Ga0070714_100004449 3300005435 Bacteria 10556
32 Ga0070701_10006295 3300005438 Bacteria 4985
33 Ga0070705_100006282 3300005440 Bacteria 5821
34 Ga0070705_100017487 3300005440 Bacteria 3743
35 Ga0070700_100001692 3300005441 Bacteria 11067
36 Ga0070694_100010375 3300005444 Bacteria 5745
37 Ga0070694_100139357 3300005444 Bacteria 1760
38 Ga0070681_10078114 3300005458 Bacteria 3267
39 Ga0070681_10353853 3300005458 Bacteria 1379
40 Ga0068867_100005839 3300005459 Bacteria 8731
41 Ga0068867_100019685 3300005459 Bacteria 4808
42 Ga0068867_100072647 3300005459 Unclassified 2575
43 Ga0070685_10140906 3300005466 Archaea 1518
44 Ga0070707_100042572 3300005468 Bacteria 4348
45 Ga0070698_100060327 3300005471 Bacteria 3828
46 Ga0070699_100008796 3300005518 Bacteria 8751
47 Ga0070699_100273284 3300005518 Bacteria 1513
48 Ga0070684_100121908 3300005535 Bacteria 2346
49 Ga0070697_100054056 3300005536 Bacteria 3264
50 Ga0070697_100390089 3300005536 Bacteria 1207
51 Ga0070672_100086718 3300005543 Bacteria 2518
52 Ga0070686_100000716 3300005544 Bacteria 19297
53 Ga0070686_100047176 3300005544 Bacteria 2723
54 Ga0070686_100156458 3300005544 Bacteria 1601
55 Ga0070695_100003718 3300005545 Bacteria 8895
56 Ga0070665_100003124 3300005548 Bacteria 17837
57 Ga0070665_100006541 3300005548 Bacteria 11841
58 Ga0070665_100254994 3300005548 Bacteria 1755
59 Ga0070665_100279906 3300005548 Unclassified 1670
60 Ga0070704_100026555 3300005549 Bacteria 3828
61 Ga0068855_100016172 3300005563 Bacteria 8970
62 Ga0070664_100284126 3300005564 Bacteria 1493
63 Ga0068857_100273065 3300005577 Unclassified 1554
64 Ga0068854_100014449 3300005578 Bacteria 5205
65 Ga0068854_100018723 3300005578 Bacteria 4654
66 Ga0068856_100057737 3300005614 Bacteria 3832
67 Ga0068856_100070083 3300005614 Bacteria 3468
68 Ga0070702_100002183 3300005615 Bacteria 8337
69 Ga0068852_100126768 3300005616 Bacteria 2345
70 Ga0068859_100202717 3300005617 Bacteria 2069
71 Ga0068859_100256590 3300005617 Bacteria 1839
72 Ga0068859_100299005 3300005617 Bacteria 1703
73 Ga0068864_100008151 3300005618 Bacteria 8641
74 Ga0068861_100072105 3300005719 Bacteria 2679
75 Ga0068861_100087402 3300005719 Bacteria 2453
76 Ga0068851_10118928 3300005834 Bacteria 1418
77 Ga0068863_100002234 3300005841 Bacteria 19218
78 Ga0068863_100120412 3300005841 Bacteria 2502
79 Ga0068863_100255534 3300005841 Unclassified 1693
80 Ga0068863_100289230 3300005841 Unclassified 1589
81 Ga0068858_100001888 3300005842 Bacteria 21404
82 Ga0068858_100039674 3300005842 Bacteria 4365
83 Ga0068858_100123034 3300005842 Bacteria 2428
84 Ga0068858_100198644 3300005842 Bacteria 1896
85 Ga0068858_100230961 3300005842 Bacteria 1754
86 Ga0068860_100018018 3300005843 Bacteria 6876
87 Ga0068860_100137029 3300005843 Bacteria 2351
88 Ga0068862_100004461 3300005844 Bacteria 11803
89 Ga0081539_10004658 3300005985 Bacteria 14918
90 Ga0081539_10005973 3300005985 Bacteria 11993
91 Ga0081539_10009345 3300005985 Bacteria 8224
92 Ga0097621_100001463 3300006237 Bacteria 16164
93 Ga0097621_100041002 3300006237 Unclassified 3724
94 Ga0097621_100052065 3300006237 Unclassified 3334
95 Ga0097621_100209839 3300006237 Bacteria 1694
96 Ga0068871_100012694 3300006358 Bacteria 6225
97 Ga0068871_100026278 3300006358 Bacteria 4541
98 Ga0068871_100129897 3300006358 Unclassified 2135
99 Ga0075428_100142286 3300006844 Bacteria 2608
100 Ga0075431_100074421 3300006847 Bacteria 3505
101 Ga0075433_10041658 3300006852 Bacteria 3979
102 Ga0075433_10047604 3300006852 Bacteria 3730
103 Ga0075434_100000049 3300006871 Bacteria 57417
104 Ga0075434_100051942 3300006871 Bacteria 4073
105 Ga0075434_100082014 3300006871 Bacteria 3222
106 Ga0075434_100119114 3300006871 Bacteria 2654
107 Ga0075434_100119475 3300006871 Bacteria 2650
108 Ga0075434_100123146 3300006871 Bacteria 2609
109 Ga0075434_100125117 3300006871 Bacteria 2588
110 Ga0075434_100212926 3300006871 Bacteria 1952
111 Ga0068865_100009117 3300006881 Bacteria 6141
112 Ga0068865_100083779 3300006881 Unclassified 2296
113 Ga0075436_100000420 3300006914 Bacteria 27162
114 Ga0075436_100035192 3300006914 Bacteria 3455
115 Ga0075436_100177892 3300006914 Bacteria 1503
116 Ga0097620_100202708 3300006931 Bacteria 2069
117 Ga0097620_100256582 3300006931 Bacteria 1839
118 Ga0097620_100299020 3300006931 Bacteria 1703
119 Ga0075435_100000059 3300007076 Bacteria 56189
120 Ga0075435_100000747 3300007076 Bacteria 20145
121 Ga0075435_100005562 3300007076 Bacteria 8819
122 Ga0075435_100019258 3300007076 Bacteria 5208
123 Ga0075435_100022587 3300007076 Bacteria 4853
124 Ga0075435_100048272 3300007076 Bacteria 3420
125 Ga0075435_100061292 3300007076 Bacteria 3052
126 Ga0075435_100068804 3300007076 Bacteria 2885
127 Ga0105240_10006658 3300009093 Bacteria 16939
128 Ga0105240_10026220 3300009093 Bacteria 7646
129 Ga0105240_10076802 3300009093 Bacteria 4117
130 Ga0105240_10221108 3300009093 Bacteria 2206
131 Ga0105240_10520608 3300009093 Bacteria 1320
132 Ga0111539_10017167 3300009094 Bacteria 8959
133 Ga0111539_10115101 3300009094 Bacteria 3154
134 Ga0111539_10182653 3300009094 Bacteria 2450
135 Ga0111539_10444675 3300009094 Bacteria 1509
136 Ga0105245_10064630 3300009098 Bacteria 3307
137 Ga0105245_10170272 3300009098 Bacteria 2074
138 Ga0105245_10238867 3300009098 Bacteria 1760
139 Ga0105245_10414671 3300009098 Bacteria 1348
140 Ga0105245_10515282 3300009098 Bacteria 1214
141 Ga0105247_10010076 3300009101 Bacteria 5726
142 Ga0105247_10010295 3300009101 Bacteria 5659
143 Ga0105247_10122592 3300009101 Bacteria 1686
144 Ga0114129_10002862 3300009147 Bacteria 24132
145 Ga0114129_10006531 3300009147 Bacteria 16547
146 Ga0114129_10006748 3300009147 Bacteria 16297
147 Ga0114129_10015216 3300009147 Bacteria 10950
148 Ga0114129_10025221 3300009147 Bacteria 8424
149 Ga0114129_10031782 3300009147 Bacteria 7463
150 Ga0114129_10036412 3300009147 Bacteria 6949
151 Ga0114129_10058054 3300009147 Bacteria 5413
152 Ga0114129_10063068 3300009147 Bacteria 5177
153 Ga0114129_10161662 3300009147 Bacteria 3058
154 Ga0114129_10190122 3300009147 Bacteria 2788
155 Ga0114129_10298538 3300009147 Bacteria 2148
156 Ga0114129_10301400 3300009147 Bacteria 2136
157 Ga0114129_10356792 3300009147 Bacteria 1935
158 Ga0114129_10479680 3300009147 Bacteria 1627
159 Ga0114129_10559552 3300009147 Bacteria 1486
160 Ga0105243_10007657 3300009148 Bacteria 8299
161 Ga0105243_10033202 3300009148 Bacteria 3990
162 Ga0105241_10010377 3300009174 Bacteria 6836
163 Ga0105242_10024473 3300009176 Bacteria 4769
164 Ga0105242_10027323 3300009176 Bacteria 4529
165 Ga0105242_10097671 3300009176 Bacteria 2483
166 Ga0105242_10257204 3300009176 Bacteria 1576
167 Ga0105248_10017801 3300009177 Bacteria 7840
168 Ga0105248_10042178 3300009177 Bacteria 5117
169 Ga0105248_10047185 3300009177 Bacteria 4830
170 Ga0105248_10214338 3300009177 Bacteria 2169
171 Ga0105248_10378416 3300009177 Bacteria 1594
172 Ga0105248_10483489 3300009177 Unclassified 1396
173 Ga0105248_10608402 3300009177 Bacteria 1233
174 Ga0105249_10016719 3300009553 Bacteria 6511
175 Ga0105249_10470553 3300009553 Unclassified 1298
176 Ga0105246_10087409 3300011119 Bacteria 2237
177 Ga0157374_10005941 3300013296 Bacteria 10317
178 Ga0157374_10046634 3300013296 Bacteria 4014
179 Ga0157374_10184148 3300013296 Unclassified 2041
180 Ga0157378_10243226 3300013297 Bacteria 1720
181 Ga0163162_10100171 3300013306 Bacteria 2989
182 Ga0157375_10152246 3300013308 Unclassified 2449
183 Ga0157375_10222416 3300013308 Bacteria 2046
184 Ga0163163_10038718 3300014325 Bacteria 4648
185 Ga0163163_10059827 3300014325 Bacteria 3770
186 Ga0157380_10010700 3300014326 Bacteria 6610
187 Ga0157380_10053995 3300014326 Bacteria 3187
188 Ga0157380_10080402 3300014326 Bacteria 2664
189 Ga0157380_10144559 3300014326 Bacteria 2048
190 Ga0157379_10004956 3300014968 Bacteria 11421
191 Ga0157379_10042049 3300014968 Bacteria 4079
192 Ga0157376_10029717 3300014969 Unclassified 4356
193 Ga0157376_10033403 3300014969 Bacteria 4142
194 Ga0157376_10038389 3300014969 Bacteria 3896
195 Ga0157376_10126190 3300014969 Bacteria 2276
196 Ga0163161_10002088 3300017792 Bacteria 14477
197 Ga0207710_10003937 3300025900 Bacteria 6552
198 Ga0207710_10115657 3300025900 Bacteria 1277
199 Ga0207680_10006236 3300025903 Bacteria 5754
200 Ga0207680_10042035 3300025903 Bacteria 2671
201 Ga0207680_10126102 3300025903 Bacteria 1681
202 Ga0207645_10000374 3300025907 Bacteria 37092
203 Ga0207645_10063700 3300025907 Unclassified 2356
204 Ga0207645_10136638 3300025907 Bacteria 1597
205 Ga0207645_10189190 3300025907 Bacteria 1352
206 Ga0207654_10022500 3300025911 Bacteria 3364
207 Ga0207707_10099829 3300025912 Unclassified 2537
208 Ga0207707_10424515 3300025912 Bacteria 1140
209 Ga0207695_10070547 3300025913 Bacteria 3571
210 Ga0207660_10045789 3300025917 Unclassified 3084
211 Ga0207660_10191379 3300025917 Unclassified 1593
212 Ga0207662_10062322 3300025918 Bacteria 2241
213 Ga0207657_10000448 3300025919 Bacteria 43812
214 Ga0207657_10106303 3300025919 Bacteria 2322
215 Ga0207649_10413249 3300025920 Bacteria 1012
216 Ga0207652_10022692 3300025921 Bacteria 5196
217 Ga0207652_10095072 3300025921 Unclassified 2624
218 Ga0207646_10009032 3300025922 Bacteria 9905
219 Ga0207646_10410807 3300025922 Unclassified 1222
220 Ga0207681_10009087 3300025923 Bacteria 6072
221 Ga0207681_10065714 3300025923 Bacteria 2508
222 Ga0207650_10298406 3300025925 Archaea 1315
223 Ga0207659_10411369 3300025926 Unclassified 1133
224 Ga0207687_10035310 3300025927 Bacteria 3400
225 Ga0207687_10083399 3300025927 Bacteria 2314
226 Ga0207687_10093437 3300025927 Bacteria 2199
227 Ga0207706_10163341 3300025933 Bacteria 1957
228 Ga0207686_10109214 3300025934 Bacteria 1862
229 Ga0207709_10032299 3300025935 Bacteria 3064
230 Ga0207709_10047099 3300025935 Bacteria 2620
231 Ga0207704_10246919 3300025938 Bacteria 1337
232 Ga0207691_10024989 3300025940 Bacteria 5613
233 Ga0207711_10017730 3300025941 Bacteria 5916
234 Ga0207711_10061336 3300025941 Bacteria 3242
235 Ga0207711_10066341 3300025941 Bacteria 3121
236 Ga0207711_10187942 3300025941 Bacteria 1882
237 Ga0207711_10321604 3300025941 Unclassified 1430
238 Ga0207679_10189009 3300025945 Bacteria 1710
239 Ga0207667_10028765 3300025949 Bacteria 6034
240 Ga0207640_10005035 3300025981 Bacteria 7188
241 Ga0207640_10109513 3300025981 Bacteria 1954
242 Ga0207677_10364658 3300026023 Bacteria 1215
243 Ga0207703_10014697 3300026035 Bacteria 6109
244 Ga0207703_10045598 3300026035 Bacteria 3527
245 Ga0207703_10045825 3300026035 Bacteria 3519
246 Ga0207708_10000853 3300026075 Bacteria 22965
247 Ga0207708_10004792 3300026075 Bacteria 9964
248 Ga0207708_10234557 3300026075 Bacteria 1474
249 Ga0207702_10050194 3300026078 Bacteria 3522
250 Ga0207641_10005189 3300026088 Bacteria 11136
251 Ga0207641_10089922 3300026088 Unclassified 2684
252 Ga0207648_10022113 3300026089 Bacteria 5713
253 Ga0207648_10027133 3300026089 Bacteria 5086
254 Ga0207648_10052270 3300026089 Bacteria 3572
255 Ga0207648_10060205 3300026089 Bacteria 3311
256 Ga0207676_10059551 3300026095 Bacteria 3016
257 Ga0207676_10190928 3300026095 Unclassified 1802
258 Ga0207674_10171201 3300026116 Bacteria 2125
259 Ga0207675_100037468 3300026118 Bacteria 4523
260 Ga0207675_100102971 3300026118 Bacteria 2690
261 Ga0207675_100109675 3300026118 Bacteria 2604
262 Ga0207675_100519081 3300026118 Bacteria 1187
263 Ga0207683_10288057 3300026121 Bacteria 1502
264 Ga0207698_10066390 3300026142 Bacteria 2839
265 Ga0207698_10529499 3300026142 Bacteria 1151
266 Ga0207428_10005145 3300027907 Bacteria 12252
267 Ga0207428_10015923 3300027907 Bacteria 6485
268 Ga0207428_10063531 3300027907 Bacteria 2916
269 Ga0268266_10008922 3300028379 Bacteria 8873
270 Ga0268266_10065171 3300028379 Unclassified 3149
271 Ga0268265_10011380 3300028380 Bacteria 6016
272 Ga0268265_10193664 3300028380 Bacteria 1758
273 Ga0268264_10042668 3300028381 Bacteria 3755
274 Ga0268264_10183358 3300028381 Bacteria 1903
275 Ga0268264_10194248 3300028381 Bacteria 1852
276 Ga0307405_10067740 3300031731 Bacteria 2282
277 Ga0307416_100130484 3300032002 Bacteria 2261
278 Ga0307416_100266590 3300032002 Bacteria 1678
279 Ga0307416_100481397 3300032002 Bacteria 1301
280 Ga0307415_100125417 3300032126 Bacteria 1934
281 Ga0373948_0013346 3300034817 Bacteria 1482
282 Ga0373938_0001178 3300034957 Bacteria 4218
283 Ga0373940_0000155 3300035088 Bacteria 8962
284 Ga0373932_0001748 3300035112 Bacteria 5880
285 Ga0373936_0102231 3300035113 Bacteria 1210
286 Ga0373939_0010869 3300035114 Bacteria 2287
287 Ga0373941_0001960 3300035115 Bacteria 4463
288 Ga0373941_0030555 3300035115 Bacteria 1598
289 Ga0373945_0026071 3300035116 Bacteria 2035
290 Ga0373943_0102985 3300035170 Bacteria 1496
291 Ga0373955_0066575 3300035172 Bacteria 2003
292 Ga0373942_0043041 3300035207 Bacteria 1239
293 Ga0373961_0000790 3300035241 Bacteria 10874
294 Ga0373947_0063189 3300035725 Bacteria 2255
295 Ga0373937_0141438 3300036401 Bacteria 2252
296 Ga0450923_010624 3300042125 Bacteria 1639
297 Ga0439446_0057704 3300042156 Bacteria 1169
298 Ga0439464_0064429 3300042439 Bacteria 1077
299 Ga0466963_0043060 3300044694 Bacteria 2967
300 Ga0451576_0005245 3300045051 Bacteria 16359
301 Ga0495603_0045408 3300046455 Bacteria 2620
302 Ga0495628_0279927 3300046516 Bacteria 1239
303 Ga0495586_0064838 3300046535 Bacteria 1991
304 Ga0495645_0007977 3300046543 Bacteria 7370
305 Ga0495645_0266576 3300046543 Bacteria 1132
306 Ga0495635_0096615 3300046663 Bacteria 2019
307 Ga0495647_0011190 3300046681 Bacteria 3070
308 Ga0495658_0021571 3300046683 Unclassified 3396
309 Ga0495613_0091896 3300046689 Unclassified 2198
310 Ga0495600_0055965 3300046809 Bacteria 2576
311 Ga0495604_0116300 3300047317 Unclassified 1942
312 Ga0496102_0145702 3300048905 Unclassified 2223
313 Ga0496104_0042987 3300048907 Bacteria 4243
314 Ga0496104_0063206 3300048907 Unclassified 3511
315 Ga0496104_0146666 3300048907 Bacteria 2266
316 Ga0496105_0077343 3300048908 Bacteria 2748
317 Ga0496108_0119624 3300048911 Bacteria 2258
318 Ga0496109_0209298 3300048912 Bacteria 1834
319 Ga0496109_0283043 3300048912 Bacteria 1563
320 Ga0496110_0261739 3300048913 Bacteria 1574
321 Ga0496112_0005329 3300048915 Bacteria 11101
322 Ga0496112_0116368 3300048915 Bacteria 2644
323 Ga0496113_0320666 3300048916 Bacteria 1242
324 Ga0496114_0027098 3300048917 Bacteria 4693
325 Ga0496114_0187739 3300048917 Bacteria 1807
326 Ga0496115_0028623 3300048918 Bacteria 4369
327 Ga0496115_0076189 3300048918 Bacteria 2726
328 Ga0501034_0014657 3300049571 Bacteria 8071
329 Ga0501034_0311366 3300049571 Bacteria 1509
330 Ga0501038_0089956 3300049574 Bacteria 2574
331 Ga0501043_0201236 3300049579 Bacteria 1546
332 Ga0501047_0005826 3300049581 Bacteria 11596
333 Ga0501048_0047173 3300049582 Bacteria 3074
334 Ga0501069_0079931 3300049585 Bacteria 1841
335 Ga0501071_0179581 3300049587 Bacteria 1586
336 Ga0501071_0239792 3300049587 Bacteria 1367
337 Ga0501073_0002831 3300049589 Bacteria 13000
338 Ga0501073_0126578 3300049589 Bacteria 1771
339 Ga0501076_0057353 3300049592 Bacteria 3092
340 Ga0501076_0346146 3300049592 Bacteria 1220
341 Ga0501081_0057063 3300049743 Bacteria 2700
342 Ga0501035_0494838 3300049822 Bacteria 1007
343 Ga0501044_0006256 3300049823 Bacteria 13164
344 Ga0501045_0048193 3300049824 Bacteria 3106
345 Ga0501045_0089931 3300049824 Bacteria 2268
346 nmdc:mga05p37_10708_c1 3300050507 Bacteria 10885
347 nmdc:mga05p37_150151_c1 3300050507 Bacteria 2851
348 nmdc:mga05p37_2169_c1 3300050507 Bacteria 22888
349 nmdc:mga05p37_252011_c1 3300050507 Bacteria 2117
350 nmdc:mga05p37_30866_c1 3300050507 Bacteria 6541
351 nmdc:mga05p37_48624_c1 3300050507 Bacteria 5216
352 nmdc:mga05p37_5071_c1 3300050507 Bacteria 15438
353 nmdc:mga05p37_521946_c1 3300050507 Bacteria 1358
354 nmdc:mga05p37_6745_c1 3300050507 Bacteria 13538
355 nmdc:mga05p37_72625_c1 3300050507 Bacteria 4234
356 nmdc:mga05p37_76602_c1 3300050507 Bacteria 4117
357 nmdc:mga05p37_82472_c1 3300050507 Unclassified 3962
358 nmdc:mga06r32_492021_c1 3300050510 Bacteria 1204
359 nmdc:mga08y16_104344_c1 3300050511 Bacteria 2951
360 nmdc:mga08y16_1540_c1 3300050511 Bacteria 23195
361 nmdc:mga08y16_254926_c1 3300050511 Bacteria 1813
362 nmdc:mga08y16_2595_c1 3300050511 Bacteria 18556
363 nmdc:mga08y16_35615_c1 3300050511 Bacteria 5227
364 nmdc:mga08y16_50400_c1 3300050511 Bacteria 4357
365 nmdc:mga0n895_115194_c1 3300050512 Bacteria 2706
366 nmdc:mga0n895_122519_c1 3300050512 Bacteria 2622
367 nmdc:mga0n895_126844_c2 3300050512 Bacteria 1371
368 nmdc:mga0n895_186941_c1 3300050512 Bacteria 2103
369 nmdc:mga0n895_298856_c1 3300050512 Bacteria 1632
370 nmdc:mga0n895_52286_c1 3300050512 Bacteria 4009
371 nmdc:mga0n895_95_c1 3300050512 Bacteria 52030
372 nmdc:mga0rr50_17771_c1 3300050513 Bacteria 4759
373 nmdc:mga0rr50_1940_c1 3300050513 Bacteria 11488
374 nmdc:mga0rr50_28_c1 3300050513 Bacteria 108950
375 nmdc:mga0rr50_37317_c1 3300050513 Bacteria 3507
376 nmdc:mga0rr50_4559_c1 3300050513 Bacteria 8153
377 nmdc:mga0rr50_48806_c1 3300050513 Bacteria 3131
378 nmdc:mga0rr50_79944_c1 3300050513 Unclassified 2519
379 nmdc:mga08x19_121_c1 3300050514 Bacteria 69968
380 nmdc:mga08x19_13805_c1 3300050514 Bacteria 4893
381 nmdc:mga08x19_22446_c1 3300050514 Bacteria 3909
382 nmdc:mga08x19_71333_c1 3300050514 Bacteria 2265
383 nmdc:mga08x19_93578_c1 3300050514 Bacteria 1986
384 nmdc:mga0a205_139218_c1 3300050515 Bacteria 2327
385 nmdc:mga0a205_184353_c1 3300050515 Bacteria 1981
386 nmdc:mga0a205_194206_c1 3300050515 Bacteria 1921
387 nmdc:mga0a205_56728_c1 3300050515 Bacteria 3781
388 Ga0495601_0080433 3300053077 Bacteria 2091
389 Ga0495601_0081340 3300053077 Bacteria 2079
390 Ga0495601_0369384 3300053077 Bacteria 932
391 Ga0495595_0043970 3300053084 Bacteria 2051
392 Ga0495595_0076502 3300053084 Bacteria 1589
393 Ga0495619_0001225 3300053085 Bacteria 16804
394 Ga0495619_0109442 3300053085 Bacteria 1887
395 Ga0501084_0017646 3300054114 Bacteria 5939
396 Ga0501084_0417372 3300054114 Bacteria 1134
397 Ga0501084_0463037 3300054114 Bacteria 1072
398 Ga0501082_0141438 3300060353 Bacteria 2089
399 Ga0501082_0618116 3300060353 Bacteria 948
400 Ga0530510_0051210 3300061734 Bacteria 2983
401 Ga0530510_0137577 3300061734 Bacteria 1798
402 8045867026 8045864390 Bacteria 5043873
403 nmdc:mga0rr50_224255_c1
404 Ga0065712_10078676
405 Ga0070658_10196252
406 Ga0070676_10005258
407 Ga0070676_10070181
408 Ga0070683_100202065
409 Ga0070690_100003042
410 Ga0070690_100161888
411 Ga0070670_100190205
412 Ga0070670_100322098
413 Ga0070677_10024842
414 Ga0068869_100286919
415 Ga0070666_10009409
416 Ga0070666_10352541
417 Ga0070680_100255107
418 Ga0070682_100138672
419 Ga0068868_100097604
420 Ga0068868_100300804
421 Ga0070689_100362817
422 Ga0070687_100013322
423 Ga0070687_100176784
424 Ga0070692_10106753
425 Ga0070669_100004492
426 Ga0070669_100037369
427 Ga0070671_100375129
428 Ga0070674_100003729
429 Ga0070674_100101446
430 Ga0070688_100003218
431 Ga0070659_100107585
432 Ga0070667_100035342
433 Ga0070714_100004449
434 Ga0070701_10006295
435 Ga0070705_100006282
436 Ga0070705_100017487
437 Ga0070700_100001692
438 Ga0070694_100010375
439 Ga0070694_100139357
440 Ga0070681_10078114
441 Ga0070681_10353853
442 Ga0068867_100005839
443 Ga0068867_100019685
444 Ga0068867_100072647
445 Ga0070685_10140906
446 Ga0070707_100042572
447 Ga0070698_100060327
448 Ga0070699_100008796
449 Ga0070699_100273284
450 Ga0070684_100121908
451 Ga0070697_100054056
452 Ga0070697_100390089
453 Ga0070672_100086718
454 Ga0070686_100000716
455 Ga0070686_100047176
456 Ga0070686_100156458
457 Ga0070695_100003718
458 Ga0070665_100003124
459 Ga0070665_100006541
460 Ga0070665_100254994
461 Ga0070665_100279906
462 Ga0070704_100026555
463 Ga0068855_100016172
464 Ga0070664_100284126
465 Ga0068857_100273065
466 Ga0068854_100014449
467 Ga0068854_100018723
468 Ga0068856_100057737
469 Ga0068856_100070083
470 Ga0070702_100002183
471 Ga0068852_100126768
472 Ga0068859_100202717
473 Ga0068859_100256590
474 Ga0068859_100299005
475 Ga0068864_100008151
476 Ga0068861_100072105
477 Ga0068861_100087402
478 Ga0068851_10118928
479 Ga0068863_100002234
480 Ga0068863_100120412
481 Ga0068863_100255534
482 Ga0068863_100289230
483 Ga0068858_100001888
484 Ga0068858_100039674
485 Ga0068858_100123034
486 Ga0068858_100198644
487 Ga0068858_100230961
488 Ga0068860_100018018
489 Ga0068860_100137029
490 Ga0068862_100004461
491 Ga0081539_10004658
492 Ga0081539_10005973
493 Ga0081539_10009345
494 Ga0097621_100001463
495 Ga0097621_100041002
496 Ga0097621_100052065
497 Ga0097621_100209839
498 Ga0068871_100012694
499 Ga0068871_100026278
500 Ga0068871_100129897
501 Ga0075428_100142286
502 Ga0075431_100074421
503 Ga0075433_10041658
504 Ga0075433_10047604
505 Ga0075434_100000049
506 Ga0075434_100051942
507 Ga0075434_100082014
508 Ga0075434_100119114
509 Ga0075434_100119475
510 Ga0075434_100123146
511 Ga0075434_100125117
512 Ga0075434_100212926
513 Ga0068865_100009117
514 Ga0068865_100083779
515 Ga0075436_100000420
516 Ga0075436_100035192
517 Ga0075436_100177892
518 Ga0097620_100202708
519 Ga0097620_100256582
520 Ga0097620_100299020
521 Ga0075435_100000059
522 Ga0075435_100000747
523 Ga0075435_100005562
524 Ga0075435_100019258
525 Ga0075435_100022587
526 Ga0075435_100048272
527 Ga0075435_100061292
528 Ga0075435_100068804
529 Ga0105240_10006658
530 Ga0105240_10026220
531 Ga0105240_10076802
532 Ga0105240_10221108
533 Ga0105240_10520608
534 Ga0111539_10017167
535 Ga0111539_10115101
536 Ga0111539_10182653
537 Ga0111539_10444675
538 Ga0105245_10064630
539 Ga0105245_10170272
540 Ga0105245_10238867
541 Ga0105245_10414671
542 Ga0105245_10515282
543 Ga0105247_10010076
544 Ga0105247_10010295
545 Ga0105247_10122592
546 Ga0114129_10002862
547 Ga0114129_10006531
548 Ga0114129_10006748
549 Ga0114129_10015216
550 Ga0114129_10025221
551 Ga0114129_10031782
552 Ga0114129_10036412
553 Ga0114129_10058054
554 Ga0114129_10063068
555 Ga0114129_10161662
556 Ga0114129_10190122
557 Ga0114129_10298538
558 Ga0114129_10301400
559 Ga0114129_10356792
560 Ga0114129_10479680
561 Ga0114129_10559552
562 Ga0105243_10007657
563 Ga0105243_10033202
564 Ga0105241_10010377
565 Ga0105242_10024473
566 Ga0105242_10027323
567 Ga0105242_10097671
568 Ga0105242_10257204
569 Ga0105248_10017801
570 Ga0105248_10042178
571 Ga0105248_10047185
572 Ga0105248_10214338
573 Ga0105248_10378416
574 Ga0105248_10483489
575 Ga0105248_10608402
576 Ga0105249_10016719
577 Ga0105249_10470553
578 Ga0105246_10087409
579 Ga0157374_10005941
580 Ga0157374_10046634
581 Ga0157374_10184148
582 Ga0157378_10243226
583 Ga0163162_10100171
584 Ga0157375_10152246
585 Ga0157375_10222416
586 Ga0163163_10038718
587 Ga0163163_10059827
588 Ga0157380_10010700
589 Ga0157380_10053995
590 Ga0157380_10080402
591 Ga0157380_10144559
592 Ga0157379_10004956
593 Ga0157379_10042049
594 Ga0157376_10029717
595 Ga0157376_10033403
596 Ga0157376_10038389
597 Ga0157376_10126190
598 Ga0163161_10002088
599 Ga0207710_10003937
600 Ga0207710_10115657
601 Ga0207680_10006236
602 Ga0207680_10042035
603 Ga0207680_10126102
604 Ga0207645_10000374
605 Ga0207645_10063700
606 Ga0207645_10136638
607 Ga0207645_10189190
608 Ga0207654_10022500
609 Ga0207707_10099829
610 Ga0207707_10424515
611 Ga0207695_10070547
612 Ga0207660_10045789
613 Ga0207660_10191379
614 Ga0207662_10062322
615 Ga0207657_10000448
616 Ga0207657_10106303
617 Ga0207649_10413249
618 Ga0207652_10022692
619 Ga0207652_10095072
620 Ga0207646_10009032
621 Ga0207646_10410807
622 Ga0207681_10009087
623 Ga0207681_10065714
624 Ga0207650_10298406
625 Ga0207659_10411369
626 Ga0207687_10035310
627 Ga0207687_10083399
628 Ga0207687_10093437
629 Ga0207706_10163341
630 Ga0207686_10109214
631 Ga0207709_10032299
632 Ga0207709_10047099
633 Ga0207704_10246919
634 Ga0207691_10024989
635 Ga0207711_10017730
636 Ga0207711_10061336
637 Ga0207711_10066341
638 Ga0207711_10187942
639 Ga0207711_10321604
640 Ga0207679_10189009
641 Ga0207667_10028765
642 Ga0207640_10005035
643 Ga0207640_10109513
644 Ga0207677_10364658
645 Ga0207703_10014697
646 Ga0207703_10045598
647 Ga0207703_10045825
648 Ga0207708_10000853
649 Ga0207708_10004792
650 Ga0207708_10234557
651 Ga0207702_10050194
652 Ga0207641_10005189
653 Ga0207641_10089922
654 Ga0207648_10022113
655 Ga0207648_10027133
656 Ga0207648_10052270
657 Ga0207648_10060205
658 Ga0207676_10059551
659 Ga0207676_10190928
660 Ga0207674_10171201
661 Ga0207675_100037468
662 Ga0207675_100102971
663 Ga0207675_100109675
664 Ga0207675_100519081
665 Ga0207683_10288057
666 Ga0207698_10066390
667 Ga0207698_10529499
668 Ga0207428_10005145
669 Ga0207428_10015923
670 Ga0207428_10063531
671 Ga0268266_10008922
672 Ga0268266_10065171
673 Ga0268265_10011380
674 Ga0268265_10193664
675 Ga0268264_10042668
676 Ga0268264_10183358
677 Ga0268264_10194248
678 Ga0307405_10067740
679 Ga0307416_100130484
680 Ga0307416_100266590
681 Ga0307416_100481397
682 Ga0307415_100125417
683 Ga0373948_0013346
684 Ga0373938_0001178
685 Ga0373940_0000155
686 Ga0373932_0001748
687 Ga0373936_0102231
688 Ga0373939_0010869
689 Ga0373941_0001960
690 Ga0373941_0030555
691 Ga0373945_0026071
692 Ga0373943_0102985
693 Ga0373955_0066575
694 Ga0373942_0043041
695 Ga0373961_0000790
696 Ga0373947_0063189
697 Ga0373937_0141438
698 Ga0450923_010624
699 Ga0439446_0057704
700 Ga0439464_0064429
701 Ga0466963_0043060
702 Ga0451576_0005245
703 Ga0495603_0045408
704 Ga0495628_0279927
705 Ga0495586_0064838
706 Ga0495645_0007977
707 Ga0495645_0266576
708 Ga0495635_0096615
709 Ga0495647_0011190
710 Ga0495658_0021571
711 Ga0495613_0091896
712 Ga0495600_0055965
713 Ga0495604_0116300
714 Ga0496102_0145702
715 Ga0496104_0042987
716 Ga0496104_0063206
717 Ga0496104_0146666
718 Ga0496105_0077343
719 Ga0496108_0119624
720 Ga0496109_0209298
721 Ga0496109_0283043
722 Ga0496110_0261739
723 Ga0496112_0005329
724 Ga0496112_0116368
725 Ga0496113_0320666
726 Ga0496114_0027098
727 Ga0496114_0187739
728 Ga0496115_0028623
729 Ga0496115_0076189
730 Ga0501034_0014657
731 Ga0501034_0311366
732 Ga0501038_0089956
733 Ga0501043_0201236
734 Ga0501047_0005826
735 Ga0501048_0047173
736 Ga0501069_0079931
737 Ga0501071_0179581
738 Ga0501071_0239792
739 Ga0501073_0002831
740 Ga0501073_0126578
741 Ga0501076_0057353
742 Ga0501076_0346146
743 Ga0501081_0057063
744 Ga0501035_0494838
745 Ga0501044_0006256
746 Ga0501045_0048193
747 Ga0501045_0089931
748 nmdc:mga05p37_10708_c1
749 nmdc:mga05p37_150151_c1
750 nmdc:mga05p37_2169_c1
751 nmdc:mga05p37_252011_c1
752 nmdc:mga05p37_30866_c1
753 nmdc:mga05p37_48624_c1
754 nmdc:mga05p37_5071_c1
755 nmdc:mga05p37_521946_c1
756 nmdc:mga05p37_6745_c1
757 nmdc:mga05p37_72625_c1
758 nmdc:mga05p37_76602_c1
759 nmdc:mga05p37_82472_c1
760 nmdc:mga06r32_492021_c1
761 nmdc:mga08y16_104344_c1
762 nmdc:mga08y16_1540_c1
763 nmdc:mga08y16_254926_c1
764 nmdc:mga08y16_2595_c1
765 nmdc:mga08y16_35615_c1
766 nmdc:mga08y16_50400_c1
767 nmdc:mga0n895_115194_c1
768 nmdc:mga0n895_122519_c1
769 nmdc:mga0n895_126844_c2
770 nmdc:mga0n895_186941_c1
771 nmdc:mga0n895_298856_c1
772 nmdc:mga0n895_52286_c1
773 nmdc:mga0n895_95_c1
774 nmdc:mga0rr50_17771_c1
775 nmdc:mga0rr50_1940_c1
776 nmdc:mga0rr50_28_c1
777 nmdc:mga0rr50_37317_c1
778 nmdc:mga0rr50_4559_c1
779 nmdc:mga0rr50_48806_c1
780 nmdc:mga0rr50_79944_c1
781 nmdc:mga08x19_121_c1
782 nmdc:mga08x19_13805_c1
783 nmdc:mga08x19_22446_c1
784 nmdc:mga08x19_71333_c1
785 nmdc:mga08x19_93578_c1
786 nmdc:mga0a205_139218_c1
787 nmdc:mga0a205_184353_c1
788 nmdc:mga0a205_194206_c1
789 nmdc:mga0a205_56728_c1
790 Ga0495601_0080433
791 Ga0495601_0081340
792 Ga0495601_0369384
793 Ga0495595_0043970
794 Ga0495595_0076502
795 Ga0495619_0001225
796 Ga0495619_0109442
797 Ga0501084_0017646
798 Ga0501084_0417372
799 Ga0501084_0463037
800 Ga0501082_0141438
801 Ga0501082_0618116
802 Ga0530510_0051210
803 Ga0530510_0137577
804 8045867026

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00389

2-Hacid_dh

D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain

22

331

0.98

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

126

299

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dbq-assembly1.cif.gz_A crystal structure of glyoxylate reductase (ph0597) from pyrococcus horikoshii ot3, complexed with nadp (i41) 0.9546 1 313
6bii-assembly1.cif.gz_B crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with nadp and malonate (re-refinement of 5aow) 0.9519 1 312
2cuk-assembly2.cif.gz_D crystal structure of tt0316 protein from thermus thermophilus hb8 0.9517 3 313
5aov-assembly1.cif.gz_A-2 ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate 0.9511 2 313
2dbq-assembly1.cif.gz_A crystal structure of glyoxylate reductase (ph0597) from pyrococcus horikoshii ot3, complexed with nadp (i41) 0.9488 1 313
ID Description Score Start End Superfamily
af_Q2FZW9_11_72_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9835 36 96 3.40.50.720
af_Q2FVW4_2_98_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.977 2 97 3.40.50.720
af_Q8I725_27_126_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9696 2 97 3.40.50.720
af_Q2FVW4_141_284_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9686 141 279 3.40.50.720
af_Q2FVW4_100_283_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.966 101 279 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2E8E7N8-F1-model_v4 D-isomer specific 2-hydroxyacid dehydrogenase catalytic domain-containing protein 0.9877 5 92 GO:0016616
GO:0051287
AF-A0A662VDZ6-F1-model_v4 D-glycerate dehydrogenase 0.9792 1 101 GO:0016616
GO:0051287
AF-A0A2N1ZKT9-F1-model_v4 deleted 0.9656 188 312
AF-A0A3S1CSH3-F1-model_v4 D-glycerate dehydrogenase 0.9638 148 276 GO:0005829
GO:0016618
GO:0030267
GO:0051287
AF-A0A7X3J0E1-F1-model_v4 3-phosphoglycerate dehydrogenase 0.9634 98 313 GO:0016614
GO:0051287

Map