F435197

General Info

Members Datasets Scaffolds Average Seq Length
402 148 804 145

Family's Representative Sequence

Representative Sequence 3300048091|Ga0495626_0004911|Ga0495626_0004911_3119_3598
Length 145
Sequence MHSPDKTTPIQPQGSIMHTTTNNDTLRSLDDTGKLLLRAVLALLLLFHGMSKLAGGIGFITGMLEKAGLPGAFGYLVYIGEVVAPLLILVGVFTLLLVHTSQFFSLNETGGWALELQGMYLGAALAVALLGAGRYSVGGLKGRFN

Samples

Sample ID Description Type Environment
1 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
45 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
81 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
82 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
83 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
84 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
85 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
86 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
87 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
88 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
89 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
90 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
91 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
92 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
93 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
94 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
95 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
96 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
97 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
98 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
99 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
100 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
101 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
102 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
103 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
104 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
105 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
106 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
107 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
110 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
111 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
112 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
113 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
114 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
115 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
116 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
117 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
118 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
119 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
120 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
121 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
122 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
123 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
124 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
125 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
126 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
127 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
128 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
129 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
130 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
131 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
132 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
133 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
134 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
135 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
143 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
144 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
145 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
146 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
147 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.76
Metatranscriptomes 1.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 2.49
Rhizosphere 97.01
Stem 0
Stem Tuber 0
Unclassified 1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495626_0004911 3300048091 Bacteria 8032
2 Ga0070658_10002076 3300005327 Bacteria 16814
3 Ga0070683_100060143 3300005329 Bacteria 3530
4 Ga0070680_100108141 3300005336 Bacteria 2313
5 Ga0070680_100340716 3300005336 Bacteria 1274
6 Ga0070660_100007080 3300005339 Bacteria 7793
7 Ga0070660_100088823 3300005339 Bacteria 2434
8 Ga0070691_10062719 3300005341 Bacteria 1790
9 Ga0070661_100026801 3300005344 Bacteria 4147
10 Ga0070669_100900918 3300005353 Bacteria 755
11 Ga0070659_100014092 3300005366 Bacteria 5967
12 Ga0070659_100028994 3300005366 Bacteria 4276
13 Ga0070659_100286708 3300005366 Bacteria 1370
14 Ga0070714_100029991 3300005435 Bacteria 4525
15 Ga0070714_100723143 3300005435 Bacteria 961
16 Ga0070713_101076091 3300005436 Bacteria 777
17 Ga0070711_100390332 3300005439 Bacteria 1128
18 Ga0070663_100017261 3300005455 Bacteria 4706
19 Ga0070662_100306427 3300005457 Bacteria 1292
20 Ga0070699_100026859 3300005518 Bacteria 4966
21 Ga0070699_100258674 3300005518 Bacteria 1556
22 Ga0070679_100110868 3300005530 Bacteria 2730
23 Ga0070679_100207224 3300005530 Bacteria 1925
24 Ga0070679_100666793 3300005530 Bacteria 983
25 Ga0070684_100124537 3300005535 Bacteria 2320
26 Ga0070684_101808612 3300005535 Bacteria 576
27 Ga0068853_100090053 3300005539 Bacteria 2696
28 Ga0070693_100267325 3300005547 Bacteria 1140
29 Ga0068855_100161415 3300005563 Bacteria 2543
30 Ga0068855_100860589 3300005563 Bacteria 960
31 Ga0070664_100014971 3300005564 Bacteria 6330
32 Ga0068854_100011319 3300005578 Bacteria 5802
33 Ga0068856_100009042 3300005614 Bacteria 9694
34 Ga0068856_100323196 3300005614 Bacteria 1560
35 Ga0068852_100066940 3300005616 Bacteria 3139
36 Ga0068852_100407303 3300005616 Bacteria 1339
37 Ga0068861_100150874 3300005719 Bacteria 1907
38 Ga0068851_10003311 3300005834 Bacteria 7158
39 Ga0075434_100316522 3300006871 Unclassified 1581
40 Ga0068865_100904212 3300006881 Bacteria 768
41 Ga0075436_100134526 3300006914 Bacteria 1735
42 Ga0075435_100768747 3300007076 Bacteria 838
43 Ga0105240_10021532 3300009093 Bacteria 8573
44 Ga0105240_10035370 3300009093 Bacteria 6439
45 Ga0105240_10269429 3300009093 Bacteria 1961
46 Ga0105237_10050202 3300009545 Bacteria 4192
47 Ga0105237_10100596 3300009545 Bacteria 2882
48 Ga0105238_10007768 3300009551 Bacteria 10724
49 Ga0105239_10039353 3300010375 Bacteria 5181
50 Ga0105246_10224139 3300011119 Bacteria 1476
51 Ga0157373_10003436 3300013100 Bacteria 11985
52 Ga0157371_10185045 3300013102 Bacteria 1490
53 Ga0157370_10015767 3300013104 Bacteria 7669
54 Ga0157370_10022974 3300013104 Bacteria 6198
55 Ga0157370_10030981 3300013104 Bacteria 5237
56 Ga0157369_10011852 3300013105 Bacteria 9902
57 Ga0157369_10153036 3300013105 Bacteria 2438
58 Ga0157369_10233497 3300013105 Bacteria 1922
59 Ga0163162_10377784 3300013306 Bacteria 1550
60 Ga0157372_10151972 3300013307 Bacteria 2672
61 Ga0157372_10157395 3300013307 Bacteria 2625
62 Ga0157372_10203380 3300013307 Bacteria 2294
63 Ga0157372_10887361 3300013307 Bacteria 1035
64 Ga0157372_13128600 3300013307 Bacteria 528
65 Ga0206354_11164308 3300020081 Bacteria 3382
66 Ga0206353_11882268 3300020082 Bacteria 3517
67 Ga0154015_1157659 3300020610 Bacteria 1095
68 Ga0209148_1001112 3300025254 Bacteria 16051
69 Ga0207656_10055888 3300025321 Bacteria 1719
70 Ga0207699_10058882 3300025906 Bacteria 2300
71 Ga0207705_10068339 3300025909 Bacteria 2572
72 Ga0207705_10070481 3300025909 Bacteria 2533
73 Ga0207705_10521444 3300025909 Bacteria 923
74 Ga0207654_10040766 3300025911 Bacteria 2618
75 Ga0207707_10037804 3300025912 Bacteria 4217
76 Ga0207707_11026133 3300025912 Bacteria 676
77 Ga0207695_10011934 3300025913 Bacteria 10463
78 Ga0207695_10097547 3300025913 Bacteria 2940
79 Ga0207695_10157410 3300025913 Bacteria 2206
80 Ga0207671_10404360 3300025914 Bacteria 1086
81 Ga0207663_10712864 3300025916 Bacteria 795
82 Ga0207660_10313531 3300025917 Bacteria 1251
83 Ga0207660_10924337 3300025917 Bacteria 712
84 Ga0207657_10000545 3300025919 Bacteria 40246
85 Ga0207657_10052623 3300025919 Bacteria 3532
86 Ga0207657_10265475 3300025919 Bacteria 1365
87 Ga0207657_10742799 3300025919 Bacteria 761
88 Ga0207649_10145325 3300025920 Bacteria 1627
89 Ga0207652_10008437 3300025921 Bacteria 8291
90 Ga0207652_10356692 3300025921 Bacteria 1320
91 Ga0207681_10749278 3300025923 Bacteria 814
92 Ga0207694_10012386 3300025924 Bacteria 6427
93 Ga0207700_10065423 3300025928 Bacteria 2774
94 Ga0207664_10109183 3300025929 Bacteria 2298
95 Ga0207664_10637783 3300025929 Bacteria 957
96 Ga0207690_10141926 3300025932 Bacteria 1771
97 Ga0207690_10208815 3300025932 Bacteria 1487
98 Ga0207706_10052388 3300025933 Bacteria 3603
99 Ga0207706_10398472 3300025933 Bacteria 1193
100 Ga0207704_11153655 3300025938 Bacteria 660
101 Ga0207661_10110199 3300025944 Bacteria 2326
102 Ga0207679_10113505 3300025945 Bacteria 2143
103 Ga0207667_10001020 3300025949 Bacteria 35702
104 Ga0207667_10126173 3300025949 Bacteria 2636
105 Ga0207667_10366030 3300025949 Bacteria 1470
106 Ga0207667_10615881 3300025949 Bacteria 1094
107 Ga0207640_10302226 3300025981 Bacteria 1266
108 Ga0207639_10010534 3300026041 Bacteria 6404
109 Ga0207639_11629099 3300026041 Bacteria 605
110 Ga0207678_10003081 3300026067 Bacteria 15079
111 Ga0207702_10135908 3300026078 Bacteria 2218
112 Ga0207674_10000599 3300026116 Bacteria 47369
113 Ga0207675_100134028 3300026118 Bacteria 2349
114 Ga0207698_10112848 3300026142 Bacteria 2282
115 Ga0395899_0026998 3300037312 Bacteria 4330
116 Ga0395899_0122023 3300037312 Bacteria 1865
117 Ga0395899_0157342 3300037312 Bacteria 1607
118 Ga0395899_0425312 3300037312 Bacteria 874
119 Ga0395900_0012300 3300037418 Bacteria 8754
120 Ga0395900_0127107 3300037418 Bacteria 2614
121 Ga0395900_0296446 3300037418 Bacteria 1604
122 Ga0395900_0832794 3300037418 Bacteria 849
123 Ga0395898_0038891 3300037466 Bacteria 4711
124 Ga0395898_0159638 3300037466 Bacteria 2156
125 Ga0395898_0488586 3300037466 Bacteria 1171
126 Ga0395898_1176580 3300037466 Bacteria 698
127 Ga0395905_0079235 3300037471 Bacteria 3079
128 Ga0395905_0163803 3300037471 Bacteria 2089
129 Ga0395905_0202361 3300037471 Bacteria 1861
130 Ga0395905_0398216 3300037471 Bacteria 1271
131 Ga0395901_0006544 3300038443 Bacteria 11783
132 Ga0395901_0300761 3300038443 Bacteria 1663
133 Ga0395901_0437424 3300038443 Bacteria 1339
134 Ga0495617_000012 3300046452 Bacteria 295916
135 Ga0495617_073620 3300046452 Bacteria 1122
136 Ga0495627_000118 3300046453 Bacteria 99480
137 Ga0495590_0000013 3300046457 Bacteria 271977
138 Ga0495590_0006583 3300046457 Bacteria 4527
139 Ga0495590_0014062 3300046457 Bacteria 2930
140 Ga0495591_000109 3300046458 Bacteria 94877
141 Ga0495591_007355 3300046458 Bacteria 4694
142 Ga0495638_0208487 3300046460 Bacteria 1099
143 Ga0495638_0566511 3300046460 Bacteria 562
144 Ga0495605_0000072 3300046474 Bacteria 133731
145 Ga0495605_0004941 3300046474 Bacteria 7791
146 Ga0495605_0013762 3300046474 Bacteria 4446
147 Ga0495605_0043984 3300046474 Bacteria 2210
148 Ga0495605_0106852 3300046474 Bacteria 1280
149 Ga0495605_0193687 3300046474 Bacteria 888
150 Ga0495584_0000029 3300046491 Bacteria 105850
151 Ga0495584_0000791 3300046491 Bacteria 20848
152 Ga0495584_0261695 3300046491 Bacteria 879
153 Ga0495585_0000048 3300046492 Bacteria 120031
154 Ga0495585_0007053 3300046492 Bacteria 6912
155 Ga0495585_0210512 3300046492 Bacteria 985
156 Ga0495585_0275651 3300046492 Bacteria 833
157 Ga0495594_0050157 3300046499 Bacteria 2295
158 Ga0495596_0000243 3300046500 Bacteria 36829
159 Ga0495596_0000309 3300046500 Bacteria 32084
160 Ga0495596_0003025 3300046500 Bacteria 8705
161 Ga0495596_0003935 3300046500 Bacteria 7352
162 Ga0495596_0020735 3300046500 Bacteria 2688
163 Ga0495596_0023664 3300046500 Bacteria 2491
164 Ga0495596_0025081 3300046500 Bacteria 2411
165 Ga0495596_0025461 3300046500 Bacteria 2391
166 Ga0495596_0094711 3300046500 Bacteria 1159
167 Ga0495607_0002120 3300046501 Bacteria 16568
168 Ga0495607_0002863 3300046501 Bacteria 13664
169 Ga0495607_0005992 3300046501 Bacteria 8618
170 Ga0495607_0008378 3300046501 Bacteria 7070
171 Ga0495607_0013962 3300046501 Bacteria 5245
172 Ga0495607_0017736 3300046501 Bacteria 4558
173 Ga0495607_0032051 3300046501 Bacteria 3212
174 Ga0495583_0000463 3300046506 Bacteria 59986
175 Ga0495583_0000697 3300046506 Bacteria 43333
176 Ga0495583_0001770 3300046506 Bacteria 20595
177 Ga0495583_0011831 3300046506 Bacteria 4985
178 Ga0495583_0028892 3300046506 Bacteria 2720
179 Ga0495583_0097507 3300046506 Bacteria 1258
180 Ga0495606_0018958 3300046507 Bacteria 5141
181 Ga0495606_0039782 3300046507 Bacteria 3163
182 Ga0495606_0074336 3300046507 Bacteria 2129
183 Ga0495610_0004903 3300046512 Bacteria 9722
184 Ga0495616_0000131 3300046513 Bacteria 65268
185 Ga0495616_0000238 3300046513 Bacteria 44742
186 Ga0495616_0000388 3300046513 Bacteria 34173
187 Ga0495616_0001928 3300046513 Bacteria 13957
188 Ga0495616_0020509 3300046513 Bacteria 3593
189 Ga0495616_0022267 3300046513 Bacteria 3423
190 Ga0495616_0067250 3300046513 Bacteria 1742
191 Ga0495616_0123675 3300046513 Bacteria 1191
192 Ga0495616_0192586 3300046513 Bacteria 900
193 Ga0495616_0390288 3300046513 Bacteria 573
194 Ga0495631_0000737 3300046518 Bacteria 21033
195 Ga0495631_0002673 3300046518 Bacteria 9920
196 Ga0495631_0004913 3300046518 Bacteria 7044
197 Ga0495631_0017067 3300046518 Bacteria 3441
198 Ga0495631_0023136 3300046518 Bacteria 2883
199 Ga0495631_0039124 3300046518 Bacteria 2106
200 Ga0495631_0115584 3300046518 Bacteria 1153
201 Ga0495631_0161327 3300046518 Bacteria 962
202 Ga0495632_0000116 3300046519 Bacteria 81523
203 Ga0495632_0000156 3300046519 Bacteria 70702
204 Ga0495632_0000853 3300046519 Bacteria 26790
205 Ga0495632_0001593 3300046519 Bacteria 18701
206 Ga0495632_0003692 3300046519 Bacteria 10734
207 Ga0495632_0014760 3300046519 Bacteria 4407
208 Ga0495632_0024852 3300046519 Bacteria 3176
209 Ga0495632_0064615 3300046519 Bacteria 1769
210 Ga0495637_0000008 3300046520 Bacteria 404658
211 Ga0495637_0051725 3300046520 Bacteria 1717
212 Ga0495637_0057590 3300046520 Bacteria 1605
213 Ga0495637_0065149 3300046520 Bacteria 1484
214 Ga0495643_0000121 3300046522 Bacteria 125932
215 Ga0495643_0005225 3300046522 Bacteria 8838
216 Ga0495643_0006816 3300046522 Bacteria 7465
217 Ga0495643_0014186 3300046522 Bacteria 4746
218 Ga0495643_0028165 3300046522 Bacteria 3152
219 Ga0495643_0066303 3300046522 Bacteria 1904
220 Ga0495643_0091543 3300046522 Bacteria 1568
221 Ga0495643_0295619 3300046522 Bacteria 740
222 Ga0495644_0007278 3300046523 Bacteria 4277
223 Ga0495644_0027243 3300046523 Bacteria 2165
224 Ga0495644_0075377 3300046523 Bacteria 1270
225 Ga0495648_0000116 3300046524 Bacteria 98123
226 Ga0495648_0005481 3300046524 Bacteria 10528
227 Ga0495648_0007837 3300046524 Bacteria 8495
228 Ga0495648_0040184 3300046524 Bacteria 2968
229 Ga0495648_0047558 3300046524 Bacteria 2650
230 Ga0495648_0183606 3300046524 Bacteria 1061
231 Ga0495648_0385232 3300046524 Bacteria 631
232 Ga0495666_0002015 3300046526 Bacteria 10043
233 Ga0495666_0029471 3300046526 Bacteria 2700
234 Ga0495642_0000010 3300046528 Bacteria 136557
235 Ga0495642_0000459 3300046528 Bacteria 21479
236 Ga0495642_0002240 3300046528 Bacteria 7922
237 Ga0495642_0024702 3300046528 Bacteria 2378
238 Ga0495642_0029050 3300046528 Bacteria 2205
239 Ga0495642_0435014 3300046528 Bacteria 579
240 Ga0495654_0005595 3300046530 Bacteria 7271
241 Ga0495654_0052292 3300046530 Bacteria 1990
242 Ga0495654_0067621 3300046530 Bacteria 1701
243 Ga0495654_0185286 3300046530 Bacteria 899
244 Ga0495665_0001347 3300046531 Bacteria 13125
245 Ga0495665_0015551 3300046531 Bacteria 4096
246 Ga0495587_0001570 3300046536 Bacteria 15194
247 Ga0495609_0007564 3300046538 Bacteria 5401
248 Ga0495609_0008690 3300046538 Bacteria 4953
249 Ga0495609_0023384 3300046538 Bacteria 2841
250 Ga0495609_0060136 3300046538 Bacteria 1680
251 Ga0495609_0088079 3300046538 Bacteria 1352
252 Ga0495609_0172417 3300046538 Bacteria 913
253 Ga0495597_0010574 3300046542 Bacteria 4503
254 Ga0495597_0014466 3300046542 Bacteria 3757
255 Ga0495597_0019080 3300046542 Bacteria 3211
256 Ga0495597_0027852 3300046542 Bacteria 2589
257 Ga0495597_0161830 3300046542 Bacteria 913
258 Ga0495645_0023835 3300046543 Bacteria 4436
259 Ga0495622_0001500 3300046557 Bacteria 11667
260 Ga0495633_0000874 3300046558 Bacteria 26052
261 Ga0495633_0056515 3300046558 Unclassified 1844
262 Ga0495633_0071954 3300046558 Bacteria 1613
263 Ga0495633_0100581 3300046558 Bacteria 1342
264 Ga0495633_0150743 3300046558 Bacteria 1074
265 Ga0495656_0006750 3300046615 Bacteria 4033
266 Ga0495656_0025576 3300046615 Bacteria 2342
267 Ga0495668_0000006 3300046616 Bacteria 553404
268 Ga0495668_0000532 3300046616 Bacteria 47353
269 Ga0495668_0000733 3300046616 Bacteria 39289
270 Ga0495668_0002189 3300046616 Bacteria 16712
271 Ga0495668_0006228 3300046616 Bacteria 7876
272 Ga0495668_0033857 3300046616 Bacteria 2869
273 Ga0495668_0057870 3300046616 Bacteria 2139
274 Ga0495611_0001733 3300046648 Bacteria 10560
275 Ga0495611_0003086 3300046648 Bacteria 7397
276 Ga0495611_0004803 3300046648 Bacteria 5807
277 Ga0495611_0027979 3300046648 Bacteria 2468
278 Ga0495611_0295649 3300046648 Bacteria 747
279 Ga0495625_0010704 3300046660 Bacteria 7554
280 Ga0495625_0031882 3300046660 Bacteria 3915
281 Ga0495625_0248641 3300046660 Bacteria 1155
282 Ga0495661_0002259 3300046665 Bacteria 14910
283 Ga0495661_0002490 3300046665 Bacteria 14173
284 Ga0495661_0006159 3300046665 Bacteria 8441
285 Ga0495661_0029945 3300046665 Bacteria 3469
286 Ga0495661_0045398 3300046665 Bacteria 2688
287 Ga0495661_0045480 3300046665 Bacteria 2684
288 Ga0495661_0057941 3300046665 Bacteria 2310
289 Ga0495661_0076096 3300046665 Bacteria 1949
290 Ga0495661_0077806 3300046665 Bacteria 1920
291 Ga0495661_0102008 3300046665 Bacteria 1613
292 Ga0495661_0127387 3300046665 Bacteria 1399
293 Ga0495661_0169331 3300046665 Bacteria 1166
294 Ga0495661_0183386 3300046665 Bacteria 1107
295 Ga0495661_0225848 3300046665 Bacteria 968
296 Ga0495588_0000052 3300046674 Bacteria 304493
297 Ga0495588_0002966 3300046674 Bacteria 7332
298 Ga0495588_0028372 3300046674 Bacteria 2801
299 Ga0495588_0041932 3300046674 Bacteria 2338
300 Ga0495669_0019563 3300046684 Bacteria 2923
301 Ga0495669_0031167 3300046684 Bacteria 2341
302 Ga0495669_0038224 3300046684 Bacteria 2125
303 Ga0495669_0070220 3300046684 Bacteria 1595
304 Ga0495669_0075459 3300046684 Bacteria 1542
305 Ga0495669_0373973 3300046684 Bacteria 689
306 Ga0495613_0053263 3300046689 Bacteria 2978
307 Ga0495670_0052918 3300046691 Bacteria 2033
308 Ga0495670_0082147 3300046691 Bacteria 1642
309 Ga0495671_0000092 3300046692 Bacteria 85232
310 Ga0495671_0000484 3300046692 Bacteria 30964
311 Ga0495671_0000792 3300046692 Bacteria 22664
312 Ga0495671_0010833 3300046692 Bacteria 5040
313 Ga0495671_0089259 3300046692 Bacteria 1509
314 Ga0495649_0000071 3300046694 Bacteria 89386
315 Ga0495649_0053926 3300046694 Bacteria 2175
316 Ga0495649_0113801 3300046694 Bacteria 1433
317 Ga0495589_0000115 3300046794 Bacteria 75796
318 Ga0495589_0000654 3300046794 Bacteria 22704
319 Ga0495589_0001477 3300046794 Bacteria 13524
320 Ga0495589_0017199 3300046794 Bacteria 3713
321 Ga0495589_0021653 3300046794 Bacteria 3284
322 Ga0495589_0057789 3300046794 Bacteria 1907
323 Ga0495660_0000218 3300046810 Bacteria 57673
324 Ga0495660_0005717 3300046810 Bacteria 7425
325 Ga0495660_0012774 3300046810 Bacteria 4872
326 Ga0495660_0022574 3300046810 Bacteria 3592
327 Ga0495660_0052663 3300046810 Bacteria 2210
328 Ga0495660_0065234 3300046810 Bacteria 1944
329 Ga0495660_0079790 3300046810 Bacteria 1718
330 Ga0495660_0110962 3300046810 Bacteria 1399
331 Ga0495581_0009228 3300047315 Bacteria 5706
332 Ga0495636_0024252 3300047318 Bacteria 2459
333 Ga0495636_0245293 3300047318 Bacteria 827
334 Ga0495672_0000033 3300047320 Bacteria 291992
335 Ga0495672_0001570 3300047320 Bacteria 22373
336 Ga0495672_0004983 3300047320 Bacteria 10650
337 Ga0495683_0000168 3300047323 Bacteria 63828
338 Ga0495683_0054425 3300047323 Bacteria 1994
339 Ga0495683_0385510 3300047323 Unclassified 585
340 Ga0495687_000067 3300047443 Bacteria 161372
341 Ga0495687_000086 3300047443 Bacteria 143855
342 Ga0495677_0000584 3300047445 Bacteria 14980
343 Ga0495677_0000985 3300047445 Bacteria 11464
344 Ga0495677_0002359 3300047445 Bacteria 7418
345 Ga0495677_0004949 3300047445 Bacteria 5080
346 Ga0495677_0028233 3300047445 Bacteria 2037
347 Ga0495677_0029100 3300047445 Bacteria 2008
348 Ga0495677_0041935 3300047445 Bacteria 1676
349 Ga0495677_0187111 3300047445 Unclassified 803
350 Ga0495679_004238 3300047446 Bacteria 6669
351 Ga0495679_008936 3300047446 Bacteria 4039
352 Ga0495679_016875 3300047446 Bacteria 2628
353 Ga0495685_004815 3300047447 Bacteria 4380
354 Ga0495685_084471 3300047447 Bacteria 1055
355 Ga0495685_094758 3300047447 Bacteria 987
356 Ga0495673_0087886 3300047469 Bacteria 1275
357 Ga0495681_0001730 3300047470 Bacteria 16136
358 Ga0495681_0010130 3300047470 Bacteria 5732
359 Ga0495681_0025432 3300047470 Bacteria 3098
360 Ga0495681_0050902 3300047470 Bacteria 1950
361 Ga0495681_0112969 3300047470 Bacteria 1174
362 Ga0495681_0113617 3300047470 Bacteria 1169
363 Ga0495686_0000431 3300047472 Bacteria 65240
364 Ga0495686_0021849 3300047472 Bacteria 4241
365 Ga0495686_0094887 3300047472 Bacteria 1807
366 Ga0495686_0135666 3300047472 Bacteria 1455
367 Ga0495686_0155285 3300047472 Bacteria 1341
368 Ga0495593_0069368 3300047673 Bacteria 1833
369 Ga0495626_0000011 3300048091 Bacteria 260928
370 Ga0495626_0001550 3300048091 Bacteria 18037
371 Ga0495626_0003408 3300048091 Bacteria 10220
372 Ga0495626_0005288 3300048091 Bacteria 7621
373 Ga0495626_0012060 3300048091 Bacteria 4547
374 Ga0495626_0012228 3300048091 Bacteria 4506
375 Ga0495626_0015366 3300048091 Bacteria 3922
376 Ga0495626_0093976 3300048091 Bacteria 1315
377 Ga0495626_0194201 3300048091 Bacteria 835
378 Ga0495626_0222735 3300048091 Bacteria 766
379 Ga0496102_0175900 3300048905 Bacteria 2015
380 Ga0496106_0022475 3300048909 Bacteria 4686
381 Ga0496106_0062637 3300048909 Bacteria 2825
382 Ga0496107_0029464 3300048910 Bacteria 3905
383 Ga0496107_0070147 3300048910 Bacteria 2544
384 Ga0496110_0000007 3300048913 Bacteria 114271
385 Ga0496110_0001834 3300048913 Bacteria 15666
386 Ga0496111_0029712 3300048914 Bacteria 3883
387 Ga0496111_0760913 3300048914 Bacteria 702
388 Ga0496115_0032229 3300048918 Bacteria 4134
389 Ga0496123_0002198 3300048926 Bacteria 24822
390 Ga0495678_000024 3300049459 Bacteria 229034
391 Ga0495678_000035 3300049459 Bacteria 200957
392 Ga0495678_020732 3300049459 Bacteria 2903
393 Ga0495682_0000365 3300049460 Bacteria 32900
394 Ga0495682_0003650 3300049460 Bacteria 6783
395 Ga0495682_0009487 3300049460 Bacteria 3797
396 Ga0495682_0013363 3300049460 Bacteria 3128
397 Ga0495682_0016084 3300049460 Bacteria 2830
398 Ga0495682_0254902 3300049460 Bacteria 620
399 nmdc:mga0rr50_696309_c1 3300050513 Bacteria 867
400 nmdc:mga08x19_387451_c1 3300050514 Bacteria 979
401 Ga0587083_0058271 3300059505 Bacteria 863
402 Ga0587076_099591 3300059645 Bacteria 647
403 Ga0495626_0004911
404 Ga0070658_10002076
405 Ga0070683_100060143
406 Ga0070680_100108141
407 Ga0070680_100340716
408 Ga0070660_100007080
409 Ga0070660_100088823
410 Ga0070691_10062719
411 Ga0070661_100026801
412 Ga0070669_100900918
413 Ga0070659_100014092
414 Ga0070659_100028994
415 Ga0070659_100286708
416 Ga0070714_100029991
417 Ga0070714_100723143
418 Ga0070713_101076091
419 Ga0070711_100390332
420 Ga0070663_100017261
421 Ga0070662_100306427
422 Ga0070699_100026859
423 Ga0070699_100258674
424 Ga0070679_100110868
425 Ga0070679_100207224
426 Ga0070679_100666793
427 Ga0070684_100124537
428 Ga0070684_101808612
429 Ga0068853_100090053
430 Ga0070693_100267325
431 Ga0068855_100161415
432 Ga0068855_100860589
433 Ga0070664_100014971
434 Ga0068854_100011319
435 Ga0068856_100009042
436 Ga0068856_100323196
437 Ga0068852_100066940
438 Ga0068852_100407303
439 Ga0068861_100150874
440 Ga0068851_10003311
441 Ga0075434_100316522
442 Ga0068865_100904212
443 Ga0075436_100134526
444 Ga0075435_100768747
445 Ga0105240_10021532
446 Ga0105240_10035370
447 Ga0105240_10269429
448 Ga0105237_10050202
449 Ga0105237_10100596
450 Ga0105238_10007768
451 Ga0105239_10039353
452 Ga0105246_10224139
453 Ga0157373_10003436
454 Ga0157371_10185045
455 Ga0157370_10015767
456 Ga0157370_10022974
457 Ga0157370_10030981
458 Ga0157369_10011852
459 Ga0157369_10153036
460 Ga0157369_10233497
461 Ga0163162_10377784
462 Ga0157372_10151972
463 Ga0157372_10157395
464 Ga0157372_10203380
465 Ga0157372_10887361
466 Ga0157372_13128600
467 Ga0206354_11164308
468 Ga0206353_11882268
469 Ga0154015_1157659
470 Ga0209148_1001112
471 Ga0207656_10055888
472 Ga0207699_10058882
473 Ga0207705_10068339
474 Ga0207705_10070481
475 Ga0207705_10521444
476 Ga0207654_10040766
477 Ga0207707_10037804
478 Ga0207707_11026133
479 Ga0207695_10011934
480 Ga0207695_10097547
481 Ga0207695_10157410
482 Ga0207671_10404360
483 Ga0207663_10712864
484 Ga0207660_10313531
485 Ga0207660_10924337
486 Ga0207657_10000545
487 Ga0207657_10052623
488 Ga0207657_10265475
489 Ga0207657_10742799
490 Ga0207649_10145325
491 Ga0207652_10008437
492 Ga0207652_10356692
493 Ga0207681_10749278
494 Ga0207694_10012386
495 Ga0207700_10065423
496 Ga0207664_10109183
497 Ga0207664_10637783
498 Ga0207690_10141926
499 Ga0207690_10208815
500 Ga0207706_10052388
501 Ga0207706_10398472
502 Ga0207704_11153655
503 Ga0207661_10110199
504 Ga0207679_10113505
505 Ga0207667_10001020
506 Ga0207667_10126173
507 Ga0207667_10366030
508 Ga0207667_10615881
509 Ga0207640_10302226
510 Ga0207639_10010534
511 Ga0207639_11629099
512 Ga0207678_10003081
513 Ga0207702_10135908
514 Ga0207674_10000599
515 Ga0207675_100134028
516 Ga0207698_10112848
517 Ga0395899_0026998
518 Ga0395899_0122023
519 Ga0395899_0157342
520 Ga0395899_0425312
521 Ga0395900_0012300
522 Ga0395900_0127107
523 Ga0395900_0296446
524 Ga0395900_0832794
525 Ga0395898_0038891
526 Ga0395898_0159638
527 Ga0395898_0488586
528 Ga0395898_1176580
529 Ga0395905_0079235
530 Ga0395905_0163803
531 Ga0395905_0202361
532 Ga0395905_0398216
533 Ga0395901_0006544
534 Ga0395901_0300761
535 Ga0395901_0437424
536 Ga0495617_000012
537 Ga0495617_073620
538 Ga0495627_000118
539 Ga0495590_0000013
540 Ga0495590_0006583
541 Ga0495590_0014062
542 Ga0495591_000109
543 Ga0495591_007355
544 Ga0495638_0208487
545 Ga0495638_0566511
546 Ga0495605_0000072
547 Ga0495605_0004941
548 Ga0495605_0013762
549 Ga0495605_0043984
550 Ga0495605_0106852
551 Ga0495605_0193687
552 Ga0495584_0000029
553 Ga0495584_0000791
554 Ga0495584_0261695
555 Ga0495585_0000048
556 Ga0495585_0007053
557 Ga0495585_0210512
558 Ga0495585_0275651
559 Ga0495594_0050157
560 Ga0495596_0000243
561 Ga0495596_0000309
562 Ga0495596_0003025
563 Ga0495596_0003935
564 Ga0495596_0020735
565 Ga0495596_0023664
566 Ga0495596_0025081
567 Ga0495596_0025461
568 Ga0495596_0094711
569 Ga0495607_0002120
570 Ga0495607_0002863
571 Ga0495607_0005992
572 Ga0495607_0008378
573 Ga0495607_0013962
574 Ga0495607_0017736
575 Ga0495607_0032051
576 Ga0495583_0000463
577 Ga0495583_0000697
578 Ga0495583_0001770
579 Ga0495583_0011831
580 Ga0495583_0028892
581 Ga0495583_0097507
582 Ga0495606_0018958
583 Ga0495606_0039782
584 Ga0495606_0074336
585 Ga0495610_0004903
586 Ga0495616_0000131
587 Ga0495616_0000238
588 Ga0495616_0000388
589 Ga0495616_0001928
590 Ga0495616_0020509
591 Ga0495616_0022267
592 Ga0495616_0067250
593 Ga0495616_0123675
594 Ga0495616_0192586
595 Ga0495616_0390288
596 Ga0495631_0000737
597 Ga0495631_0002673
598 Ga0495631_0004913
599 Ga0495631_0017067
600 Ga0495631_0023136
601 Ga0495631_0039124
602 Ga0495631_0115584
603 Ga0495631_0161327
604 Ga0495632_0000116
605 Ga0495632_0000156
606 Ga0495632_0000853
607 Ga0495632_0001593
608 Ga0495632_0003692
609 Ga0495632_0014760
610 Ga0495632_0024852
611 Ga0495632_0064615
612 Ga0495637_0000008
613 Ga0495637_0051725
614 Ga0495637_0057590
615 Ga0495637_0065149
616 Ga0495643_0000121
617 Ga0495643_0005225
618 Ga0495643_0006816
619 Ga0495643_0014186
620 Ga0495643_0028165
621 Ga0495643_0066303
622 Ga0495643_0091543
623 Ga0495643_0295619
624 Ga0495644_0007278
625 Ga0495644_0027243
626 Ga0495644_0075377
627 Ga0495648_0000116
628 Ga0495648_0005481
629 Ga0495648_0007837
630 Ga0495648_0040184
631 Ga0495648_0047558
632 Ga0495648_0183606
633 Ga0495648_0385232
634 Ga0495666_0002015
635 Ga0495666_0029471
636 Ga0495642_0000010
637 Ga0495642_0000459
638 Ga0495642_0002240
639 Ga0495642_0024702
640 Ga0495642_0029050
641 Ga0495642_0435014
642 Ga0495654_0005595
643 Ga0495654_0052292
644 Ga0495654_0067621
645 Ga0495654_0185286
646 Ga0495665_0001347
647 Ga0495665_0015551
648 Ga0495587_0001570
649 Ga0495609_0007564
650 Ga0495609_0008690
651 Ga0495609_0023384
652 Ga0495609_0060136
653 Ga0495609_0088079
654 Ga0495609_0172417
655 Ga0495597_0010574
656 Ga0495597_0014466
657 Ga0495597_0019080
658 Ga0495597_0027852
659 Ga0495597_0161830
660 Ga0495645_0023835
661 Ga0495622_0001500
662 Ga0495633_0000874
663 Ga0495633_0056515
664 Ga0495633_0071954
665 Ga0495633_0100581
666 Ga0495633_0150743
667 Ga0495656_0006750
668 Ga0495656_0025576
669 Ga0495668_0000006
670 Ga0495668_0000532
671 Ga0495668_0000733
672 Ga0495668_0002189
673 Ga0495668_0006228
674 Ga0495668_0033857
675 Ga0495668_0057870
676 Ga0495611_0001733
677 Ga0495611_0003086
678 Ga0495611_0004803
679 Ga0495611_0027979
680 Ga0495611_0295649
681 Ga0495625_0010704
682 Ga0495625_0031882
683 Ga0495625_0248641
684 Ga0495661_0002259
685 Ga0495661_0002490
686 Ga0495661_0006159
687 Ga0495661_0029945
688 Ga0495661_0045398
689 Ga0495661_0045480
690 Ga0495661_0057941
691 Ga0495661_0076096
692 Ga0495661_0077806
693 Ga0495661_0102008
694 Ga0495661_0127387
695 Ga0495661_0169331
696 Ga0495661_0183386
697 Ga0495661_0225848
698 Ga0495588_0000052
699 Ga0495588_0002966
700 Ga0495588_0028372
701 Ga0495588_0041932
702 Ga0495669_0019563
703 Ga0495669_0031167
704 Ga0495669_0038224
705 Ga0495669_0070220
706 Ga0495669_0075459
707 Ga0495669_0373973
708 Ga0495613_0053263
709 Ga0495670_0052918
710 Ga0495670_0082147
711 Ga0495671_0000092
712 Ga0495671_0000484
713 Ga0495671_0000792
714 Ga0495671_0010833
715 Ga0495671_0089259
716 Ga0495649_0000071
717 Ga0495649_0053926
718 Ga0495649_0113801
719 Ga0495589_0000115
720 Ga0495589_0000654
721 Ga0495589_0001477
722 Ga0495589_0017199
723 Ga0495589_0021653
724 Ga0495589_0057789
725 Ga0495660_0000218
726 Ga0495660_0005717
727 Ga0495660_0012774
728 Ga0495660_0022574
729 Ga0495660_0052663
730 Ga0495660_0065234
731 Ga0495660_0079790
732 Ga0495660_0110962
733 Ga0495581_0009228
734 Ga0495636_0024252
735 Ga0495636_0245293
736 Ga0495672_0000033
737 Ga0495672_0001570
738 Ga0495672_0004983
739 Ga0495683_0000168
740 Ga0495683_0054425
741 Ga0495683_0385510
742 Ga0495687_000067
743 Ga0495687_000086
744 Ga0495677_0000584
745 Ga0495677_0000985
746 Ga0495677_0002359
747 Ga0495677_0004949
748 Ga0495677_0028233
749 Ga0495677_0029100
750 Ga0495677_0041935
751 Ga0495677_0187111
752 Ga0495679_004238
753 Ga0495679_008936
754 Ga0495679_016875
755 Ga0495685_004815
756 Ga0495685_084471
757 Ga0495685_094758
758 Ga0495673_0087886
759 Ga0495681_0001730
760 Ga0495681_0010130
761 Ga0495681_0025432
762 Ga0495681_0050902
763 Ga0495681_0112969
764 Ga0495681_0113617
765 Ga0495686_0000431
766 Ga0495686_0021849
767 Ga0495686_0094887
768 Ga0495686_0135666
769 Ga0495686_0155285
770 Ga0495593_0069368
771 Ga0495626_0000011
772 Ga0495626_0001550
773 Ga0495626_0003408
774 Ga0495626_0005288
775 Ga0495626_0012060
776 Ga0495626_0012228
777 Ga0495626_0015366
778 Ga0495626_0093976
779 Ga0495626_0194201
780 Ga0495626_0222735
781 Ga0496102_0175900
782 Ga0496106_0022475
783 Ga0496106_0062637
784 Ga0496107_0029464
785 Ga0496107_0070147
786 Ga0496110_0000007
787 Ga0496110_0001834
788 Ga0496111_0029712
789 Ga0496111_0760913
790 Ga0496115_0032229
791 Ga0496123_0002198
792 Ga0495678_000024
793 Ga0495678_000035
794 Ga0495678_020732
795 Ga0495682_0000365
796 Ga0495682_0003650
797 Ga0495682_0009487
798 Ga0495682_0013363
799 Ga0495682_0016084
800 Ga0495682_0254902
801 nmdc:mga0rr50_696309_c1
802 nmdc:mga08x19_387451_c1
803 Ga0587083_0058271
804 Ga0587076_099591

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07681

DoxX

DoxX

33

107

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dgu-assembly1.cif.gz_A de novo designed protein h4a1r 0.5292 21 131
7dgu-assembly1.cif.gz_A de novo designed protein h4a1r 0.5089 21 131
2rld-assembly1.cif.gz_A crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.4786 18 131
7jpv-assembly1.cif.gz_E rabbit cav1.1 in the presence of 1 micromolar (s)-(-)-bay k8644 in nanodiscs at 3.4 angstrom resolution 0.4767 22 130
2rld-assembly1.cif.gz_A crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.4501 18 131
ID Description Score Start End Superfamily
af_Q9VRE4_271_372_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7659 81 130 1.20.120.550
af_Q7KSM4_10_156_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6902 11 131 1.20.120.550
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6841 19 130 1.10.10.1740
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6361 19 130 1.10.10.1740
af_A0A1D6HRG8_1_138_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6278 22 131 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A1M7YAC6-F1-model_v4 Putative oxidoreductase 0.9172 18 138 GO:0005886
AF-A0A328YTP2-F1-model_v4 Putative membrane protein YphA (DoxX/SURF4 family) 0.9169 2 146 GO:0005886
AF-A0A3N1WZY1-F1-model_v4 Putative oxidoreductase 0.9119 18 138 GO:0005886
AF-D5V2U8-F1-model_v4 DoxX family protein 0.9113 14 138 GO:0005886
AF-A0A7C5D8Z5-F1-model_v4 DoxX family protein 0.9084 18 138 GO:0005886

Map