F435112

General Info

Members Datasets Scaffolds Average Seq Length
402 181 804 223

Family's Representative Sequence

Representative Sequence 3300026116|Ga0207674_10505617|Ga0207674_105056171
Length 240
Sequence MGTPSIAAAKEAPPGSSSSCHCPGRSAILLKAVMAVTGLILFGFTFVHMVGNLLVFLPPEAINSYGYLLHHSGIHGLTLIWPFRIFLLAAAVAHIVAAIVLTKRNRAARPVAYAEIKPNGATLASRTMFVGGLVLAVFIVFHILHFTTGTIRPAGTFEEGNVYSNVVASFRIWWVVLFYVIAMAFLGLHLYHGAWSSVRTLGATGESPDPFHRRASATLAILVWLGFTLVPLAVFFGLVG

Samples

Sample ID Description Type Environment
1 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
144 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
145 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
158 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
159 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
160 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
172 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
179 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
180 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
181 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.75
Rhizosphere 98.51
Stem 0
Stem Tuber 0
Unclassified 1.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207674_10505617 3300026116 Bacteria 1167
2 rootH2_10127106 3300003320 Bacteria 1291
3 Ga0065712_10253350 3300005290 Bacteria 954
4 Ga0070658_10002750 3300005327 Bacteria 14643
5 Ga0070658_10026394 3300005327 Bacteria 4659
6 Ga0070658_10032863 3300005327 Bacteria 4172
7 Ga0070658_10073239 3300005327 Bacteria 2808
8 Ga0070658_10287089 3300005327 Bacteria 1402
9 Ga0070658_10361807 3300005327 Bacteria 1243
10 Ga0070658_10505873 3300005327 Bacteria 1044
11 Ga0070676_10008428 3300005328 Bacteria 5558
12 Ga0070683_100002847 3300005329 Bacteria 13848
13 Ga0070683_100017988 3300005329 Bacteria 6250
14 Ga0070683_100037195 3300005329 Bacteria 4456
15 Ga0070683_100037586 3300005329 Bacteria 4432
16 Ga0070683_100077735 3300005329 Bacteria 3104
17 Ga0070683_100131677 3300005329 Bacteria 2367
18 Ga0070683_100167832 3300005329 Bacteria 2083
19 Ga0070683_100199775 3300005329 Bacteria 1899
20 Ga0070683_101133429 3300005329 Bacteria 751
21 Ga0070690_100230009 3300005330 Bacteria 1303
22 Ga0070670_100035854 3300005331 Bacteria 4270
23 Ga0070670_100261160 3300005331 Bacteria 1510
24 Ga0070670_100411702 3300005331 Bacteria 1195
25 Ga0070677_10049752 3300005333 Bacteria 1689
26 Ga0070680_100002545 3300005336 Bacteria 13484
27 Ga0070680_100010843 3300005336 Bacteria 7037
28 Ga0070680_100036228 3300005336 Bacteria 3985
29 Ga0070680_100112330 3300005336 Bacteria 2269
30 Ga0070680_100122326 3300005336 Bacteria 2173
31 Ga0070680_100122756 3300005336 Bacteria 2169
32 Ga0070680_100171324 3300005336 Bacteria 1827
33 Ga0070680_100208891 3300005336 Bacteria 1647
34 Ga0070680_100237339 3300005336 Bacteria 1541
35 Ga0070680_100412615 3300005336 Bacteria 1152
36 Ga0070680_100527079 3300005336 Bacteria 1012
37 Ga0070682_100245343 3300005337 Bacteria 1288
38 Ga0070682_100287302 3300005337 Bacteria 1201
39 Ga0068868_100011964 3300005338 Bacteria 6332
40 Ga0070660_100007429 3300005339 Bacteria 7637
41 Ga0070660_100156823 3300005339 Bacteria 1832
42 Ga0070660_100197423 3300005339 Bacteria 1631
43 Ga0070660_100415985 3300005339 Bacteria 1113
44 Ga0070660_100416856 3300005339 Bacteria 1112
45 Ga0070660_100552338 3300005339 Bacteria 961
46 Ga0070689_100137399 3300005340 Bacteria 1963
47 Ga0070691_10018487 3300005341 Bacteria 3214
48 Ga0070687_100025891 3300005343 Bacteria 2818
49 Ga0070661_100009638 3300005344 Bacteria 6693
50 Ga0070661_100014592 3300005344 Bacteria 5538
51 Ga0070668_100101556 3300005347 Bacteria 2279
52 Ga0070669_100015564 3300005353 Bacteria 5424
53 Ga0070675_100034038 3300005354 Bacteria 4133
54 Ga0070675_100155273 3300005354 Bacteria 1964
55 Ga0070674_100121558 3300005356 Bacteria 1934
56 Ga0070673_100125214 3300005364 Bacteria 2149
57 Ga0070673_100205722 3300005364 Bacteria 1697
58 Ga0070673_100269911 3300005364 Bacteria 1489
59 Ga0070688_100009037 3300005365 Bacteria 5432
60 Ga0070659_100023234 3300005366 Bacteria 4742
61 Ga0070659_100051143 3300005366 Bacteria 3248
62 Ga0070659_100110129 3300005366 Bacteria 2223
63 Ga0070659_100590018 3300005366 Bacteria 954
64 Ga0070667_100316107 3300005367 Bacteria 1408
65 Ga0070667_100345125 3300005367 Bacteria 1347
66 Ga0070714_100005085 3300005435 Bacteria 10008
67 Ga0070714_100010120 3300005435 Bacteria 7445
68 Ga0070714_100051854 3300005435 Bacteria 3498
69 Ga0070714_100345321 3300005435 Bacteria 1397
70 Ga0070713_100185929 3300005436 Bacteria 1870
71 Ga0070705_100081655 3300005440 Bacteria 1987
72 Ga0070694_100239447 3300005444 Bacteria 1368
73 Ga0070708_100000086 3300005445 Bacteria 61026
74 Ga0070708_100006652 3300005445 Bacteria 9204
75 Ga0070708_100029066 3300005445 Bacteria 4764
76 Ga0070681_10000631 3300005458 Bacteria 28933
77 Ga0070681_10024256 3300005458 Bacteria 6105
78 Ga0070681_10234794 3300005458 Bacteria 1748
79 Ga0070681_10299049 3300005458 Bacteria 1519
80 Ga0070681_10316993 3300005458 Bacteria 1469
81 Ga0070681_10849187 3300005458 Bacteria 831
82 Ga0068867_100022809 3300005459 Bacteria 4479
83 Ga0070685_10040284 3300005466 Bacteria 2657
84 Ga0070707_100002230 3300005468 Bacteria 18506
85 Ga0070707_100003354 3300005468 Bacteria 15121
86 Ga0070707_100110643 3300005468 Bacteria 2664
87 Ga0070698_100026756 3300005471 Bacteria 6001
88 Ga0070698_100434250 3300005471 Bacteria 1248
89 Ga0070699_100001800 3300005518 Bacteria 19483
90 Ga0070699_100001873 3300005518 Bacteria 19028
91 Ga0070699_100017055 3300005518 Bacteria 6237
92 Ga0070699_100100152 3300005518 Bacteria 2540
93 Ga0070679_100012489 3300005530 Bacteria 8119
94 Ga0070679_100013710 3300005530 Bacteria 7765
95 Ga0070679_100013982 3300005530 Bacteria 7692
96 Ga0070679_100015417 3300005530 Bacteria 7345
97 Ga0070679_100081389 3300005530 Bacteria 3227
98 Ga0070679_100130386 3300005530 Bacteria 2495
99 Ga0070679_100222851 3300005530 Bacteria 1847
100 Ga0070679_100422696 3300005530 Bacteria 1278
101 Ga0070679_100472674 3300005530 Bacteria 1198
102 Ga0070679_100593676 3300005530 Bacteria 1051
103 Ga0070679_100602788 3300005530 Bacteria 1042
104 Ga0070684_100035660 3300005535 Bacteria 4258
105 Ga0070684_100037570 3300005535 Bacteria 4155
106 Ga0070684_100278013 3300005535 Bacteria 1534
107 Ga0070684_100309105 3300005535 Bacteria 1451
108 Ga0070684_100343711 3300005535 Bacteria 1372
109 Ga0070684_100439231 3300005535 Bacteria 1205
110 Ga0070684_100521309 3300005535 Bacteria 1101
111 Ga0070684_100596847 3300005535 Bacteria 1026
112 Ga0070697_100023901 3300005536 Bacteria 4863
113 Ga0070697_100112981 3300005536 Bacteria 2265
114 Ga0068853_100206189 3300005539 Bacteria 1790
115 Ga0068853_100223400 3300005539 Bacteria 1721
116 Ga0068853_100500471 3300005539 Bacteria 1147
117 Ga0070672_100441498 3300005543 Bacteria 1120
118 Ga0070672_100568133 3300005543 Bacteria 986
119 Ga0070686_100300020 3300005544 Bacteria 1191
120 Ga0070696_100001356 3300005546 Bacteria 15966
121 Ga0070696_100031934 3300005546 Bacteria 3610
122 Ga0070696_100052842 3300005546 Bacteria 2827
123 Ga0070696_100328986 3300005546 Bacteria 1178
124 Ga0070693_100001694 3300005547 Bacteria 10007
125 Ga0068855_100014675 3300005563 Bacteria 9436
126 Ga0068855_100527388 3300005563 Bacteria 1280
127 Ga0070664_100130085 3300005564 Bacteria 2210
128 Ga0070664_100413560 3300005564 Bacteria 1234
129 Ga0068857_100010305 3300005577 Bacteria 8120
130 Ga0068857_100106689 3300005577 Bacteria 2515
131 Ga0068857_100270406 3300005577 Bacteria 1562
132 Ga0068854_100003624 3300005578 Bacteria 9663
133 Ga0068854_100088314 3300005578 Bacteria 2302
134 Ga0068854_100161329 3300005578 Bacteria 1736
135 Ga0068852_100011526 3300005616 Bacteria 6661
136 Ga0068852_100015514 3300005616 Bacteria 5913
137 Ga0068852_100059662 3300005616 Bacteria 3309
138 Ga0068852_100101026 3300005616 Bacteria 2603
139 Ga0068852_100113713 3300005616 Bacteria 2465
140 Ga0068852_100230565 3300005616 Bacteria 1765
141 Ga0068852_100910499 3300005616 Unclassified 897
142 Ga0068852_100958449 3300005616 Bacteria 874
143 Ga0068859_100005447 3300005617 Bacteria 12941
144 Ga0068864_100034740 3300005618 Bacteria 4289
145 Ga0068866_10164688 3300005718 Bacteria 1296
146 Ga0068858_100145977 3300005842 Bacteria 2222
147 Ga0068862_100330157 3300005844 Bacteria 1410
148 Ga0068871_100564956 3300006358 Unclassified 1032
149 Ga0075428_100696032 3300006844 Bacteria 1083
150 Ga0075431_100158297 3300006847 Bacteria 2330
151 Ga0075429_100915422 3300006880 Unclassified 767
152 Ga0068865_100260085 3300006881 Bacteria 1374
153 Ga0075436_100012271 3300006914 Bacteria 5871
154 Ga0075436_100097770 3300006914 Bacteria 2042
155 Ga0097620_100005447 3300006931 Bacteria 12941
156 Ga0075435_100239130 3300007076 Bacteria 1544
157 Ga0105240_10003569 3300009093 Bacteria 24134
158 Ga0105240_10150265 3300009093 Bacteria 2775
159 Ga0105240_10259890 3300009093 Bacteria 2003
160 Ga0105240_10343705 3300009093 Bacteria 1694
161 Ga0105240_10468639 3300009093 Bacteria 1406
162 Ga0105240_10476314 3300009093 Bacteria 1392
163 Ga0105240_10542332 3300009093 Bacteria 1288
164 Ga0111539_10679105 3300009094 Bacteria 1199
165 Ga0105247_10207921 3300009101 Bacteria 1319
166 Ga0105243_10311822 3300009148 Bacteria 1430
167 Ga0105243_10389961 3300009148 Bacteria 1291
168 Ga0105241_10000025 3300009174 Bacteria 132929
169 Ga0105241_10180560 3300009174 Bacteria 1750
170 Ga0105241_10258702 3300009174 Bacteria 1479
171 Ga0105241_10855722 3300009174 Bacteria 841
172 Ga0105242_10013123 3300009176 Bacteria 6393
173 Ga0105242_10787037 3300009176 Bacteria 940
174 Ga0105248_10115345 3300009177 Bacteria 3030
175 Ga0105248_10230700 3300009177 Bacteria 2084
176 Ga0105237_10109403 3300009545 Bacteria 2755
177 Ga0105238_10010734 3300009551 Bacteria 9200
178 Ga0105238_10201585 3300009551 Bacteria 1965
179 Ga0105238_10333908 3300009551 Bacteria 1503
180 Ga0105238_10429065 3300009551 Bacteria 1317
181 Ga0105249_10000078 3300009553 Bacteria 140030
182 Ga0105239_10651435 3300010375 Bacteria 1203
183 Ga0105246_10281258 3300011119 Bacteria 1335
184 Ga0157373_10000736 3300013100 Bacteria 25407
185 Ga0157373_10097945 3300013100 Bacteria 2064
186 Ga0157373_10183302 3300013100 Bacteria 1474
187 Ga0157371_10020647 3300013102 Bacteria 4845
188 Ga0157370_10001847 3300013104 Bacteria 26111
189 Ga0157370_10146038 3300013104 Bacteria 2203
190 Ga0157370_10183322 3300013104 Bacteria 1945
191 Ga0157370_10231181 3300013104 Bacteria 1711
192 Ga0157370_10378340 3300013104 Bacteria 1304
193 Ga0157370_10388117 3300013104 Bacteria 1286
194 Ga0157369_10011508 3300013105 Bacteria 10050
195 Ga0157369_10040781 3300013105 Bacteria 5068
196 Ga0157369_10065317 3300013105 Bacteria 3916
197 Ga0157369_10130123 3300013105 Bacteria 2668
198 Ga0157369_10169371 3300013105 Bacteria 2302
199 Ga0157369_10193988 3300013105 Bacteria 2133
200 Ga0157369_10672014 3300013105 Bacteria 1067
201 Ga0157378_10195153 3300013297 Bacteria 1912
202 Ga0157378_10215389 3300013297 Bacteria 1823
203 Ga0163162_10626415 3300013306 Bacteria 1201
204 Ga0163162_10647666 3300013306 Bacteria 1180
205 Ga0163162_10992121 3300013306 Bacteria 949
206 Ga0157372_10003298 3300013307 Bacteria 17437
207 Ga0157372_10019480 3300013307 Bacteria 7315
208 Ga0157372_10024605 3300013307 Bacteria 6544
209 Ga0157372_10048925 3300013307 Bacteria 4699
210 Ga0157372_10055016 3300013307 Bacteria 4442
211 Ga0157372_10074002 3300013307 Bacteria 3840
212 Ga0157372_10085771 3300013307 Bacteria 3572
213 Ga0157372_10216354 3300013307 Bacteria 2221
214 Ga0157372_11141491 3300013307 Bacteria 901
215 Ga0157372_11149878 3300013307 Bacteria 897
216 Ga0157375_10232396 3300013308 Bacteria 2003
217 Ga0157375_10330610 3300013308 Bacteria 1689
218 Ga0157375_10399318 3300013308 Bacteria 1541
219 Ga0163163_10533196 3300014325 Bacteria 1236
220 Ga0182008_10003891 3300014497 Bacteria 8858
221 Ga0157377_10026718 3300014745 Bacteria 3092
222 Ga0157379_10317898 3300014968 Bacteria 1421
223 Ga0157376_10098287 3300014969 Bacteria 2552
224 Ga0207682_10044830 3300025893 Bacteria 1814
225 Ga0207642_10230350 3300025899 Bacteria 1040
226 Ga0207699_10121108 3300025906 Bacteria 1692
227 Ga0207645_10014559 3300025907 Bacteria 5262
228 Ga0207705_10001197 3300025909 Bacteria 21028
229 Ga0207705_10001680 3300025909 Bacteria 17619
230 Ga0207705_10020801 3300025909 Bacteria 4683
231 Ga0207705_10270207 3300025909 Bacteria 1300
232 Ga0207705_10360871 3300025909 Bacteria 1120
233 Ga0207705_10503526 3300025909 Bacteria 941
234 Ga0207654_10002010 3300025911 Bacteria 10453
235 Ga0207654_10206285 3300025911 Bacteria 1297
236 Ga0207654_10367029 3300025911 Bacteria 994
237 Ga0207707_10000450 3300025912 Bacteria 42820
238 Ga0207707_10004865 3300025912 Bacteria 11787
239 Ga0207707_10007906 3300025912 Bacteria 9249
240 Ga0207707_10078325 3300025912 Bacteria 2886
241 Ga0207707_10199385 3300025912 Bacteria 1745
242 Ga0207707_10212647 3300025912 Bacteria 1684
243 Ga0207707_10340130 3300025912 Bacteria 1294
244 Ga0207707_10626863 3300025912 Bacteria 908
245 Ga0207707_10705901 3300025912 Bacteria 847
246 Ga0207695_10001853 3300025913 Bacteria 33132
247 Ga0207695_10002468 3300025913 Bacteria 27266
248 Ga0207695_10005733 3300025913 Bacteria 16362
249 Ga0207695_10021940 3300025913 Bacteria 7267
250 Ga0207695_10023378 3300025913 Bacteria 6984
251 Ga0207695_10205956 3300025913 Bacteria 1880
252 Ga0207695_10427023 3300025913 Bacteria 1209
253 Ga0207671_10322322 3300025914 Bacteria 1223
254 Ga0207660_10000275 3300025917 Bacteria 33934
255 Ga0207660_10002553 3300025917 Bacteria 11968
256 Ga0207660_10015844 3300025917 Bacteria 4982
257 Ga0207660_10039326 3300025917 Bacteria 3306
258 Ga0207660_10044865 3300025917 Bacteria 3111
259 Ga0207660_10055702 3300025917 Bacteria 2827
260 Ga0207660_10207710 3300025917 Bacteria 1532
261 Ga0207660_10331481 3300025917 Bacteria 1217
262 Ga0207660_10474874 3300025917 Bacteria 1013
263 Ga0207662_10008178 3300025918 Bacteria 5720
264 Ga0207657_10012430 3300025919 Bacteria 8409
265 Ga0207657_10038904 3300025919 Bacteria 4229
266 Ga0207657_10049738 3300025919 Bacteria 3650
267 Ga0207657_10220120 3300025919 Bacteria 1521
268 Ga0207649_10377135 3300025920 Bacteria 1056
269 Ga0207652_10000841 3300025921 Bacteria 29282
270 Ga0207652_10009836 3300025921 Bacteria 7697
271 Ga0207652_10021570 3300025921 Bacteria 5316
272 Ga0207652_10072293 3300025921 Bacteria 2999
273 Ga0207652_10090478 3300025921 Bacteria 2689
274 Ga0207652_10197541 3300025921 Bacteria 1810
275 Ga0207652_10201645 3300025921 Bacteria 1790
276 Ga0207652_10340980 3300025921 Bacteria 1353
277 Ga0207652_10362242 3300025921 Bacteria 1309
278 Ga0207652_10369481 3300025921 Bacteria 1295
279 Ga0207652_10437835 3300025921 Bacteria 1179
280 Ga0207652_10477819 3300025921 Bacteria 1123
281 Ga0207646_10018644 3300025922 Bacteria 6470
282 Ga0207646_10250501 3300025922 Bacteria 1600
283 Ga0207694_10171445 3300025924 Bacteria 1757
284 Ga0207650_10041260 3300025925 Bacteria 3380
285 Ga0207659_10079170 3300025926 Bacteria 2424
286 Ga0207664_10010523 3300025929 Bacteria 6533
287 Ga0207664_10022173 3300025929 Bacteria 4737
288 Ga0207664_10100935 3300025929 Bacteria 2383
289 Ga0207664_10172807 3300025929 Bacteria 1850
290 Ga0207664_10612966 3300025929 Bacteria 978
291 Ga0207644_10268923 3300025931 Bacteria 1365
292 Ga0207690_10043830 3300025932 Bacteria 2946
293 Ga0207690_10052306 3300025932 Bacteria 2735
294 Ga0207690_10062338 3300025932 Bacteria 2538
295 Ga0207690_10094145 3300025932 Bacteria 2125
296 Ga0207706_10264517 3300025933 Bacteria 1501
297 Ga0207706_10317397 3300025933 Bacteria 1356
298 Ga0207686_10026358 3300025934 Bacteria 3390
299 Ga0207709_10041469 3300025935 Bacteria 2762
300 Ga0207670_10019380 3300025936 Bacteria 4155
301 Ga0207669_10040307 3300025937 Bacteria 2708
302 Ga0207669_10394741 3300025937 Bacteria 1082
303 Ga0207704_10388433 3300025938 Bacteria 1098
304 Ga0207691_10004754 3300025940 Bacteria 13127
305 Ga0207691_10085456 3300025940 Bacteria 2831
306 Ga0207691_10225212 3300025940 Bacteria 1625
307 Ga0207711_10061030 3300025941 Bacteria 3250
308 Ga0207689_10694754 3300025942 Bacteria 858
309 Ga0207661_10000396 3300025944 Bacteria 28141
310 Ga0207661_10010350 3300025944 Bacteria 6712
311 Ga0207661_10012334 3300025944 Bacteria 6209
312 Ga0207661_10052868 3300025944 Bacteria 3247
313 Ga0207661_10090331 3300025944 Bacteria 2550
314 Ga0207661_10189729 3300025944 Bacteria 1801
315 Ga0207661_10529090 3300025944 Unclassified 1079
316 Ga0207679_10022560 3300025945 Bacteria 4290
317 Ga0207679_10076686 3300025945 Bacteria 2541
318 Ga0207679_10083993 3300025945 Bacteria 2443
319 Ga0207679_10159044 3300025945 Bacteria 1847
320 Ga0207667_10207614 3300025949 Bacteria 2008
321 Ga0207667_10235198 3300025949 Bacteria 1875
322 Ga0207667_10361392 3300025949 Bacteria 1480
323 Ga0207651_10106325 3300025960 Bacteria 2095
324 Ga0207651_10323808 3300025960 Unclassified 1289
325 Ga0207651_10587236 3300025960 Bacteria 972
326 Ga0207651_10785327 3300025960 Bacteria 843
327 Ga0207712_10000079 3300025961 Bacteria 115164
328 Ga0207640_10000433 3300025981 Bacteria 25514
329 Ga0207658_10225213 3300025986 Bacteria 1580
330 Ga0207677_10512304 3300026023 Bacteria 1039
331 Ga0207678_10212576 3300026067 Bacteria 1655
332 Ga0207708_10006221 3300026075 Bacteria 8845
333 Ga0207648_10011010 3300026089 Bacteria 8540
334 Ga0207674_10011748 3300026116 Bacteria 9825
335 Ga0207674_10012406 3300026116 Bacteria 9526
336 Ga0207674_10095692 3300026116 Bacteria 2955
337 Ga0207674_10193657 3300026116 Bacteria 1983
338 Ga0207683_10167239 3300026121 Bacteria 1990
339 Ga0207698_10041472 3300026142 Bacteria 3430
340 Ga0207698_10058851 3300026142 Bacteria 2980
341 Ga0207698_10073547 3300026142 Bacteria 2722
342 Ga0207698_10138501 3300026142 Bacteria 2092
343 Ga0207698_10833224 3300026142 Bacteria 926
344 Ga0209998_10002075 3300027717 Bacteria 4685
345 Ga0209974_10035378 3300027876 Bacteria 1659
346 Ga0268265_10463582 3300028380 Bacteria 1186
347 Ga0268264_10386912 3300028381 Bacteria 1341
348 Ga0307408_100080812 3300031548 Bacteria 2429
349 Ga0307405_10035264 3300031731 Bacteria 2986
350 Ga0307406_10074045 3300031901 Bacteria 2241
351 Ga0307406_10128535 3300031901 Bacteria 1774
352 Ga0307406_10195713 3300031901 Bacteria 1484
353 Ga0307407_10048650 3300031903 Bacteria 2415
354 Ga0307407_10065110 3300031903 Bacteria 2145
355 Ga0307409_100631075 3300031995 Bacteria 1063
356 Ga0307416_100159435 3300032002 Bacteria 2083
357 Ga0436365_0349623 3300039437 Bacteria 2600
358 Ga0451853_2194816 3300041512 Bacteria 1472
359 Ga0466969_0046547 3300044656 Bacteria 2151
360 Ga0453683_0060617 3300044673 Bacteria 2366
361 Ga0453683_0103278 3300044673 Bacteria 1790
362 Ga0466966_0052836 3300044684 Bacteria 2579
363 Ga0466961_0165863 3300044693 Bacteria 1375
364 Ga0466961_0194304 3300044693 Bacteria 1257
365 Ga0466960_0208868 3300044901 Bacteria 1070
366 Ga0466959_0053856 3300045049 Bacteria 2941
367 Ga0495662_0202579 3300046476 Bacteria 978
368 Ga0495586_0175051 3300046535 Bacteria 1213
369 Ga0495587_0065103 3300046536 Bacteria 2129
370 Ga0495667_0034615 3300046559 Bacteria 3377
371 Ga0495588_0171895 3300046674 Bacteria 1145
372 Ga0495613_0025474 3300046689 Bacteria 4407
373 Ga0495581_0079091 3300047315 Bacteria 1903
374 Ga0495604_0062578 3300047317 Bacteria 2842
375 Ga0495636_0018807 3300047318 Bacteria 2773
376 Ga0495675_0111480 3300047444 Bacteria 1708
377 Ga0495614_0155609 3300048089 Bacteria 1021
378 Ga0495615_0061868 3300048090 Bacteria 990
379 Ga0496108_1367172 3300048911 Bacteria 593
380 Ga0496112_0023026 3300048915 Bacteria 5944
381 Ga0496115_0589723 3300048918 Unclassified 885
382 Ga0501033_0082397 3300049570 Bacteria 2359
383 Ga0501034_0044400 3300049571 Bacteria 4496
384 Ga0501034_0625960 3300049571 Bacteria 980
385 Ga0501038_0202855 3300049574 Bacteria 1590
386 Ga0501039_0469583 3300049575 Bacteria 988
387 Ga0501043_0661466 3300049579 Bacteria 766
388 Ga0501047_0510379 3300049581 Bacteria 1028
389 Ga0501048_0128413 3300049582 Bacteria 1793
390 Ga0501070_0092912 3300049586 Bacteria 2497
391 Ga0501070_0139987 3300049586 Bacteria 1998
392 Ga0501070_0461067 3300049586 Bacteria 1024
393 Ga0501207_009434 3300049654 Bacteria 1426
394 Ga0501083_0480292 3300049744 Unclassified 809
395 Ga0501283_030091 3300049779 Bacteria 908
396 Ga0501044_0150726 3300049823 Bacteria 2308
397 nmdc:mga06r32_170756_c1 3300050510 Bacteria 2158
398 nmdc:mga08y16_636467_c1 3300050511 Bacteria 1072
399 nmdc:mga0rr50_180903_c1 3300050513 Bacteria 1723
400 nmdc:mga08x19_12702_c1 3300050514 Bacteria 5079
401 Ga0590071_004360 3300059421 Bacteria 3442
402 Ga0590075_031073 3300059424 Bacteria 1353
403 Ga0207674_10505617
404 rootH2_10127106
405 Ga0065712_10253350
406 Ga0070658_10002750
407 Ga0070658_10026394
408 Ga0070658_10032863
409 Ga0070658_10073239
410 Ga0070658_10287089
411 Ga0070658_10361807
412 Ga0070658_10505873
413 Ga0070676_10008428
414 Ga0070683_100002847
415 Ga0070683_100017988
416 Ga0070683_100037195
417 Ga0070683_100037586
418 Ga0070683_100077735
419 Ga0070683_100131677
420 Ga0070683_100167832
421 Ga0070683_100199775
422 Ga0070683_101133429
423 Ga0070690_100230009
424 Ga0070670_100035854
425 Ga0070670_100261160
426 Ga0070670_100411702
427 Ga0070677_10049752
428 Ga0070680_100002545
429 Ga0070680_100010843
430 Ga0070680_100036228
431 Ga0070680_100112330
432 Ga0070680_100122326
433 Ga0070680_100122756
434 Ga0070680_100171324
435 Ga0070680_100208891
436 Ga0070680_100237339
437 Ga0070680_100412615
438 Ga0070680_100527079
439 Ga0070682_100245343
440 Ga0070682_100287302
441 Ga0068868_100011964
442 Ga0070660_100007429
443 Ga0070660_100156823
444 Ga0070660_100197423
445 Ga0070660_100415985
446 Ga0070660_100416856
447 Ga0070660_100552338
448 Ga0070689_100137399
449 Ga0070691_10018487
450 Ga0070687_100025891
451 Ga0070661_100009638
452 Ga0070661_100014592
453 Ga0070668_100101556
454 Ga0070669_100015564
455 Ga0070675_100034038
456 Ga0070675_100155273
457 Ga0070674_100121558
458 Ga0070673_100125214
459 Ga0070673_100205722
460 Ga0070673_100269911
461 Ga0070688_100009037
462 Ga0070659_100023234
463 Ga0070659_100051143
464 Ga0070659_100110129
465 Ga0070659_100590018
466 Ga0070667_100316107
467 Ga0070667_100345125
468 Ga0070714_100005085
469 Ga0070714_100010120
470 Ga0070714_100051854
471 Ga0070714_100345321
472 Ga0070713_100185929
473 Ga0070705_100081655
474 Ga0070694_100239447
475 Ga0070708_100000086
476 Ga0070708_100006652
477 Ga0070708_100029066
478 Ga0070681_10000631
479 Ga0070681_10024256
480 Ga0070681_10234794
481 Ga0070681_10299049
482 Ga0070681_10316993
483 Ga0070681_10849187
484 Ga0068867_100022809
485 Ga0070685_10040284
486 Ga0070707_100002230
487 Ga0070707_100003354
488 Ga0070707_100110643
489 Ga0070698_100026756
490 Ga0070698_100434250
491 Ga0070699_100001800
492 Ga0070699_100001873
493 Ga0070699_100017055
494 Ga0070699_100100152
495 Ga0070679_100012489
496 Ga0070679_100013710
497 Ga0070679_100013982
498 Ga0070679_100015417
499 Ga0070679_100081389
500 Ga0070679_100130386
501 Ga0070679_100222851
502 Ga0070679_100422696
503 Ga0070679_100472674
504 Ga0070679_100593676
505 Ga0070679_100602788
506 Ga0070684_100035660
507 Ga0070684_100037570
508 Ga0070684_100278013
509 Ga0070684_100309105
510 Ga0070684_100343711
511 Ga0070684_100439231
512 Ga0070684_100521309
513 Ga0070684_100596847
514 Ga0070697_100023901
515 Ga0070697_100112981
516 Ga0068853_100206189
517 Ga0068853_100223400
518 Ga0068853_100500471
519 Ga0070672_100441498
520 Ga0070672_100568133
521 Ga0070686_100300020
522 Ga0070696_100001356
523 Ga0070696_100031934
524 Ga0070696_100052842
525 Ga0070696_100328986
526 Ga0070693_100001694
527 Ga0068855_100014675
528 Ga0068855_100527388
529 Ga0070664_100130085
530 Ga0070664_100413560
531 Ga0068857_100010305
532 Ga0068857_100106689
533 Ga0068857_100270406
534 Ga0068854_100003624
535 Ga0068854_100088314
536 Ga0068854_100161329
537 Ga0068852_100011526
538 Ga0068852_100015514
539 Ga0068852_100059662
540 Ga0068852_100101026
541 Ga0068852_100113713
542 Ga0068852_100230565
543 Ga0068852_100910499
544 Ga0068852_100958449
545 Ga0068859_100005447
546 Ga0068864_100034740
547 Ga0068866_10164688
548 Ga0068858_100145977
549 Ga0068862_100330157
550 Ga0068871_100564956
551 Ga0075428_100696032
552 Ga0075431_100158297
553 Ga0075429_100915422
554 Ga0068865_100260085
555 Ga0075436_100012271
556 Ga0075436_100097770
557 Ga0097620_100005447
558 Ga0075435_100239130
559 Ga0105240_10003569
560 Ga0105240_10150265
561 Ga0105240_10259890
562 Ga0105240_10343705
563 Ga0105240_10468639
564 Ga0105240_10476314
565 Ga0105240_10542332
566 Ga0111539_10679105
567 Ga0105247_10207921
568 Ga0105243_10311822
569 Ga0105243_10389961
570 Ga0105241_10000025
571 Ga0105241_10180560
572 Ga0105241_10258702
573 Ga0105241_10855722
574 Ga0105242_10013123
575 Ga0105242_10787037
576 Ga0105248_10115345
577 Ga0105248_10230700
578 Ga0105237_10109403
579 Ga0105238_10010734
580 Ga0105238_10201585
581 Ga0105238_10333908
582 Ga0105238_10429065
583 Ga0105249_10000078
584 Ga0105239_10651435
585 Ga0105246_10281258
586 Ga0157373_10000736
587 Ga0157373_10097945
588 Ga0157373_10183302
589 Ga0157371_10020647
590 Ga0157370_10001847
591 Ga0157370_10146038
592 Ga0157370_10183322
593 Ga0157370_10231181
594 Ga0157370_10378340
595 Ga0157370_10388117
596 Ga0157369_10011508
597 Ga0157369_10040781
598 Ga0157369_10065317
599 Ga0157369_10130123
600 Ga0157369_10169371
601 Ga0157369_10193988
602 Ga0157369_10672014
603 Ga0157378_10195153
604 Ga0157378_10215389
605 Ga0163162_10626415
606 Ga0163162_10647666
607 Ga0163162_10992121
608 Ga0157372_10003298
609 Ga0157372_10019480
610 Ga0157372_10024605
611 Ga0157372_10048925
612 Ga0157372_10055016
613 Ga0157372_10074002
614 Ga0157372_10085771
615 Ga0157372_10216354
616 Ga0157372_11141491
617 Ga0157372_11149878
618 Ga0157375_10232396
619 Ga0157375_10330610
620 Ga0157375_10399318
621 Ga0163163_10533196
622 Ga0182008_10003891
623 Ga0157377_10026718
624 Ga0157379_10317898
625 Ga0157376_10098287
626 Ga0207682_10044830
627 Ga0207642_10230350
628 Ga0207699_10121108
629 Ga0207645_10014559
630 Ga0207705_10001197
631 Ga0207705_10001680
632 Ga0207705_10020801
633 Ga0207705_10270207
634 Ga0207705_10360871
635 Ga0207705_10503526
636 Ga0207654_10002010
637 Ga0207654_10206285
638 Ga0207654_10367029
639 Ga0207707_10000450
640 Ga0207707_10004865
641 Ga0207707_10007906
642 Ga0207707_10078325
643 Ga0207707_10199385
644 Ga0207707_10212647
645 Ga0207707_10340130
646 Ga0207707_10626863
647 Ga0207707_10705901
648 Ga0207695_10001853
649 Ga0207695_10002468
650 Ga0207695_10005733
651 Ga0207695_10021940
652 Ga0207695_10023378
653 Ga0207695_10205956
654 Ga0207695_10427023
655 Ga0207671_10322322
656 Ga0207660_10000275
657 Ga0207660_10002553
658 Ga0207660_10015844
659 Ga0207660_10039326
660 Ga0207660_10044865
661 Ga0207660_10055702
662 Ga0207660_10207710
663 Ga0207660_10331481
664 Ga0207660_10474874
665 Ga0207662_10008178
666 Ga0207657_10012430
667 Ga0207657_10038904
668 Ga0207657_10049738
669 Ga0207657_10220120
670 Ga0207649_10377135
671 Ga0207652_10000841
672 Ga0207652_10009836
673 Ga0207652_10021570
674 Ga0207652_10072293
675 Ga0207652_10090478
676 Ga0207652_10197541
677 Ga0207652_10201645
678 Ga0207652_10340980
679 Ga0207652_10362242
680 Ga0207652_10369481
681 Ga0207652_10437835
682 Ga0207652_10477819
683 Ga0207646_10018644
684 Ga0207646_10250501
685 Ga0207694_10171445
686 Ga0207650_10041260
687 Ga0207659_10079170
688 Ga0207664_10010523
689 Ga0207664_10022173
690 Ga0207664_10100935
691 Ga0207664_10172807
692 Ga0207664_10612966
693 Ga0207644_10268923
694 Ga0207690_10043830
695 Ga0207690_10052306
696 Ga0207690_10062338
697 Ga0207690_10094145
698 Ga0207706_10264517
699 Ga0207706_10317397
700 Ga0207686_10026358
701 Ga0207709_10041469
702 Ga0207670_10019380
703 Ga0207669_10040307
704 Ga0207669_10394741
705 Ga0207704_10388433
706 Ga0207691_10004754
707 Ga0207691_10085456
708 Ga0207691_10225212
709 Ga0207711_10061030
710 Ga0207689_10694754
711 Ga0207661_10000396
712 Ga0207661_10010350
713 Ga0207661_10012334
714 Ga0207661_10052868
715 Ga0207661_10090331
716 Ga0207661_10189729
717 Ga0207661_10529090
718 Ga0207679_10022560
719 Ga0207679_10076686
720 Ga0207679_10083993
721 Ga0207679_10159044
722 Ga0207667_10207614
723 Ga0207667_10235198
724 Ga0207667_10361392
725 Ga0207651_10106325
726 Ga0207651_10323808
727 Ga0207651_10587236
728 Ga0207651_10785327
729 Ga0207712_10000079
730 Ga0207640_10000433
731 Ga0207658_10225213
732 Ga0207677_10512304
733 Ga0207678_10212576
734 Ga0207708_10006221
735 Ga0207648_10011010
736 Ga0207674_10011748
737 Ga0207674_10012406
738 Ga0207674_10095692
739 Ga0207674_10193657
740 Ga0207683_10167239
741 Ga0207698_10041472
742 Ga0207698_10058851
743 Ga0207698_10073547
744 Ga0207698_10138501
745 Ga0207698_10833224
746 Ga0209998_10002075
747 Ga0209974_10035378
748 Ga0268265_10463582
749 Ga0268264_10386912
750 Ga0307408_100080812
751 Ga0307405_10035264
752 Ga0307406_10074045
753 Ga0307406_10128535
754 Ga0307406_10195713
755 Ga0307407_10048650
756 Ga0307407_10065110
757 Ga0307409_100631075
758 Ga0307416_100159435
759 Ga0436365_0349623
760 Ga0451853_2194816
761 Ga0466969_0046547
762 Ga0453683_0060617
763 Ga0453683_0103278
764 Ga0466966_0052836
765 Ga0466961_0165863
766 Ga0466961_0194304
767 Ga0466960_0208868
768 Ga0466959_0053856
769 Ga0495662_0202579
770 Ga0495586_0175051
771 Ga0495587_0065103
772 Ga0495667_0034615
773 Ga0495588_0171895
774 Ga0495613_0025474
775 Ga0495581_0079091
776 Ga0495604_0062578
777 Ga0495636_0018807
778 Ga0495675_0111480
779 Ga0495614_0155609
780 Ga0495615_0061868
781 Ga0496108_1367172
782 Ga0496112_0023026
783 Ga0496115_0589723
784 Ga0501033_0082397
785 Ga0501034_0044400
786 Ga0501034_0625960
787 Ga0501038_0202855
788 Ga0501039_0469583
789 Ga0501043_0661466
790 Ga0501047_0510379
791 Ga0501048_0128413
792 Ga0501070_0092912
793 Ga0501070_0139987
794 Ga0501070_0461067
795 Ga0501207_009434
796 Ga0501083_0480292
797 Ga0501283_030091
798 Ga0501044_0150726
799 nmdc:mga06r32_170756_c1
800 nmdc:mga08y16_636467_c1
801 nmdc:mga0rr50_180903_c1
802 nmdc:mga08x19_12702_c1
803 Ga0590071_004360
804 Ga0590075_031073

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ws3-assembly3.cif.gz_D crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd tyr83phe mutant 0.7141 135 275
2wu5-assembly1.cif.gz_H crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd his71met mutant 0.711 135 271
2wdr-assembly1.cif.gz_D e. coli succinate:quinone oxidoreductase (sqr) with pentachlorophenol bound 0.706 135 275
2wdq-assembly3.cif.gz_H e. coli succinate:quinone oxidoreductase (sqr) with carboxin bound 0.6744 135 275
2ws3-assembly3.cif.gz_D crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd tyr83phe mutant 0.6681 135 275
ID Description Score Start End Superfamily
2wdrL00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.7138 135 275 1.20.1300.10
2wdqD00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.7102 135 275 1.20.1300.10
2wu5L00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.6938 135 271 1.20.1300.10
2ws3H00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.6929 135 271 1.20.1300.10
2aczD01 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.6714 135 271 1.20.1300.10
ID Description Score Start End GO Terms
AF-A0A359EXK8-F1-model_v4 Succinate dehydrogenase 0.9614 207 281 GO:0016020
AF-A9B6R8-F1-model_v4 Succinate dehydrogenase (Or fumarate reductase) cytochrome b subunit, b558 family 0.9072 29 281 GO:0016020
GO:0046872
AF-A0A7Y2NWU5-F1-model_v4 Succinate dehydrogenase cytochrome b subunit 0.9026 32 281 GO:0016020
AF-A0A356T9K1-F1-model_v4 Succinate dehydrogenase 0.9012 33 281 GO:0016020
AF-A0A7C6A1B6-F1-model_v4 Succinate dehydrogenase cytochrome b subunit 0.901 32 281 GO:0016020

Map