F435061

General Info

Members Datasets Scaffolds Average Seq Length
402 226 804 251

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100165867|Ga0075428_1001658673
Length 271
Sequence MMRDLFSLEGKTIAVIGAGSGIGRAVAIGVAEQGGEVFCLDVNADRAAETAQSIVDAGGTGTTWRRRDGSLLPCDITDLTSVRDGITEACSTHDRIDGVVCTPAINVRKPILQYTSDEFHRVVEVNLLGNFNVLQTAGQLMTLQGFGSIVLFSSIRSLVTEPGQSVYSMTKAGIVQLVRTAATEWGTKGVRVNAVGPGVIETPLTAPIKAQPDWYNAYADKTAMKRWAKAEEMAGPTIFLLSDAASYVTGTILFADGGWLAADGRFQPPGM

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
121 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
134 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
135 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
136 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
137 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
138 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
139 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
140 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
141 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
142 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
143 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
144 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
145 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
146 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
147 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
148 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
149 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
152 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
153 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
154 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
155 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
161 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
164 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
165 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
166 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
167 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
168 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
169 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
170 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
171 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
194 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
195 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
219 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
220 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
223 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
224 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 2738543005 Rhodococcus sp. OK519 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0
Isolates 0.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1
Nodule 0
Rhizoplane 2.99
Rhizosphere 95.27
Stem 0
Stem Tuber 0
Unclassified 6.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100165867 3300006844 Unclassified 2396
2 JGI24751J29686_10014043 3300002459 Bacteria 1653
3 Ga0070676_10001644 3300005328 Bacteria 11374
4 Ga0070670_100244075 3300005331 Bacteria 1564
5 Ga0070677_10124527 3300005333 Bacteria 1168
6 Ga0070666_10019869 3300005335 Bacteria 4339
7 Ga0070666_10420282 3300005335 Bacteria 963
8 Ga0070680_100033522 3300005336 Bacteria 4141
9 Ga0070680_100151772 3300005336 Bacteria 1945
10 Ga0070660_100005984 3300005339 Bacteria 8409
11 Ga0070660_100068216 3300005339 Bacteria 2772
12 Ga0070691_10006792 3300005341 Bacteria 5232
13 Ga0070691_10168915 3300005341 Unclassified 1132
14 Ga0070687_100002276 3300005343 Bacteria 7128
15 Ga0070668_100232545 3300005347 Bacteria 1524
16 Ga0070668_100289876 3300005347 Bacteria 1369
17 Ga0070669_100015500 3300005353 Bacteria 5433
18 Ga0070669_100018395 3300005353 Bacteria 4995
19 Ga0070675_100024565 3300005354 Bacteria 4826
20 Ga0070673_100847512 3300005364 Bacteria 846
21 Ga0070667_100182954 3300005367 Bacteria 1854
22 Ga0070711_100209339 3300005439 Bacteria 1509
23 Ga0070705_100053772 3300005440 Bacteria 2359
24 Ga0070705_100115462 3300005440 Bacteria 1724
25 Ga0070700_100005546 3300005441 Bacteria 6688
26 Ga0070700_100022993 3300005441 Bacteria 3643
27 Ga0070700_100110053 3300005441 Bacteria 1830
28 Ga0070694_100042609 3300005444 Bacteria 3033
29 Ga0070708_100100113 3300005445 Bacteria 2652
30 Ga0070708_100297341 3300005445 Bacteria 1520
31 Ga0070662_100370628 3300005457 Bacteria 1177
32 Ga0070681_10028289 3300005458 Bacteria 5634
33 Ga0070681_10679075 3300005458 Bacteria 945
34 Ga0068867_100015131 3300005459 Bacteria 5471
35 Ga0068867_100274146 3300005459 Unclassified 1381
36 Ga0068867_100483116 3300005459 Bacteria 1062
37 Ga0070707_100048401 3300005468 Bacteria 4073
38 Ga0070698_100017397 3300005471 Bacteria 7576
39 Ga0070698_100248901 3300005471 Bacteria 1710
40 Ga0070699_100010933 3300005518 Bacteria 7851
41 Ga0070699_100198604 3300005518 Bacteria 1783
42 Ga0070699_100548428 3300005518 Bacteria 1052
43 Ga0070697_100114861 3300005536 Bacteria 2247
44 Ga0070686_100000289 3300005544 Bacteria 33772
45 Ga0070695_100008632 3300005545 Bacteria 6053
46 Ga0070695_100049541 3300005545 Bacteria 2689
47 Ga0070696_100074285 3300005546 Bacteria 2397
48 Ga0070693_100214788 3300005547 Bacteria 1257
49 Ga0070665_100065683 3300005548 Bacteria 3639
50 Ga0070665_100225309 3300005548 Bacteria 1875
51 Ga0070704_100016250 3300005549 Bacteria 4699
52 Ga0070704_100039981 3300005549 Bacteria 3224
53 Ga0068855_100030220 3300005563 Bacteria 6480
54 Ga0068855_100820918 3300005563 Bacteria 987
55 Ga0068854_100001842 3300005578 Bacteria 12910
56 Ga0068854_100085661 3300005578 Bacteria 2334
57 Ga0070702_100012265 3300005615 Bacteria 4289
58 Ga0068852_100181963 3300005616 Bacteria 1977
59 Ga0068852_100256193 3300005616 Bacteria 1678
60 Ga0068852_100832402 3300005616 Bacteria 938
61 Ga0068859_100009585 3300005617 Bacteria 9778
62 Ga0068864_100043118 3300005618 Bacteria 3862
63 Ga0068866_10094879 3300005718 Bacteria 1633
64 Ga0068866_10153851 3300005718 Bacteria 1335
65 Ga0068861_100001513 3300005719 Bacteria 14718
66 Ga0068861_100165736 3300005719 Bacteria 1827
67 Ga0068861_100201066 3300005719 Bacteria 1672
68 Ga0068861_100229181 3300005719 Bacteria 1574
69 Ga0068863_100416466 3300005841 Bacteria 1316
70 Ga0068863_100433691 3300005841 Bacteria 1288
71 Ga0068858_100024577 3300005842 Bacteria 5613
72 Ga0068858_100131843 3300005842 Bacteria 2344
73 Ga0068860_100231230 3300005843 Bacteria 1797
74 Ga0068860_100252771 3300005843 Bacteria 1717
75 Ga0068860_100292587 3300005843 Bacteria 1594
76 Ga0068862_100040347 3300005844 Bacteria 3968
77 Ga0068862_100127452 3300005844 Bacteria 2248
78 Ga0068862_100869355 3300005844 Bacteria 885
79 Ga0081538_10090077 3300005981 Bacteria 1589
80 Ga0081539_10004995 3300005985 Bacteria 14021
81 Ga0070717_10299286 3300006028 Bacteria 1430
82 Ga0075366_10057729 3300006195 Bacteria 2306
83 Ga0097621_100048965 3300006237 Bacteria 3431
84 Ga0075370_10059407 3300006353 Bacteria 2176
85 Ga0068871_100044854 3300006358 Bacteria 3557
86 Ga0068871_100067226 3300006358 Bacteria 2940
87 Ga0068871_100174805 3300006358 Bacteria 1843
88 Ga0068871_100258180 3300006358 Unclassified 1519
89 Ga0075428_100003688 3300006844 Bacteria 16797
90 Ga0075428_100082801 3300006844 Bacteria 3501
91 Ga0075428_100115712 3300006844 Bacteria 2921
92 Ga0075428_100240819 3300006844 Bacteria 1952
93 Ga0075428_100845313 3300006844 Bacteria 972
94 Ga0075430_100002479 3300006846 Bacteria 15382
95 Ga0075430_100012440 3300006846 Bacteria 7241
96 Ga0075430_100267383 3300006846 Bacteria 1416
97 Ga0075431_100017121 3300006847 Bacteria 7366
98 Ga0075431_100046377 3300006847 Bacteria 4481
99 Ga0075431_100350541 3300006847 Bacteria 1484
100 Ga0075434_100009170 3300006871 Bacteria 9218
101 Ga0075434_100040414 3300006871 Bacteria 4618
102 Ga0075434_100076267 3300006871 Bacteria 3347
103 Ga0075434_100239834 3300006871 Bacteria 1833
104 Ga0075434_100317261 3300006871 Bacteria 1579
105 Ga0075429_100000904 3300006880 Bacteria 23465
106 Ga0075429_100015283 3300006880 Bacteria 6652
107 Ga0075436_100003144 3300006914 Bacteria 11321
108 Ga0075436_100019911 3300006914 Bacteria 4602
109 Ga0075436_100069296 3300006914 Bacteria 2437
110 Ga0075436_100105265 3300006914 Bacteria 1967
111 Ga0097620_100009585 3300006931 Bacteria 9778
112 Ga0075435_100003305 3300007076 Bacteria 10935
113 Ga0075435_100004177 3300007076 Bacteria 9907
114 Ga0075435_100015234 3300007076 Bacteria 5775
115 Ga0075435_100026553 3300007076 Bacteria 4520
116 Ga0075435_100073921 3300007076 Bacteria 2787
117 Ga0075435_100097189 3300007076 Bacteria 2437
118 Ga0075435_100447516 3300007076 Bacteria 1114
119 Ga0105240_10038337 3300009093 Bacteria 6147
120 Ga0105240_10128736 3300009093 Bacteria 3039
121 Ga0105240_10152563 3300009093 Bacteria 2750
122 Ga0105240_10385923 3300009093 Bacteria 1581
123 Ga0105240_11085398 3300009093 Bacteria 852
124 Ga0111539_10001248 3300009094 Bacteria 33874
125 Ga0111539_10011894 3300009094 Bacteria 10909
126 Ga0111539_10062132 3300009094 Bacteria 4423
127 Ga0111539_10207445 3300009094 Bacteria 2284
128 Ga0105245_10007987 3300009098 Bacteria 9255
129 Ga0105245_10058967 3300009098 Bacteria 3455
130 Ga0105247_10422361 3300009101 Bacteria 955
131 Ga0114129_10008132 3300009147 Bacteria 14952
132 Ga0114129_10015599 3300009147 Bacteria 10803
133 Ga0114129_10025690 3300009147 Bacteria 8343
134 Ga0114129_10065667 3300009147 Bacteria 5064
135 Ga0114129_10078160 3300009147 Bacteria 4603
136 Ga0114129_10082254 3300009147 Bacteria 4475
137 Ga0114129_10199838 3300009147 Bacteria 2708
138 Ga0114129_10242072 3300009147 Unclassified 2425
139 Ga0114129_10532578 3300009147 Bacteria 1530
140 Ga0114129_10740586 3300009147 Bacteria 1259
141 Ga0105243_10044110 3300009148 Bacteria 3497
142 Ga0105241_10031409 3300009174 Bacteria 3977
143 Ga0105242_10002905 3300009176 Bacteria 13397
144 Ga0105242_10007747 3300009176 Bacteria 8263
145 Ga0105242_10410271 3300009176 Bacteria 1267
146 Ga0105248_10005851 3300009177 Bacteria 13514
147 Ga0105248_10144776 3300009177 Bacteria 2681
148 Ga0105248_10155264 3300009177 Bacteria 2582
149 Ga0105248_10331618 3300009177 Bacteria 1714
150 Ga0105237_10225536 3300009545 Bacteria 1874
151 Ga0105237_10405386 3300009545 Bacteria 1368
152 Ga0105238_10450464 3300009551 Bacteria 1284
153 Ga0105249_10079006 3300009553 Bacteria 3053
154 Ga0105249_10378283 3300009553 Bacteria 1441
155 Ga0105246_10347226 3300011119 Bacteria 1215
156 Ga0157374_10128044 3300013296 Bacteria 2455
157 Ga0163162_10546200 3300013306 Bacteria 1287
158 Ga0157375_10906274 3300013308 Bacteria 1025
159 Ga0163163_10038612 3300014325 Bacteria 4655
160 Ga0163163_10126199 3300014325 Bacteria 2597
161 Ga0157380_10007208 3300014326 Bacteria 7879
162 Ga0157380_10013183 3300014326 Bacteria 6020
163 Ga0157380_10086754 3300014326 Bacteria 2572
164 Ga0157380_10101426 3300014326 Bacteria 2398
165 Ga0157379_10273188 3300014968 Bacteria 1537
166 Ga0157376_10581183 3300014969 Bacteria 1112
167 Ga0207682_10063533 3300025893 Bacteria 1550
168 Ga0207680_10025871 3300025903 Bacteria 3243
169 Ga0207680_10091712 3300025903 Bacteria 1934
170 Ga0207699_10139243 3300025906 Bacteria 1593
171 Ga0207654_10086167 3300025911 Bacteria 1903
172 Ga0207707_10079636 3300025912 Bacteria 2861
173 Ga0207707_10173735 3300025912 Bacteria 1882
174 Ga0207695_10024986 3300025913 Bacteria 6703
175 Ga0207695_10099917 3300025913 Bacteria 2898
176 Ga0207671_10246092 3300025914 Bacteria 1405
177 Ga0207660_10089122 3300025917 Bacteria 2283
178 Ga0207662_10032874 3300025918 Bacteria 3021
179 Ga0207657_10002155 3300025919 Bacteria 21326
180 Ga0207657_10162122 3300025919 Bacteria 1816
181 Ga0207652_10391822 3300025921 Bacteria 1253
182 Ga0207681_10565390 3300025923 Bacteria 937
183 Ga0207694_10100210 3300025924 Bacteria 2295
184 Ga0207694_10388336 3300025924 Unclassified 1159
185 Ga0207694_10602827 3300025924 Bacteria 924
186 Ga0207687_10059620 3300025927 Bacteria 2689
187 Ga0207687_10297640 3300025927 Bacteria 1299
188 Ga0207644_10115990 3300025931 Bacteria 2032
189 Ga0207686_10455120 3300025934 Bacteria 985
190 Ga0207709_10111195 3300025935 Bacteria 1832
191 Ga0207669_10009182 3300025937 Bacteria 4693
192 Ga0207704_10148007 3300025938 Unclassified 1653
193 Ga0207704_10558258 3300025938 Bacteria 931
194 Ga0207691_10029931 3300025940 Bacteria 5091
195 Ga0207711_10074643 3300025941 Bacteria 2950
196 Ga0207711_10232014 3300025941 Bacteria 1690
197 Ga0207711_10444183 3300025941 Bacteria 1207
198 Ga0207689_10541542 3300025942 Bacteria 977
199 Ga0207661_10711685 3300025944 Bacteria 924
200 Ga0207651_10131042 3300025960 Bacteria 1920
201 Ga0207712_10396622 3300025961 Bacteria 1159
202 Ga0207668_10501967 3300025972 Bacteria 1044
203 Ga0207640_10018883 3300025981 Bacteria 4060
204 Ga0207658_10145018 3300025986 Bacteria 1927
205 Ga0207703_10100278 3300026035 Bacteria 2453
206 Ga0207703_10162159 3300026035 Bacteria 1959
207 Ga0207708_10007161 3300026075 Bacteria 8241
208 Ga0207708_10025351 3300026075 Bacteria 4485
209 Ga0207708_10070472 3300026075 Bacteria 2676
210 Ga0207641_10460511 3300026088 Bacteria 1230
211 Ga0207648_10319779 3300026089 Bacteria 1394
212 Ga0207648_10374292 3300026089 Unclassified 1287
213 Ga0207676_10021861 3300026095 Bacteria 4698
214 Ga0207675_100053942 3300026118 Bacteria 3750
215 Ga0207675_100199060 3300026118 Bacteria 1924
216 Ga0207675_100554642 3300026118 Bacteria 1148
217 Ga0207698_10276961 3300026142 Bacteria 1550
218 Ga0207428_10008268 3300027907 Bacteria 9409
219 Ga0207428_10009744 3300027907 Bacteria 8610
220 Ga0207428_10038075 3300027907 Bacteria 3912
221 Ga0207428_10146782 3300027907 Bacteria 1797
222 Ga0268266_10061336 3300028379 Bacteria 3243
223 Ga0268266_10296785 3300028379 Bacteria 1506
224 Ga0268265_10372153 3300028380 Bacteria 1311
225 Ga0268264_10139124 3300028381 Bacteria 2163
226 Ga0268264_10423291 3300028381 Bacteria 1285
227 Ga0307408_100087134 3300031548 Bacteria 2348
228 Ga0307408_100122387 3300031548 Unclassified 2017
229 Ga0307408_100237434 3300031548 Bacteria 1496
230 Ga0307508_10238981 3300031616 Bacteria 1414
231 Ga0316576_10003828 3300031727 Bacteria 8907
232 Ga0316576_10015476 3300031727 Bacteria 5122
233 Ga0316576_10043731 3300031727 Bacteria 3233
234 Ga0316576_10069170 3300031727 Bacteria 2603
235 Ga0307405_10071455 3300031731 Unclassified 2233
236 Ga0307405_10337942 3300031731 Unclassified 1157
237 Ga0316577_10028839 3300031733 Bacteria 3097
238 Ga0307413_10057271 3300031824 Bacteria 2382
239 Ga0307413_10107128 3300031824 Bacteria 1862
240 Ga0307410_10008946 3300031852 Bacteria 5588
241 Ga0307410_10111056 3300031852 Unclassified 1984
242 Ga0307406_10002856 3300031901 Bacteria 9406
243 Ga0307406_10097416 3300031901 Unclassified 1995
244 Ga0307407_10006176 3300031903 Bacteria 5293
245 Ga0307407_10079921 3300031903 Bacteria 1974
246 Ga0307412_10070396 3300031911 Unclassified 2384
247 Ga0307412_10121970 3300031911 Bacteria 1878
248 Ga0307412_10267653 3300031911 Unclassified 1336
249 Ga0307412_10548727 3300031911 Bacteria 970
250 Ga0307409_100007868 3300031995 Bacteria 6416
251 Ga0307409_100498739 3300031995 Bacteria 1185
252 Ga0307409_100941467 3300031995 Bacteria 879
253 Ga0307416_100023392 3300032002 Bacteria 4483
254 Ga0307416_100100963 3300032002 Unclassified 2511
255 Ga0307416_100200761 3300032002 Bacteria 1892
256 Ga0307416_100367931 3300032002 Bacteria 1462
257 Ga0307416_100452202 3300032002 Bacteria 1337
258 Ga0307416_100547052 3300032002 Bacteria 1230
259 Ga0307416_100856246 3300032002 Bacteria 1007
260 Ga0307411_10253387 3300032005 Unclassified 1385
261 Ga0307415_100013439 3300032126 Bacteria 4780
262 Ga0307415_100552962 3300032126 Bacteria 1016
263 Ga0316580_10005380 3300032139 Bacteria 3732
264 Ga0316580_10064058 3300032139 Bacteria 1128
265 Ga0373930_0000408 3300034816 Bacteria 5699
266 Ga0373948_0000954 3300034817 Bacteria 3871
267 Ga0373950_0000838 3300034818 Bacteria 3867
268 Ga0373958_0003529 3300034819 Bacteria 2259
269 Ga0373959_0001589 3300034820 Bacteria 3613
270 Ga0373938_0003042 3300034957 Bacteria 2722
271 Ga0373928_0001787 3300035084 Bacteria 4181
272 Ga0373929_0000136 3300035085 Bacteria 12486
273 Ga0373934_0038990 3300035086 Bacteria 1872
274 Ga0373940_0060348 3300035088 Bacteria 1083
275 Ga0373949_0000556 3300035090 Bacteria 12277
276 Ga0373951_0000414 3300035091 Bacteria 12575
277 Ga0373932_0001178 3300035112 Bacteria 7476
278 Ga0373939_0001051 3300035114 Bacteria 6801
279 Ga0373941_0000101 3300035115 Bacteria 14297
280 Ga0373960_0000074 3300035121 Bacteria 14453
281 Ga0373955_0198194 3300035172 Bacteria 1195
282 Ga0373942_0001075 3300035207 Bacteria 7330
283 Ga0373961_0005803 3300035241 Bacteria 2963
284 Ga0373962_0000481 3300035242 Bacteria 8833
285 Ga0316574_0031048 3300035398 Bacteria 3239
286 Ga0316574_0070116 3300035398 Bacteria 2213
287 Ga0316574_0179574 3300035398 Bacteria 1362
288 Ga0373924_0041702 3300035410 Bacteria 1881
289 Ga0373931_0005467 3300035691 Bacteria 5881
290 Ga0373933_0399547 3300035724 Bacteria 896
291 Ga0373947_0094875 3300035725 Bacteria 1866
292 Ga0373947_0416052 3300035725 Unclassified 908
293 Ga0373937_0383943 3300036401 Bacteria 1332
294 Ga0316582_0132277 3300036647 Bacteria 1677
295 Ga0316584_0058267 3300036712 Bacteria 2892
296 Ga0373925_0481476 3300037068 Bacteria 1018
297 Ga0439453_0020175 3300041408 Unclassified 1193
298 Ga0451807_0963332 3300041486 Bacteria 1598
299 Ga0451835_0291601 3300041492 Bacteria 1148
300 Ga0439431_0004923 3300041997 Bacteria 2944
301 Ga0439433_0026211 3300041999 Bacteria 1319
302 Ga0439442_027059 3300042002 Bacteria 1195
303 Ga0439446_0001704 3300042156 Bacteria 5096
304 Ga0439435_0001524 3300042436 Bacteria 4323
305 Ga0439460_0059351 3300042461 Bacteria 1165
306 Ga0451576_0034359 3300045051 Bacteria 5385
307 Ga0451576_0232414 3300045051 Bacteria 1926
308 Ga0466967_0823499 3300045976 Bacteria 922
309 Ga0495603_0027275 3300046455 Bacteria 3448
310 Ga0495651_0144853 3300046462 Bacteria 1719
311 Ga0495628_0068702 3300046516 Bacteria 2764
312 Ga0495640_0171268 3300046533 Bacteria 1387
313 Ga0495621_0020035 3300046539 Unclassified 2190
314 Ga0495645_0001183 3300046543 Bacteria 17811
315 Ga0495633_0040626 3300046558 Bacteria 2215
316 Ga0495599_0189467 3300046678 Bacteria 1266
317 Ga0495647_0070902 3300046681 Bacteria 1395
318 Ga0495658_0028994 3300046683 Bacteria 2991
319 Ga0495658_0092785 3300046683 Bacteria 1791
320 Ga0495676_0343052 3300047321 Bacteria 1000
321 Ga0495684_0091657 3300047471 Bacteria 2302
322 Ga0496100_0298818 3300048903 Bacteria 1205
323 Ga0496102_0140426 3300048905 Bacteria 2265
324 Ga0496102_0694981 3300048905 Bacteria 940
325 Ga0496104_0012520 3300048907 Bacteria 7629
326 Ga0496105_0265021 3300048908 Bacteria 1389
327 Ga0496106_0056332 3300048909 Bacteria 2971
328 Ga0496106_0078293 3300048909 Bacteria 2536
329 Ga0496112_0025413 3300048915 Bacteria 5687
330 Ga0496112_0147672 3300048915 Bacteria 2319
331 Ga0496112_0521198 3300048915 Bacteria 1123
332 Ga0496114_0059303 3300048917 Bacteria 3197
333 Ga0501291_019530 3300049514 Bacteria 1064
334 Ga0501298_030082 3300049521 Bacteria 1061
335 Ga0501031_0172762 3300049568 Bacteria 1412
336 Ga0501036_0213595 3300049572 Unclassified 1621
337 Ga0501041_0011442 3300049577 Bacteria 5244
338 Ga0501041_0086707 3300049577 Bacteria 1932
339 Ga0501041_0218534 3300049577 Bacteria 1196
340 Ga0501071_0087304 3300049587 Bacteria 2288
341 Ga0501072_0036535 3300049588 Bacteria 3851
342 Ga0501073_0003628 3300049589 Bacteria 11607
343 Ga0501075_0018116 3300049591 Bacteria 5093
344 Ga0501075_0392644 3300049591 Bacteria 1058
345 Ga0501076_0223158 3300049592 Bacteria 1540
346 Ga0501076_0310075 3300049592 Bacteria 1294
347 Ga0501076_0375141 3300049592 Bacteria 1169
348 Ga0501216_013975 3300049660 Bacteria 1337
349 Ga0501079_0093250 3300049741 Unclassified 2333
350 Ga0501079_0273696 3300049741 Bacteria 1320
351 Ga0501081_0192019 3300049743 Unclassified 1479
352 Ga0501081_0733020 3300049743 Bacteria 742
353 Ga0501045_0042039 3300049824 Bacteria 3327
354 Ga0501045_0062715 3300049824 Bacteria 2727
355 nmdc:mga07m45_154269_c1 3300050496 Bacteria 1332
356 nmdc:mga05p37_1252_c1 3300050507 Bacteria 29465
357 nmdc:mga05p37_170496_c1 3300050507 Bacteria 2654
358 nmdc:mga05p37_19883_c1 3300050507 Bacteria 8122
359 nmdc:mga05p37_362893_c1 3300050507 Bacteria 1702
360 nmdc:mga05p37_37447_c1 3300050507 Bacteria 5946
361 nmdc:mga05p37_557628_c1 3300050507 Bacteria 1303
362 nmdc:mga05p37_60585_c1 3300050507 Bacteria 4660
363 nmdc:mga05p37_78398_c1 3300050507 Bacteria 4068
364 nmdc:mga05p37_957216_c1 3300050507 Bacteria 915
365 nmdc:mga09592_12520_c1 3300050508 Bacteria 6912
366 nmdc:mga0qj67_226739_c1 3300050509 Unclassified 1516
367 nmdc:mga0qj67_37300_c1 3300050509 Bacteria 3806
368 nmdc:mga06r32_140335_c2 3300050510 Bacteria 1536
369 nmdc:mga06r32_337326_c1 3300050510 Bacteria 1492
370 nmdc:mga06r32_386869_c1 3300050510 Bacteria 1381
371 nmdc:mga06r32_42051_c1 3300050510 Bacteria 4344
372 nmdc:mga08y16_27719_c1 3300050511 Bacteria 5969
373 nmdc:mga08y16_9409_c1 3300050511 Bacteria 10249
374 nmdc:mga08y16_96302_c1 3300050511 Bacteria 3082
375 nmdc:mga0n895_10_c1 3300050512 Bacteria 115544
376 nmdc:mga0n895_239346_c1 3300050512 Bacteria 1842
377 nmdc:mga0n895_394792_c1 3300050512 Bacteria 1399
378 nmdc:mga0n895_39949_c1 3300050512 Bacteria 4557
379 nmdc:mga0rr50_176574_c1 3300050513 Bacteria 1744
380 nmdc:mga0rr50_20_c1 3300050513 Bacteria 140799
381 nmdc:mga0rr50_23022_c1 3300050513 Bacteria 4287
382 nmdc:mga0rr50_3040_c1 3300050513 Bacteria 9597
383 nmdc:mga08x19_105666_c1 3300050514 Bacteria 1873
384 nmdc:mga08x19_152847_c1 3300050514 Bacteria 1564
385 nmdc:mga08x19_191614_c1 3300050514 Archaea 1399
386 nmdc:mga08x19_20176_c1 3300050514 Bacteria 4103
387 nmdc:mga08x19_2537_c1 3300050514 Bacteria 11101
388 nmdc:mga0a205_22133_c1 3300050515 Bacteria 6016
389 nmdc:mga0a205_89497_c1 3300050515 Bacteria 2975
390 Ga0495601_0101655 3300053077 Bacteria 1857
391 Ga0495601_0368785 3300053077 Bacteria 932
392 Ga0495595_0172134 3300053084 Bacteria 1072
393 Ga0495619_0111308 3300053085 Bacteria 1871
394 Ga0495619_0137364 3300053085 Bacteria 1682
395 Ga0500555_003363 3300053103 Bacteria 4560
396 Ga0501084_0145247 3300054114 Unclassified 1998
397 Ga0590071_000380 3300059421 Bacteria 13035
398 Ga0590075_000108 3300059424 Bacteria 21310
399 Ga0590077_000763 3300059426 Bacteria 8421
400 Ga0501082_0205458 3300060353 Unclassified 1714
401 Ga0501082_0436049 3300060353 Bacteria 1144
402 2739206964 2738543005 Bacteria 5278128
403 Ga0075428_100165867
404 JGI24751J29686_10014043
405 Ga0070676_10001644
406 Ga0070670_100244075
407 Ga0070677_10124527
408 Ga0070666_10019869
409 Ga0070666_10420282
410 Ga0070680_100033522
411 Ga0070680_100151772
412 Ga0070660_100005984
413 Ga0070660_100068216
414 Ga0070691_10006792
415 Ga0070691_10168915
416 Ga0070687_100002276
417 Ga0070668_100232545
418 Ga0070668_100289876
419 Ga0070669_100015500
420 Ga0070669_100018395
421 Ga0070675_100024565
422 Ga0070673_100847512
423 Ga0070667_100182954
424 Ga0070711_100209339
425 Ga0070705_100053772
426 Ga0070705_100115462
427 Ga0070700_100005546
428 Ga0070700_100022993
429 Ga0070700_100110053
430 Ga0070694_100042609
431 Ga0070708_100100113
432 Ga0070708_100297341
433 Ga0070662_100370628
434 Ga0070681_10028289
435 Ga0070681_10679075
436 Ga0068867_100015131
437 Ga0068867_100274146
438 Ga0068867_100483116
439 Ga0070707_100048401
440 Ga0070698_100017397
441 Ga0070698_100248901
442 Ga0070699_100010933
443 Ga0070699_100198604
444 Ga0070699_100548428
445 Ga0070697_100114861
446 Ga0070686_100000289
447 Ga0070695_100008632
448 Ga0070695_100049541
449 Ga0070696_100074285
450 Ga0070693_100214788
451 Ga0070665_100065683
452 Ga0070665_100225309
453 Ga0070704_100016250
454 Ga0070704_100039981
455 Ga0068855_100030220
456 Ga0068855_100820918
457 Ga0068854_100001842
458 Ga0068854_100085661
459 Ga0070702_100012265
460 Ga0068852_100181963
461 Ga0068852_100256193
462 Ga0068852_100832402
463 Ga0068859_100009585
464 Ga0068864_100043118
465 Ga0068866_10094879
466 Ga0068866_10153851
467 Ga0068861_100001513
468 Ga0068861_100165736
469 Ga0068861_100201066
470 Ga0068861_100229181
471 Ga0068863_100416466
472 Ga0068863_100433691
473 Ga0068858_100024577
474 Ga0068858_100131843
475 Ga0068860_100231230
476 Ga0068860_100252771
477 Ga0068860_100292587
478 Ga0068862_100040347
479 Ga0068862_100127452
480 Ga0068862_100869355
481 Ga0081538_10090077
482 Ga0081539_10004995
483 Ga0070717_10299286
484 Ga0075366_10057729
485 Ga0097621_100048965
486 Ga0075370_10059407
487 Ga0068871_100044854
488 Ga0068871_100067226
489 Ga0068871_100174805
490 Ga0068871_100258180
491 Ga0075428_100003688
492 Ga0075428_100082801
493 Ga0075428_100115712
494 Ga0075428_100240819
495 Ga0075428_100845313
496 Ga0075430_100002479
497 Ga0075430_100012440
498 Ga0075430_100267383
499 Ga0075431_100017121
500 Ga0075431_100046377
501 Ga0075431_100350541
502 Ga0075434_100009170
503 Ga0075434_100040414
504 Ga0075434_100076267
505 Ga0075434_100239834
506 Ga0075434_100317261
507 Ga0075429_100000904
508 Ga0075429_100015283
509 Ga0075436_100003144
510 Ga0075436_100019911
511 Ga0075436_100069296
512 Ga0075436_100105265
513 Ga0097620_100009585
514 Ga0075435_100003305
515 Ga0075435_100004177
516 Ga0075435_100015234
517 Ga0075435_100026553
518 Ga0075435_100073921
519 Ga0075435_100097189
520 Ga0075435_100447516
521 Ga0105240_10038337
522 Ga0105240_10128736
523 Ga0105240_10152563
524 Ga0105240_10385923
525 Ga0105240_11085398
526 Ga0111539_10001248
527 Ga0111539_10011894
528 Ga0111539_10062132
529 Ga0111539_10207445
530 Ga0105245_10007987
531 Ga0105245_10058967
532 Ga0105247_10422361
533 Ga0114129_10008132
534 Ga0114129_10015599
535 Ga0114129_10025690
536 Ga0114129_10065667
537 Ga0114129_10078160
538 Ga0114129_10082254
539 Ga0114129_10199838
540 Ga0114129_10242072
541 Ga0114129_10532578
542 Ga0114129_10740586
543 Ga0105243_10044110
544 Ga0105241_10031409
545 Ga0105242_10002905
546 Ga0105242_10007747
547 Ga0105242_10410271
548 Ga0105248_10005851
549 Ga0105248_10144776
550 Ga0105248_10155264
551 Ga0105248_10331618
552 Ga0105237_10225536
553 Ga0105237_10405386
554 Ga0105238_10450464
555 Ga0105249_10079006
556 Ga0105249_10378283
557 Ga0105246_10347226
558 Ga0157374_10128044
559 Ga0163162_10546200
560 Ga0157375_10906274
561 Ga0163163_10038612
562 Ga0163163_10126199
563 Ga0157380_10007208
564 Ga0157380_10013183
565 Ga0157380_10086754
566 Ga0157380_10101426
567 Ga0157379_10273188
568 Ga0157376_10581183
569 Ga0207682_10063533
570 Ga0207680_10025871
571 Ga0207680_10091712
572 Ga0207699_10139243
573 Ga0207654_10086167
574 Ga0207707_10079636
575 Ga0207707_10173735
576 Ga0207695_10024986
577 Ga0207695_10099917
578 Ga0207671_10246092
579 Ga0207660_10089122
580 Ga0207662_10032874
581 Ga0207657_10002155
582 Ga0207657_10162122
583 Ga0207652_10391822
584 Ga0207681_10565390
585 Ga0207694_10100210
586 Ga0207694_10388336
587 Ga0207694_10602827
588 Ga0207687_10059620
589 Ga0207687_10297640
590 Ga0207644_10115990
591 Ga0207686_10455120
592 Ga0207709_10111195
593 Ga0207669_10009182
594 Ga0207704_10148007
595 Ga0207704_10558258
596 Ga0207691_10029931
597 Ga0207711_10074643
598 Ga0207711_10232014
599 Ga0207711_10444183
600 Ga0207689_10541542
601 Ga0207661_10711685
602 Ga0207651_10131042
603 Ga0207712_10396622
604 Ga0207668_10501967
605 Ga0207640_10018883
606 Ga0207658_10145018
607 Ga0207703_10100278
608 Ga0207703_10162159
609 Ga0207708_10007161
610 Ga0207708_10025351
611 Ga0207708_10070472
612 Ga0207641_10460511
613 Ga0207648_10319779
614 Ga0207648_10374292
615 Ga0207676_10021861
616 Ga0207675_100053942
617 Ga0207675_100199060
618 Ga0207675_100554642
619 Ga0207698_10276961
620 Ga0207428_10008268
621 Ga0207428_10009744
622 Ga0207428_10038075
623 Ga0207428_10146782
624 Ga0268266_10061336
625 Ga0268266_10296785
626 Ga0268265_10372153
627 Ga0268264_10139124
628 Ga0268264_10423291
629 Ga0307408_100087134
630 Ga0307408_100122387
631 Ga0307408_100237434
632 Ga0307508_10238981
633 Ga0316576_10003828
634 Ga0316576_10015476
635 Ga0316576_10043731
636 Ga0316576_10069170
637 Ga0307405_10071455
638 Ga0307405_10337942
639 Ga0316577_10028839
640 Ga0307413_10057271
641 Ga0307413_10107128
642 Ga0307410_10008946
643 Ga0307410_10111056
644 Ga0307406_10002856
645 Ga0307406_10097416
646 Ga0307407_10006176
647 Ga0307407_10079921
648 Ga0307412_10070396
649 Ga0307412_10121970
650 Ga0307412_10267653
651 Ga0307412_10548727
652 Ga0307409_100007868
653 Ga0307409_100498739
654 Ga0307409_100941467
655 Ga0307416_100023392
656 Ga0307416_100100963
657 Ga0307416_100200761
658 Ga0307416_100367931
659 Ga0307416_100452202
660 Ga0307416_100547052
661 Ga0307416_100856246
662 Ga0307411_10253387
663 Ga0307415_100013439
664 Ga0307415_100552962
665 Ga0316580_10005380
666 Ga0316580_10064058
667 Ga0373930_0000408
668 Ga0373948_0000954
669 Ga0373950_0000838
670 Ga0373958_0003529
671 Ga0373959_0001589
672 Ga0373938_0003042
673 Ga0373928_0001787
674 Ga0373929_0000136
675 Ga0373934_0038990
676 Ga0373940_0060348
677 Ga0373949_0000556
678 Ga0373951_0000414
679 Ga0373932_0001178
680 Ga0373939_0001051
681 Ga0373941_0000101
682 Ga0373960_0000074
683 Ga0373955_0198194
684 Ga0373942_0001075
685 Ga0373961_0005803
686 Ga0373962_0000481
687 Ga0316574_0031048
688 Ga0316574_0070116
689 Ga0316574_0179574
690 Ga0373924_0041702
691 Ga0373931_0005467
692 Ga0373933_0399547
693 Ga0373947_0094875
694 Ga0373947_0416052
695 Ga0373937_0383943
696 Ga0316582_0132277
697 Ga0316584_0058267
698 Ga0373925_0481476
699 Ga0439453_0020175
700 Ga0451807_0963332
701 Ga0451835_0291601
702 Ga0439431_0004923
703 Ga0439433_0026211
704 Ga0439442_027059
705 Ga0439446_0001704
706 Ga0439435_0001524
707 Ga0439460_0059351
708 Ga0451576_0034359
709 Ga0451576_0232414
710 Ga0466967_0823499
711 Ga0495603_0027275
712 Ga0495651_0144853
713 Ga0495628_0068702
714 Ga0495640_0171268
715 Ga0495621_0020035
716 Ga0495645_0001183
717 Ga0495633_0040626
718 Ga0495599_0189467
719 Ga0495647_0070902
720 Ga0495658_0028994
721 Ga0495658_0092785
722 Ga0495676_0343052
723 Ga0495684_0091657
724 Ga0496100_0298818
725 Ga0496102_0140426
726 Ga0496102_0694981
727 Ga0496104_0012520
728 Ga0496105_0265021
729 Ga0496106_0056332
730 Ga0496106_0078293
731 Ga0496112_0025413
732 Ga0496112_0147672
733 Ga0496112_0521198
734 Ga0496114_0059303
735 Ga0501291_019530
736 Ga0501298_030082
737 Ga0501031_0172762
738 Ga0501036_0213595
739 Ga0501041_0011442
740 Ga0501041_0086707
741 Ga0501041_0218534
742 Ga0501071_0087304
743 Ga0501072_0036535
744 Ga0501073_0003628
745 Ga0501075_0018116
746 Ga0501075_0392644
747 Ga0501076_0223158
748 Ga0501076_0310075
749 Ga0501076_0375141
750 Ga0501216_013975
751 Ga0501079_0093250
752 Ga0501079_0273696
753 Ga0501081_0192019
754 Ga0501081_0733020
755 Ga0501045_0042039
756 Ga0501045_0062715
757 nmdc:mga07m45_154269_c1
758 nmdc:mga05p37_1252_c1
759 nmdc:mga05p37_170496_c1
760 nmdc:mga05p37_19883_c1
761 nmdc:mga05p37_362893_c1
762 nmdc:mga05p37_37447_c1
763 nmdc:mga05p37_557628_c1
764 nmdc:mga05p37_60585_c1
765 nmdc:mga05p37_78398_c1
766 nmdc:mga05p37_957216_c1
767 nmdc:mga09592_12520_c1
768 nmdc:mga0qj67_226739_c1
769 nmdc:mga0qj67_37300_c1
770 nmdc:mga06r32_140335_c2
771 nmdc:mga06r32_337326_c1
772 nmdc:mga06r32_386869_c1
773 nmdc:mga06r32_42051_c1
774 nmdc:mga08y16_27719_c1
775 nmdc:mga08y16_9409_c1
776 nmdc:mga08y16_96302_c1
777 nmdc:mga0n895_10_c1
778 nmdc:mga0n895_239346_c1
779 nmdc:mga0n895_394792_c1
780 nmdc:mga0n895_39949_c1
781 nmdc:mga0rr50_176574_c1
782 nmdc:mga0rr50_20_c1
783 nmdc:mga0rr50_23022_c1
784 nmdc:mga0rr50_3040_c1
785 nmdc:mga08x19_105666_c1
786 nmdc:mga08x19_152847_c1
787 nmdc:mga08x19_191614_c1
788 nmdc:mga08x19_20176_c1
789 nmdc:mga08x19_2537_c1
790 nmdc:mga0a205_22133_c1
791 nmdc:mga0a205_89497_c1
792 Ga0495601_0101655
793 Ga0495601_0368785
794 Ga0495595_0172134
795 Ga0495619_0111308
796 Ga0495619_0137364
797 Ga0500555_003363
798 Ga0501084_0145247
799 Ga0590071_000380
800 Ga0590075_000108
801 Ga0590077_000763
802 Ga0501082_0205458
803 Ga0501082_0436049
804 2739206964

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

17

260

0.96

PF00106

adh_short

short chain dehydrogenase

11

213

0.95

PF08659

KR

KR domain

11

198

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4iin-assembly1.cif.gz_C crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from helicobacter pylori 26695 complexed with nad+ 0.9768 27 212
8jfa-assembly2.cif.gz_F-2 crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadph from helicobacter pylori 0.9759 27 212
8jfg-assembly1.cif.gz_A crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadp+ and 3-keto-octanoyl-acp from helicobacter pylori 0.9758 27 212
8jfa-assembly1.cif.gz_C crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadph from helicobacter pylori 0.975 29 212
8jfa-assembly1.cif.gz_B crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadph from helicobacter pylori 0.9734 27 212
ID Description Score Start End Superfamily
3awdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9738 27 214 3.40.50.720
3ay6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9676 27 214 3.40.50.720
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9644 27 212 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9633 28 215 3.40.50.720
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9622 27 214 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0M2UZH1-F1-model_v4 Putative gluconate dehydrogenase 0.986 27 214 GO:0016616
AF-A0A352VPG1-F1-model_v4 3-oxoacyl-ACP reductase 0.9855 49 220 GO:0016491
AF-M7NH27-F1-model_v4 Gluconate 5-dehydrogenase (EC 1.1.1.69) 0.9855 27 214 GO:0006633
GO:0008874
GO:0048038
AF-A0A0S4QIH3-F1-model_v4 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family 0.985 27 219 GO:0016616
GO:0030497
AF-A0A6L7RZ87-F1-model_v4 SDR family oxidoreductase 0.985 27 214 GO:0016491

Map