F434890

General Info

Members Datasets Scaffolds Average Seq Length
401 227 802 168

Family's Representative Sequence

Representative Sequence 3300036712|Ga0316584_0266624|Ga0316584_0266624_341_925
Length 194
Sequence MKSAADRSTGARHPSGCDDLQVSHSAIPAAEDVIDASAKVQFETFLDQHRDALDACLDGLTEEQARRSLVPSKTTLLGLVKHATFVEKVWFDEAVTCRSRDELGIPAGPDESFDLHDDDTIATVRQAHREACQASREAVAALDLSAFVYGNRRGPLPLRWVYMHVLRELAQHCGHADILREQLLDGGAEDVRPR

Samples

Sample ID Description Type Environment
1 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
85 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
86 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
92 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
93 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
94 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
95 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
96 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
97 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
98 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
99 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
100 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
101 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
102 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
103 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
104 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
105 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
106 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
107 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
108 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
109 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
110 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
111 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
112 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
113 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
129 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
130 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
131 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
132 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
144 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
206 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
207 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
208 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
209 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
210 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
211 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
212 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
213 2858882152 Micromonospora noduli MED15 Isolate Nodule
214 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
215 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
216 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
217 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
218 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
219 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
220 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
221 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
222 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
223 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
224 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
225 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
226 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
227 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.01
Metatranscriptomes 0
Isolates 4.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 1.25
Rhizoplane 7.23
Rhizosphere 85.29
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316584_0266624 3300036712 Bacteria 1247
2 rootH1_10095794 3300003316 Bacteria 2513
3 Ga0070683_100691784 3300005329 Bacteria 976
4 Ga0070680_100160352 3300005336 Bacteria 1890
5 Ga0070682_100473226 3300005337 Bacteria 965
6 Ga0068868_100813367 3300005338 Bacteria 844
7 Ga0070691_10284730 3300005341 Bacteria 898
8 Ga0070709_10001100 3300005434 Bacteria 14918
9 Ga0070709_10023252 3300005434 Bacteria 3636
10 Ga0070709_10201260 3300005434 Bacteria 1410
11 Ga0070709_10385903 3300005434 Bacteria 1042
12 Ga0070714_100577175 3300005435 Bacteria 1078
13 Ga0070714_100615864 3300005435 Bacteria 1043
14 Ga0070714_101333925 3300005435 Bacteria 700
15 Ga0070713_100007982 3300005436 Bacteria 7482
16 Ga0070713_100066313 3300005436 Bacteria 3035
17 Ga0070713_100090082 3300005436 Bacteria 2636
18 Ga0070713_100334866 3300005436 Bacteria 1401
19 Ga0070713_100481768 3300005436 Bacteria 1169
20 Ga0070713_100608547 3300005436 Bacteria 1038
21 Ga0070713_100874962 3300005436 Bacteria 863
22 Ga0070710_10006556 3300005437 Bacteria 5596
23 Ga0070710_10081570 3300005437 Bacteria 1889
24 Ga0070710_10093982 3300005437 Bacteria 1773
25 Ga0070710_10246611 3300005437 Bacteria 1146
26 Ga0070710_10728005 3300005437 Bacteria 702
27 Ga0070701_10251489 3300005438 Bacteria 1067
28 Ga0070711_100024026 3300005439 Bacteria 3972
29 Ga0070711_100036645 3300005439 Bacteria 3287
30 Ga0070711_100122231 3300005439 Bacteria 1927
31 Ga0070711_100243034 3300005439 Bacteria 1408
32 Ga0070711_100478274 3300005439 Bacteria 1023
33 Ga0070708_100002379 3300005445 Bacteria 14559
34 Ga0070663_100228127 3300005455 Bacteria 1465
35 Ga0070678_100356620 3300005456 Bacteria 1259
36 Ga0070706_100540655 3300005467 Bacteria 1084
37 Ga0070707_100186954 3300005468 Bacteria 2020
38 Ga0070707_100571812 3300005468 Bacteria 1092
39 Ga0070698_100128226 3300005471 Bacteria 2493
40 Ga0070698_100132789 3300005471 Bacteria 2444
41 Ga0070699_100417783 3300005518 Bacteria 1214
42 Ga0070695_100092178 3300005545 Bacteria 2025
43 Ga0070696_100585385 3300005546 Bacteria 898
44 Ga0070693_100214714 3300005547 Bacteria 1257
45 Ga0070665_100194507 3300005548 Bacteria 2029
46 Ga0070704_100276348 3300005549 Bacteria 1390
47 Ga0070704_100476859 3300005549 Bacteria 1079
48 Ga0068855_100262655 3300005563 Bacteria 1923
49 Ga0068857_100350896 3300005577 Bacteria 1366
50 Ga0068856_100087716 3300005614 Bacteria 3093
51 Ga0068856_100111593 3300005614 Bacteria 2732
52 Ga0068856_100259415 3300005614 Bacteria 1753
53 Ga0068856_101040034 3300005614 Bacteria 837
54 Ga0070702_100066130 3300005615 Bacteria 2119
55 Ga0068864_100031645 3300005618 Bacteria 4491
56 Ga0068863_100377661 3300005841 Bacteria 1384
57 Ga0068858_100096289 3300005842 Bacteria 2758
58 Ga0070717_10016255 3300006028 Bacteria 5767
59 Ga0070717_10017480 3300006028 Bacteria 5580
60 Ga0070717_10054626 3300006028 Bacteria 3294
61 Ga0070717_10180387 3300006028 Bacteria 1840
62 Ga0070717_10556872 3300006028 Bacteria 1038
63 Ga0070715_10023847 3300006163 Bacteria 2402
64 Ga0070715_10082889 3300006163 Bacteria 1459
65 Ga0070715_10188944 3300006163 Bacteria 1038
66 Ga0070716_100075540 3300006173 Bacteria 1994
67 Ga0070716_100351471 3300006173 Bacteria 1043
68 Ga0070716_100355505 3300006173 Bacteria 1038
69 Ga0070712_100038934 3300006175 Bacteria 3251
70 Ga0070712_100056872 3300006175 Bacteria 2745
71 Ga0070712_100090615 3300006175 Bacteria 2239
72 Ga0070712_100101531 3300006175 Bacteria 2128
73 Ga0070712_100478896 3300006175 Bacteria 1040
74 Ga0070712_101060706 3300006175 Bacteria 702
75 Ga0097621_100205845 3300006237 Bacteria 1710
76 Ga0068871_100013882 3300006358 Bacteria 5989
77 Ga0068871_100513357 3300006358 Bacteria 1081
78 Ga0075434_100079646 3300006871 Bacteria 3272
79 Ga0075434_100135237 3300006871 Bacteria 2484
80 Ga0075436_100179814 3300006914 Bacteria 1495
81 Ga0075436_100780809 3300006914 Bacteria 710
82 Ga0075435_100038307 3300007076 Bacteria 3822
83 Ga0105245_11178065 3300009098 Bacteria 814
84 Ga0105243_11415420 3300009148 Bacteria 716
85 Ga0105241_10226470 3300009174 Bacteria 1574
86 Ga0105248_10394523 3300009177 Bacteria 1558
87 Ga0105237_10524009 3300009545 Bacteria 1192
88 Ga0105238_11166341 3300009551 Bacteria 794
89 Ga0105239_11731626 3300010375 Bacteria 724
90 Ga0105246_10721199 3300011119 Bacteria 876
91 Ga0157373_10446558 3300013100 Bacteria 930
92 Ga0157369_10253338 3300013105 Bacteria 1837
93 Ga0157369_10365896 3300013105 Bacteria 1497
94 Ga0157374_10044060 3300013296 Bacteria 4124
95 Ga0157374_10746790 3300013296 Bacteria 993
96 Ga0157378_10629223 3300013297 Bacteria 1087
97 Ga0163162_10998966 3300013306 Bacteria 946
98 Ga0157372_10183798 3300013307 Bacteria 2421
99 Ga0157375_10255176 3300013308 Bacteria 1915
100 Ga0163163_10038700 3300014325 Bacteria 4649
101 Ga0157379_10017573 3300014968 Bacteria 6296
102 Ga0157376_10173616 3300014969 Bacteria 1965
103 Ga0213874_10075402 3300021377 Bacteria 1084
104 Ga0213876_10310133 3300021384 Bacteria 839
105 Ga0207692_10022575 3300025898 Bacteria 2897
106 Ga0207692_10029392 3300025898 Bacteria 2611
107 Ga0207692_10052282 3300025898 Bacteria 2076
108 Ga0207688_10372891 3300025901 Bacteria 882
109 Ga0207685_10000487 3300025905 Bacteria 6730
110 Ga0207699_10020837 3300025906 Bacteria 3522
111 Ga0207699_10058428 3300025906 Bacteria 2307
112 Ga0207699_10078592 3300025906 Bacteria 2038
113 Ga0207699_10392309 3300025906 Bacteria 987
114 Ga0207707_11478419 3300025912 Bacteria 539
115 Ga0207693_10006379 3300025915 Bacteria 9773
116 Ga0207693_10054822 3300025915 Bacteria 3127
117 Ga0207693_10129772 3300025915 Bacteria 1981
118 Ga0207693_10453991 3300025915 Bacteria 1001
119 Ga0207693_10456481 3300025915 Bacteria 998
120 Ga0207663_10005272 3300025916 Bacteria 6507
121 Ga0207663_10005771 3300025916 Bacteria 6268
122 Ga0207663_10028790 3300025916 Bacteria 3256
123 Ga0207663_10123602 3300025916 Bacteria 1776
124 Ga0207646_10345192 3300025922 Bacteria 1345
125 Ga0207687_10338086 3300025927 Bacteria 1223
126 Ga0207700_10001348 3300025928 Bacteria 13927
127 Ga0207700_10004372 3300025928 Bacteria 8322
128 Ga0207700_10025383 3300025928 Bacteria 4113
129 Ga0207700_10101840 3300025928 Bacteria 2292
130 Ga0207700_10108365 3300025928 Bacteria 2230
131 Ga0207700_10546971 3300025928 Bacteria 1027
132 Ga0207664_10002578 3300025929 Bacteria 11987
133 Ga0207664_10130331 3300025929 Bacteria 2116
134 Ga0207664_10248166 3300025929 Bacteria 1553
135 Ga0207664_10284725 3300025929 Bacteria 1451
136 Ga0207664_10336775 3300025929 Bacteria 1333
137 Ga0207664_10528811 3300025929 Bacteria 1057
138 Ga0207664_10689162 3300025929 Bacteria 919
139 Ga0207665_10054283 3300025939 Bacteria 2702
140 Ga0207665_10437706 3300025939 Bacteria 1001
141 Ga0207665_10441032 3300025939 Bacteria 998
142 Ga0207711_10316420 3300025941 Bacteria 1441
143 Ga0207661_10043133 3300025944 Bacteria 3559
144 Ga0207679_10613760 3300025945 Bacteria 981
145 Ga0207667_10315608 3300025949 Bacteria 1596
146 Ga0207677_10761757 3300026023 Bacteria 864
147 Ga0207703_10021999 3300026035 Bacteria 4994
148 Ga0207678_10298112 3300026067 Bacteria 1385
149 Ga0207702_10072354 3300026078 Bacteria 2971
150 Ga0207702_10823273 3300026078 Bacteria 918
151 Ga0207683_10338823 3300026121 Bacteria 1379
152 Ga0268266_10521572 3300028379 Bacteria 1136
153 Ga0307516_10013753 3300031730 Bacteria 8596
154 Ga0307413_10417236 3300031824 Bacteria 1056
155 Ga0307413_11684118 3300031824 Bacteria 565
156 Ga0307410_10002881 3300031852 Bacteria 8467
157 Ga0307406_10312683 3300031901 Bacteria 1212
158 Ga0307407_10032709 3300031903 Bacteria 2831
159 Ga0307412_10542817 3300031911 Bacteria 975
160 Ga0307409_100030223 3300031995 Bacteria 3889
161 Ga0307409_100090942 3300031995 Bacteria 2500
162 Ga0307409_100315807 3300031995 Bacteria 1460
163 Ga0307414_10145753 3300032004 Bacteria 1860
164 Ga0373930_0013888 3300034816 Bacteria 1492
165 Ga0373948_0002121 3300034817 Bacteria 2888
166 Ga0373959_0015717 3300034820 Bacteria 1393
167 Ga0373929_0061475 3300035085 Bacteria 880
168 Ga0373934_0001527 3300035086 Bacteria 8478
169 Ga0373940_0036409 3300035088 Bacteria 1336
170 Ga0373952_0172550 3300035092 Bacteria 619
171 Ga0373923_0049865 3300035111 Bacteria 1752
172 Ga0373932_0007656 3300035112 Bacteria 2575
173 Ga0373936_0005904 3300035113 Bacteria 4609
174 Ga0373936_0199238 3300035113 Bacteria 883
175 Ga0373939_0019583 3300035114 Bacteria 1827
176 Ga0373941_0109928 3300035115 Bacteria 970
177 Ga0373945_0070250 3300035116 Bacteria 1324
178 Ga0373953_0025993 3300035117 Bacteria 2241
179 Ga0373953_0106063 3300035117 Bacteria 1185
180 Ga0373954_0290351 3300035118 Bacteria 806
181 Ga0373956_0013114 3300035119 Bacteria 3446
182 Ga0373957_0093576 3300035120 Bacteria 1197
183 Ga0373960_0008009 3300035121 Bacteria 2519
184 Ga0373955_0072275 3300035172 Bacteria 1932
185 Ga0373942_0267228 3300035207 Bacteria 586
186 Ga0316574_0214327 3300035398 Bacteria 1235
187 Ga0373924_0008391 3300035410 Bacteria 3751
188 Ga0373924_0105445 3300035410 Bacteria 1215
189 Ga0373931_0009239 3300035691 Bacteria 4708
190 Ga0373935_0048674 3300035692 Bacteria 2684
191 Ga0373935_0150196 3300035692 Bacteria 1580
192 Ga0373935_0623913 3300035692 Bacteria 789
193 Ga0373935_0647366 3300035692 Bacteria 775
194 Ga0373927_0071170 3300035695 Bacteria 2251
195 Ga0373927_0130901 3300035695 Bacteria 1639
196 Ga0373927_0167521 3300035695 Bacteria 1440
197 Ga0373933_0016109 3300035724 Bacteria 4176
198 Ga0373933_0218846 3300035724 Bacteria 1221
199 Ga0373947_0056919 3300035725 Bacteria 2364
200 Ga0373947_0269630 3300035725 Bacteria 1130
201 Ga0373947_0378615 3300035725 Bacteria 952
202 Ga0373937_0052043 3300036401 Bacteria 3753
203 Ga0373937_0069222 3300036401 Bacteria 3253
204 Ga0316584_0207612 3300036712 Bacteria 1443
205 Ga0395900_0125514 3300037418 Bacteria 2632
206 Ga0395900_0178731 3300037418 Bacteria 2158
207 Ga0395898_0046004 3300037466 Bacteria 4288
208 Ga0395898_1206303 3300037466 Bacteria 688
209 Ga0436364_1414573 3300037853 Bacteria 9225
210 Ga0436365_0059980 3300039437 Bacteria 938
211 Ga0436363_0051204 3300039450 Bacteria 1087
212 Ga0436363_0428169 3300039450 Bacteria 2195
213 Ga0466972_0389430 3300044658 Bacteria 653
214 Ga0466966_0117755 3300044684 Bacteria 1634
215 Ga0466961_0087614 3300044693 Bacteria 1967
216 Ga0466961_0379326 3300044693 Bacteria 859
217 Ga0466961_0419331 3300044693 Bacteria 811
218 Ga0466963_0007175 3300044694 Bacteria 6644
219 Ga0466963_0236318 3300044694 Bacteria 1281
220 Ga0466963_1182335 3300044694 Bacteria 537
221 Ga0466971_0025245 3300044719 Bacteria 2654
222 Ga0466971_0122684 3300044719 Bacteria 1203
223 Ga0466970_0519478 3300044765 Bacteria 687
224 Ga0466957_0056930 3300044842 Bacteria 2392
225 Ga0466957_0214544 3300044842 Bacteria 1269
226 Ga0466960_0025827 3300044901 Bacteria 2662
227 Ga0466958_0182732 3300045836 Bacteria 1331
228 Ga0466958_0192353 3300045836 Bacteria 1297
229 Ga0466967_0023449 3300045976 Bacteria 5057
230 Ga0466967_0053682 3300045976 Bacteria 3543
231 Ga0466967_0479828 3300045976 Bacteria 1218
232 Ga0466967_0811356 3300045976 Bacteria 929
233 Ga0466967_1815257 3300045976 Bacteria 607
234 Ga0495592_0000397 3300046454 Bacteria 33962
235 Ga0495603_0117701 3300046455 Bacteria 1549
236 Ga0495629_0001951 3300046459 Bacteria 16079
237 Ga0495629_0008151 3300046459 Bacteria 7708
238 Ga0495629_0017239 3300046459 Bacteria 5180
239 Ga0495641_0009710 3300046461 Bacteria 5685
240 Ga0495641_0018293 3300046461 Bacteria 3619
241 Ga0495641_0045835 3300046461 Bacteria 2012
242 Ga0495651_0044407 3300046462 Bacteria 3444
243 Ga0495651_0058485 3300046462 Bacteria 2958
244 Ga0495651_0407878 3300046462 Bacteria 886
245 Ga0495653_0017085 3300046463 Bacteria 5902
246 Ga0495653_0095990 3300046463 Bacteria 2156
247 Ga0495653_0310474 3300046463 Bacteria 1025
248 Ga0495580_0128754 3300046472 Bacteria 1756
249 Ga0495580_0298714 3300046472 Bacteria 1097
250 Ga0495582_0023030 3300046473 Bacteria 3406
251 Ga0495582_0124263 3300046473 Bacteria 1455
252 Ga0495582_0259494 3300046473 Bacteria 997
253 Ga0495639_0078695 3300046475 Bacteria 1532
254 Ga0495639_0098726 3300046475 Bacteria 1377
255 Ga0495639_0138033 3300046475 Bacteria 1171
256 Ga0495662_0024778 3300046476 Bacteria 2895
257 Ga0495662_0082780 3300046476 Bacteria 1561
258 Ga0495662_0403947 3300046476 Bacteria 671
259 Ga0495664_0094516 3300046477 Bacteria 1799
260 Ga0495664_0394973 3300046477 Bacteria 831
261 Ga0495664_0491633 3300046477 Bacteria 733
262 Ga0495594_0482080 3300046499 Bacteria 705
263 Ga0495608_0001756 3300046511 Bacteria 15486
264 Ga0495608_0063473 3300046511 Bacteria 2423
265 Ga0495618_0057745 3300046514 Bacteria 2457
266 Ga0495628_0025150 3300046516 Bacteria 4865
267 Ga0495630_0093603 3300046517 Bacteria 2271
268 Ga0495630_0149233 3300046517 Bacteria 1778
269 Ga0495630_0860808 3300046517 Bacteria 691
270 Ga0495666_0058039 3300046526 Bacteria 1852
271 Ga0495666_0303866 3300046526 Bacteria 721
272 Ga0495666_0326756 3300046526 Bacteria 692
273 Ga0495652_0089177 3300046529 Bacteria 2525
274 Ga0495652_0091761 3300046529 Bacteria 2482
275 Ga0495665_0006542 3300046531 Bacteria 6293
276 Ga0495640_0012413 3300046533 Bacteria 6507
277 Ga0495640_0130797 3300046533 Bacteria 1624
278 Ga0495586_0135844 3300046535 Bacteria 1378
279 Ga0495586_0169059 3300046535 Bacteria 1235
280 Ga0495586_0322104 3300046535 Bacteria 887
281 Ga0495587_0002185 3300046536 Bacteria 13084
282 Ga0495645_0074173 3300046543 Bacteria 2450
283 Ga0495645_0075546 3300046543 Bacteria 2425
284 Ga0495645_0308617 3300046543 Bacteria 1031
285 Ga0495667_0022052 3300046559 Bacteria 4292
286 Ga0495667_0066045 3300046559 Bacteria 2365
287 Ga0495634_0040674 3300046642 Bacteria 3159
288 Ga0495634_0040788 3300046642 Bacteria 3154
289 Ga0495634_0068441 3300046642 Bacteria 2345
290 Ga0495635_0007791 3300046663 Bacteria 7477
291 Ga0495635_0017210 3300046663 Bacteria 5048
292 Ga0495588_0079694 3300046674 Bacteria 1709
293 Ga0495588_0100486 3300046674 Bacteria 1520
294 Ga0495657_0002699 3300046675 Bacteria 14825
295 Ga0495657_0028092 3300046675 Bacteria 3961
296 Ga0495599_0011017 3300046678 Bacteria 5549
297 Ga0495599_0014239 3300046678 Bacteria 4923
298 Ga0495599_0131896 3300046678 Bacteria 1552
299 Ga0495623_0015250 3300046679 Bacteria 4965
300 Ga0495623_0033535 3300046679 Bacteria 3294
301 Ga0495646_0013197 3300046680 Bacteria 5249
302 Ga0495646_0077139 3300046680 Bacteria 1949
303 Ga0495646_0080318 3300046680 Bacteria 1902
304 Ga0495658_0025811 3300046683 Bacteria 3144
305 Ga0495613_0010454 3300046689 Bacteria 6890
306 Ga0495613_0055563 3300046689 Bacteria 2908
307 Ga0495624_0098219 3300046690 Bacteria 1804
308 Ga0495624_0593019 3300046690 Bacteria 661
309 Ga0495600_0002732 3300046809 Bacteria 10211
310 Ga0495600_0112109 3300046809 Bacteria 1776
311 Ga0495581_0021525 3300047315 Bacteria 3736
312 Ga0495581_0034567 3300047315 Bacteria 2924
313 Ga0495604_0008417 3300047317 Bacteria 8150
314 Ga0495604_0022194 3300047317 Bacteria 5066
315 Ga0495674_0009447 3300047319 Bacteria 9264
316 Ga0495674_0346075 3300047319 Bacteria 1207
317 Ga0495676_0115354 3300047321 Bacteria 1964
318 Ga0495676_0229573 3300047321 Bacteria 1275
319 Ga0495676_0518252 3300047321 Bacteria 781
320 Ga0495680_0003722 3300047322 Bacteria 14871
321 Ga0495680_0097818 3300047322 Bacteria 2190
322 Ga0495680_0265325 3300047322 Bacteria 1213
323 Ga0495675_0234109 3300047444 Bacteria 1107
324 Ga0495684_0022861 3300047471 Bacteria 4809
325 Ga0495684_0143511 3300047471 Bacteria 1789
326 Ga0495593_0003688 3300047673 Bacteria 9146
327 Ga0495593_0008660 3300047673 Bacteria 5914
328 Ga0495602_0057510 3300048088 Bacteria 3410
329 Ga0495602_0106647 3300048088 Bacteria 2286
330 Ga0496101_0264312 3300048904 Bacteria 1342
331 Ga0496102_0196490 3300048905 Bacteria 1901
332 Ga0496102_0465639 3300048905 Bacteria 1185
333 Ga0496102_0622810 3300048905 Bacteria 1002
334 Ga0496103_0171401 3300048906 Bacteria 1394
335 Ga0496104_0010469 3300048907 Bacteria 8283
336 Ga0496104_0020892 3300048907 Bacteria 6004
337 Ga0496104_0312438 3300048907 Bacteria 1484
338 Ga0496104_1465650 3300048907 Bacteria 585
339 Ga0496105_0006079 3300048908 Bacteria 9239
340 Ga0496105_0189244 3300048908 Bacteria 1683
341 Ga0496105_0515924 3300048908 Bacteria 937
342 Ga0496106_0040725 3300048909 Bacteria 3480
343 Ga0496107_0125951 3300048910 Bacteria 1889
344 Ga0496108_0008061 3300048911 Bacteria 8546
345 Ga0496109_0014126 3300048912 Bacteria 6941
346 Ga0496109_0291411 3300048912 Bacteria 1539
347 Ga0496109_0317336 3300048912 Bacteria 1470
348 Ga0496110_0002242 3300048913 Bacteria 14460
349 Ga0496110_0088216 3300048913 Bacteria 2770
350 Ga0496111_0014307 3300048914 Bacteria 5418
351 Ga0496112_0097493 3300048915 Bacteria 2910
352 Ga0496112_0325728 3300048915 Bacteria 1480
353 Ga0496112_0474626 3300048915 Bacteria 1188
354 Ga0496112_0634877 3300048915 Bacteria 998
355 Ga0496113_0182376 3300048916 Bacteria 1664
356 Ga0496114_0024584 3300048917 Bacteria 4918
357 Ga0496115_0071559 3300048918 Bacteria 2812
358 Ga0496115_0460067 3300048918 Bacteria 1026
359 Ga0496126_0170755 3300048929 Bacteria 1853
360 Ga0496126_0242440 3300048929 Bacteria 1505
361 Ga0501033_0042716 3300049570 Bacteria 3379
362 Ga0501036_0175265 3300049572 Bacteria 1806
363 Ga0501037_0087379 3300049573 Bacteria 2256
364 Ga0501038_0098110 3300049574 Bacteria 2443
365 Ga0501038_0247398 3300049574 Bacteria 1413
366 Ga0501038_0323193 3300049574 Bacteria 1206
367 Ga0501044_0184769 3300049823 Bacteria 2050
368 nmdc:mga0n895_166328_c1 3300050512 Bacteria 2237
369 nmdc:mga0n895_93363_c1 3300050512 Bacteria 3013
370 nmdc:mga0rr50_26686_c1 3300050513 Bacteria 4034
371 nmdc:mga08x19_115521_c1 3300050514 Bacteria 1794
372 nmdc:mga08x19_663081_c1 3300050514 Bacteria 740
373 nmdc:mga0a205_848066_c1 3300050515 Bacteria 761
374 Ga0495601_0018028 3300053077 Bacteria 4292
375 Ga0495601_0066999 3300053077 Bacteria 2286
376 Ga0495601_0730878 3300053077 Bacteria 630
377 Ga0495612_0026219 3300053078 Bacteria 2342
378 Ga0495619_0009299 3300053085 Bacteria 6204
379 Ga0495619_0036126 3300053085 Bacteria 3216
380 Ga0495619_0087244 3300053085 Bacteria 2109
381 Ga0500573_0062956 3300053140 Bacteria 2123
382 2772645545 2772190715 Bacteria 6959372
383 2855673198 2855670206 Bacteria 7120389
384 2855682121 2855676851 Bacteria 7063653
385 2857293611 2857288857 Bacteria 7189066
386 2858851217 2858848962 Bacteria 6963058
387 2858887670 2858882152 Bacteria 7230291
388 2858893503 2858888857 Bacteria 7060307
389 2858896964 2858895516 Bacteria 7378898
390 2866070925 2866065130 Bacteria 6518152
391 2869051000 2869048445 Bacteria 6875584
392 2869062045 2869061728 Bacteria 7112407
393 2869068995 2869068681 Bacteria 7205615
394 2880491704 2880489317 Bacteria 7096270
395 2880500636 2880495981 Bacteria 7340502
396 2917737117 2917736166 Bacteria 9690793
397 2929229130 2929226422 Bacteria 7248583
398 8003877632 8003870546 Bacteria 7396674
399 8054709272 8054704163 Bacteria 7247792
400 8054727741 8054727385 Bacteria 7558670
401 8054736669 8054734606 Bacteria 6947278
402 Ga0316584_0266624
403 rootH1_10095794
404 Ga0070683_100691784
405 Ga0070680_100160352
406 Ga0070682_100473226
407 Ga0068868_100813367
408 Ga0070691_10284730
409 Ga0070709_10001100
410 Ga0070709_10023252
411 Ga0070709_10201260
412 Ga0070709_10385903
413 Ga0070714_100577175
414 Ga0070714_100615864
415 Ga0070714_101333925
416 Ga0070713_100007982
417 Ga0070713_100066313
418 Ga0070713_100090082
419 Ga0070713_100334866
420 Ga0070713_100481768
421 Ga0070713_100608547
422 Ga0070713_100874962
423 Ga0070710_10006556
424 Ga0070710_10081570
425 Ga0070710_10093982
426 Ga0070710_10246611
427 Ga0070710_10728005
428 Ga0070701_10251489
429 Ga0070711_100024026
430 Ga0070711_100036645
431 Ga0070711_100122231
432 Ga0070711_100243034
433 Ga0070711_100478274
434 Ga0070708_100002379
435 Ga0070663_100228127
436 Ga0070678_100356620
437 Ga0070706_100540655
438 Ga0070707_100186954
439 Ga0070707_100571812
440 Ga0070698_100128226
441 Ga0070698_100132789
442 Ga0070699_100417783
443 Ga0070695_100092178
444 Ga0070696_100585385
445 Ga0070693_100214714
446 Ga0070665_100194507
447 Ga0070704_100276348
448 Ga0070704_100476859
449 Ga0068855_100262655
450 Ga0068857_100350896
451 Ga0068856_100087716
452 Ga0068856_100111593
453 Ga0068856_100259415
454 Ga0068856_101040034
455 Ga0070702_100066130
456 Ga0068864_100031645
457 Ga0068863_100377661
458 Ga0068858_100096289
459 Ga0070717_10016255
460 Ga0070717_10017480
461 Ga0070717_10054626
462 Ga0070717_10180387
463 Ga0070717_10556872
464 Ga0070715_10023847
465 Ga0070715_10082889
466 Ga0070715_10188944
467 Ga0070716_100075540
468 Ga0070716_100351471
469 Ga0070716_100355505
470 Ga0070712_100038934
471 Ga0070712_100056872
472 Ga0070712_100090615
473 Ga0070712_100101531
474 Ga0070712_100478896
475 Ga0070712_101060706
476 Ga0097621_100205845
477 Ga0068871_100013882
478 Ga0068871_100513357
479 Ga0075434_100079646
480 Ga0075434_100135237
481 Ga0075436_100179814
482 Ga0075436_100780809
483 Ga0075435_100038307
484 Ga0105245_11178065
485 Ga0105243_11415420
486 Ga0105241_10226470
487 Ga0105248_10394523
488 Ga0105237_10524009
489 Ga0105238_11166341
490 Ga0105239_11731626
491 Ga0105246_10721199
492 Ga0157373_10446558
493 Ga0157369_10253338
494 Ga0157369_10365896
495 Ga0157374_10044060
496 Ga0157374_10746790
497 Ga0157378_10629223
498 Ga0163162_10998966
499 Ga0157372_10183798
500 Ga0157375_10255176
501 Ga0163163_10038700
502 Ga0157379_10017573
503 Ga0157376_10173616
504 Ga0213874_10075402
505 Ga0213876_10310133
506 Ga0207692_10022575
507 Ga0207692_10029392
508 Ga0207692_10052282
509 Ga0207688_10372891
510 Ga0207685_10000487
511 Ga0207699_10020837
512 Ga0207699_10058428
513 Ga0207699_10078592
514 Ga0207699_10392309
515 Ga0207707_11478419
516 Ga0207693_10006379
517 Ga0207693_10054822
518 Ga0207693_10129772
519 Ga0207693_10453991
520 Ga0207693_10456481
521 Ga0207663_10005272
522 Ga0207663_10005771
523 Ga0207663_10028790
524 Ga0207663_10123602
525 Ga0207646_10345192
526 Ga0207687_10338086
527 Ga0207700_10001348
528 Ga0207700_10004372
529 Ga0207700_10025383
530 Ga0207700_10101840
531 Ga0207700_10108365
532 Ga0207700_10546971
533 Ga0207664_10002578
534 Ga0207664_10130331
535 Ga0207664_10248166
536 Ga0207664_10284725
537 Ga0207664_10336775
538 Ga0207664_10528811
539 Ga0207664_10689162
540 Ga0207665_10054283
541 Ga0207665_10437706
542 Ga0207665_10441032
543 Ga0207711_10316420
544 Ga0207661_10043133
545 Ga0207679_10613760
546 Ga0207667_10315608
547 Ga0207677_10761757
548 Ga0207703_10021999
549 Ga0207678_10298112
550 Ga0207702_10072354
551 Ga0207702_10823273
552 Ga0207683_10338823
553 Ga0268266_10521572
554 Ga0307516_10013753
555 Ga0307413_10417236
556 Ga0307413_11684118
557 Ga0307410_10002881
558 Ga0307406_10312683
559 Ga0307407_10032709
560 Ga0307412_10542817
561 Ga0307409_100030223
562 Ga0307409_100090942
563 Ga0307409_100315807
564 Ga0307414_10145753
565 Ga0373930_0013888
566 Ga0373948_0002121
567 Ga0373959_0015717
568 Ga0373929_0061475
569 Ga0373934_0001527
570 Ga0373940_0036409
571 Ga0373952_0172550
572 Ga0373923_0049865
573 Ga0373932_0007656
574 Ga0373936_0005904
575 Ga0373936_0199238
576 Ga0373939_0019583
577 Ga0373941_0109928
578 Ga0373945_0070250
579 Ga0373953_0025993
580 Ga0373953_0106063
581 Ga0373954_0290351
582 Ga0373956_0013114
583 Ga0373957_0093576
584 Ga0373960_0008009
585 Ga0373955_0072275
586 Ga0373942_0267228
587 Ga0316574_0214327
588 Ga0373924_0008391
589 Ga0373924_0105445
590 Ga0373931_0009239
591 Ga0373935_0048674
592 Ga0373935_0150196
593 Ga0373935_0623913
594 Ga0373935_0647366
595 Ga0373927_0071170
596 Ga0373927_0130901
597 Ga0373927_0167521
598 Ga0373933_0016109
599 Ga0373933_0218846
600 Ga0373947_0056919
601 Ga0373947_0269630
602 Ga0373947_0378615
603 Ga0373937_0052043
604 Ga0373937_0069222
605 Ga0316584_0207612
606 Ga0395900_0125514
607 Ga0395900_0178731
608 Ga0395898_0046004
609 Ga0395898_1206303
610 Ga0436364_1414573
611 Ga0436365_0059980
612 Ga0436363_0051204
613 Ga0436363_0428169
614 Ga0466972_0389430
615 Ga0466966_0117755
616 Ga0466961_0087614
617 Ga0466961_0379326
618 Ga0466961_0419331
619 Ga0466963_0007175
620 Ga0466963_0236318
621 Ga0466963_1182335
622 Ga0466971_0025245
623 Ga0466971_0122684
624 Ga0466970_0519478
625 Ga0466957_0056930
626 Ga0466957_0214544
627 Ga0466960_0025827
628 Ga0466958_0182732
629 Ga0466958_0192353
630 Ga0466967_0023449
631 Ga0466967_0053682
632 Ga0466967_0479828
633 Ga0466967_0811356
634 Ga0466967_1815257
635 Ga0495592_0000397
636 Ga0495603_0117701
637 Ga0495629_0001951
638 Ga0495629_0008151
639 Ga0495629_0017239
640 Ga0495641_0009710
641 Ga0495641_0018293
642 Ga0495641_0045835
643 Ga0495651_0044407
644 Ga0495651_0058485
645 Ga0495651_0407878
646 Ga0495653_0017085
647 Ga0495653_0095990
648 Ga0495653_0310474
649 Ga0495580_0128754
650 Ga0495580_0298714
651 Ga0495582_0023030
652 Ga0495582_0124263
653 Ga0495582_0259494
654 Ga0495639_0078695
655 Ga0495639_0098726
656 Ga0495639_0138033
657 Ga0495662_0024778
658 Ga0495662_0082780
659 Ga0495662_0403947
660 Ga0495664_0094516
661 Ga0495664_0394973
662 Ga0495664_0491633
663 Ga0495594_0482080
664 Ga0495608_0001756
665 Ga0495608_0063473
666 Ga0495618_0057745
667 Ga0495628_0025150
668 Ga0495630_0093603
669 Ga0495630_0149233
670 Ga0495630_0860808
671 Ga0495666_0058039
672 Ga0495666_0303866
673 Ga0495666_0326756
674 Ga0495652_0089177
675 Ga0495652_0091761
676 Ga0495665_0006542
677 Ga0495640_0012413
678 Ga0495640_0130797
679 Ga0495586_0135844
680 Ga0495586_0169059
681 Ga0495586_0322104
682 Ga0495587_0002185
683 Ga0495645_0074173
684 Ga0495645_0075546
685 Ga0495645_0308617
686 Ga0495667_0022052
687 Ga0495667_0066045
688 Ga0495634_0040674
689 Ga0495634_0040788
690 Ga0495634_0068441
691 Ga0495635_0007791
692 Ga0495635_0017210
693 Ga0495588_0079694
694 Ga0495588_0100486
695 Ga0495657_0002699
696 Ga0495657_0028092
697 Ga0495599_0011017
698 Ga0495599_0014239
699 Ga0495599_0131896
700 Ga0495623_0015250
701 Ga0495623_0033535
702 Ga0495646_0013197
703 Ga0495646_0077139
704 Ga0495646_0080318
705 Ga0495658_0025811
706 Ga0495613_0010454
707 Ga0495613_0055563
708 Ga0495624_0098219
709 Ga0495624_0593019
710 Ga0495600_0002732
711 Ga0495600_0112109
712 Ga0495581_0021525
713 Ga0495581_0034567
714 Ga0495604_0008417
715 Ga0495604_0022194
716 Ga0495674_0009447
717 Ga0495674_0346075
718 Ga0495676_0115354
719 Ga0495676_0229573
720 Ga0495676_0518252
721 Ga0495680_0003722
722 Ga0495680_0097818
723 Ga0495680_0265325
724 Ga0495675_0234109
725 Ga0495684_0022861
726 Ga0495684_0143511
727 Ga0495593_0003688
728 Ga0495593_0008660
729 Ga0495602_0057510
730 Ga0495602_0106647
731 Ga0496101_0264312
732 Ga0496102_0196490
733 Ga0496102_0465639
734 Ga0496102_0622810
735 Ga0496103_0171401
736 Ga0496104_0010469
737 Ga0496104_0020892
738 Ga0496104_0312438
739 Ga0496104_1465650
740 Ga0496105_0006079
741 Ga0496105_0189244
742 Ga0496105_0515924
743 Ga0496106_0040725
744 Ga0496107_0125951
745 Ga0496108_0008061
746 Ga0496109_0014126
747 Ga0496109_0291411
748 Ga0496109_0317336
749 Ga0496110_0002242
750 Ga0496110_0088216
751 Ga0496111_0014307
752 Ga0496112_0097493
753 Ga0496112_0325728
754 Ga0496112_0474626
755 Ga0496112_0634877
756 Ga0496113_0182376
757 Ga0496114_0024584
758 Ga0496115_0071559
759 Ga0496115_0460067
760 Ga0496126_0170755
761 Ga0496126_0242440
762 Ga0501033_0042716
763 Ga0501036_0175265
764 Ga0501037_0087379
765 Ga0501038_0098110
766 Ga0501038_0247398
767 Ga0501038_0323193
768 Ga0501044_0184769
769 nmdc:mga0n895_166328_c1
770 nmdc:mga0n895_93363_c1
771 nmdc:mga0rr50_26686_c1
772 nmdc:mga08x19_115521_c1
773 nmdc:mga08x19_663081_c1
774 nmdc:mga0a205_848066_c1
775 Ga0495601_0018028
776 Ga0495601_0066999
777 Ga0495601_0730878
778 Ga0495612_0026219
779 Ga0495619_0009299
780 Ga0495619_0036126
781 Ga0495619_0087244
782 Ga0500573_0062956
783 2772645545
784 2855673198
785 2855682121
786 2857293611
787 2858851217
788 2858887670
789 2858893503
790 2858896964
791 2866070925
792 2869051000
793 2869062045
794 2869068995
795 2880491704
796 2880500636
797 2917737117
798 2929229130
799 8003877632
800 8054709272
801 8054727741
802 8054736669

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04978

DUF664

Protein of unknown function (DUF664)

41

186

0.96

PF12867

DinB_2

DinB superfamily

46

176

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f22-assembly1.cif.gz_A crystal structure of a putative dna damage-inducable (dinb) protein (bh3987) from bacillus halodurans at 1.42 a resolution 0.8027 23 163
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.7796 16 163
2yqy-assembly2.cif.gz_B crystal structure of tt2238, a four-helix bundle protein 0.7785 20 157
2p1a-assembly1.cif.gz_A crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.7732 19 166
3dka-assembly1.cif.gz_A crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.7703 21 163
ID Description Score Start End Superfamily
af_P9WM91_7_150_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8044 23 159 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7867 25 160 1.20.120.450
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7785 20 157 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7714 25 160 1.20.120.450
af_P9WM91_7_150_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7646 23 159 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A561T539-F1-model_v4 Uncharacterized protein DUF664 0.9965 38 165
AF-A0A345VG50-F1-model_v4 Mini-circle protein 0.9954 16 165
AF-A0A7H0HM85-F1-model_v4 DinB family protein 0.9948 14 165
AF-A0A7W7CZ89-F1-model_v4 DinB family protein 0.9921 8 163
AF-A0A1C4VIQ4-F1-model_v4 DinB superfamily protein 0.9902 9 165

Map