F434442
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 399 | 309 | 202 | 283 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2511231023|2511370061 |
| Length | 327 |
| Sequence | SYMGLRMNRPLKLTSKPQLALQSYLDNLLQEIPEELPPVIEAQPEVVESTEALDEFQAAVLEEQARDAQKAAKPVAPVVSPAAAPVAKAPVALIETAEPVRAPVSTLAPLLQTQLLKTAPQPTVVEPAPVPAPVAPAPVEQTLVPPLVEVHLPPNNTPPPVETDGRPAWASEAFECLLFDVAGLTLAVPLVCLGSIYSLAGHELTPLFGQPEWFLGILPSQAGNLKVLDTARWVMPDRYRDDFRQGLQYVISVQGYEWGLAVHQVSRSLRLDPNEIKWRSHRGQRPWLAGTVIEHMCALLDVSALAELIASGGAKHLGGHKPLHKPT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 3 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 4 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 5 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 6 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 7 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 8 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 9 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 10 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 11 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 12 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 13 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 14 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 15 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 16 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 17 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 18 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 19 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 20 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 21 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 22 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 23 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 24 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 25 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 26 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 27 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 28 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 29 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 30 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 31 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 32 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 33 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 34 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 35 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 36 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 37 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 38 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 39 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 40 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 41 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 42 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 43 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 44 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 45 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 46 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 47 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 48 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 49 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 50 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 51 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 52 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 53 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 54 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 55 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 56 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 57 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 58 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 59 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 60 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 61 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 62 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 63 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 64 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 65 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 66 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 67 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 68 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 69 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 70 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 71 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 72 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 73 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 74 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 75 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 76 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 77 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 78 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 79 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 80 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 81 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 82 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 83 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 84 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 85 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 86 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 87 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 88 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 89 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 90 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 91 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 92 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 93 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 94 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 95 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 96 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 97 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 98 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 99 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 100 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 101 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 102 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 103 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 104 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 105 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 106 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 107 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 108 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 109 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 110 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 111 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 112 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 113 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 114 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 115 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 116 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 117 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 118 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 119 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 120 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 121 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 122 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 123 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 124 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 125 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 126 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 127 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 128 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 129 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 130 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 131 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 132 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 133 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 134 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 135 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 136 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 137 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 138 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 139 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 140 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 141 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 142 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 143 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 144 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 145 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 146 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 147 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 148 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 149 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 150 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 151 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 152 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 153 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 154 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 155 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 156 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 157 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 158 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 159 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 160 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 161 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 162 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 163 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 164 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 165 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 166 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 167 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 168 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 169 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 170 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 171 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 172 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 173 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 174 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 175 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 176 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 177 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 178 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 179 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 180 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 181 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 182 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 183 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 184 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 185 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 186 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 187 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 188 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 189 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 190 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 193 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 205 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 206 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 207 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 208 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 209 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 210 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 211 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 212 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 213 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 214 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 215 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 216 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 217 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 272 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 273 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 274 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 275 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 276 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 277 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 278 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 279 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 280 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 281 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 285 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 287 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 288 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 289 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 290 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 291 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 292 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 293 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 294 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 295 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 296 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 297 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 298 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 299 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 300 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 301 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 302 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 303 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 304 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 305 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 306 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 307 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 308 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 309 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 50.63 |
| Metatranscriptomes | 0 |
| Isolates | 49.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.76 |
| Nodule | 6.02 |
| Rhizoplane | 15.04 |
| Rhizosphere | 56.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1910630 | 2162886007 | Bacteria | 4616 |
| 2 | JGI25162J39368_1000212 | 3300002737 | Bacteria | 61036 |
| 3 | JGI25163J39215_1000503 | 3300002771 | Bacteria | 11630 |
| 4 | JGI25164J39214_1000051 | 3300002772 | Bacteria | 122377 |
| 5 | JGI25165J46597_1000091 | 3300003214 | Bacteria | 167941 |
| 6 | Ga0055530_10000158 | 3300003791 | Bacteria | 61440 |
| 7 | Ga0055540_1000182 | 3300003792 | Bacteria | 61440 |
| 8 | Ga0065714_10002255 | 3300005288 | Bacteria | 42568 |
| 9 | Ga0065714_10005121 | 3300005288 | Bacteria | 5394 |
| 10 | Ga0065714_10116355 | 3300005288 | Bacteria | 1393 |
| 11 | Ga0065704_10070596 | 3300005289 | Bacteria | 19482 |
| 12 | Ga0075362_10076448 | 3300006177 | Bacteria | 1537 |
| 13 | Ga0099823_1000984 | 3300006944 | Bacteria | 21889 |
| 14 | Ga0079104_1000545 | 3300006946 | Bacteria | 39305 |
| 15 | Ga0099826_10002700 | 3300006948 | Bacteria | 11593 |
| 16 | Ga0105251_10000060 | 3300009011 | Bacteria | 102799 |
| 17 | Ga0105251_10040434 | 3300009011 | Bacteria | 2273 |
| 18 | Ga0105251_10076646 | 3300009011 | Bacteria | 1551 |
| 19 | Ga0105251_10103080 | 3300009011 | Bacteria | 1303 |
| 20 | Ga0105244_10018535 | 3300009036 | Bacteria | 3902 |
| 21 | Ga0105244_10083975 | 3300009036 | Bacteria | 1573 |
| 22 | Ga0157373_10005441 | 3300013100 | Bacteria | 9564 |
| 23 | Ga0157373_10008944 | 3300013100 | Bacteria | 7408 |
| 24 | Ga0157372_10102990 | 3300013307 | Bacteria | 3261 |
| 25 | Ga0182006_1009115 | 3300015261 | Bacteria | 4462 |
| 26 | Ga0163161_10315586 | 3300017792 | Bacteria | 1234 |
| 27 | Ga0209760_100022 | 3300025207 | Bacteria | 159218 |
| 28 | Ga0207427_100047 | 3300025231 | Bacteria | 240409 |
| 29 | Ga0209437_100009 | 3300025233 | Bacteria | 915954 |
| 30 | Ga0209233_1000032 | 3300025261 | Bacteria | 623596 |
| 31 | Ga0209050_1000009 | 3300025298 | Bacteria | 1047265 |
| 32 | Ga0209051_1000008 | 3300025303 | Bacteria | 706935 |
| 33 | Ga0209257_1014823 | 3300025304 | Bacteria | 3308 |
| 34 | Ga0207696_1001395 | 3300025711 | Bacteria | 13209 |
| 35 | Ga0207655_1000461 | 3300025728 | Bacteria | 53372 |
| 36 | Ga0207655_1000645 | 3300025728 | Bacteria | 41696 |
| 37 | Ga0207655_1004518 | 3300025728 | Bacteria | 9838 |
| 38 | Ga0207655_1059008 | 3300025728 | Bacteria | 1496 |
| 39 | Ga0207713_1000150 | 3300025735 | Bacteria | 105170 |
| 40 | Ga0207713_1003379 | 3300025735 | Bacteria | 10938 |
| 41 | Ga0207713_1027354 | 3300025735 | Bacteria | 2592 |
| 42 | Ga0209281_1000018 | 3300027111 | Bacteria | 579091 |
| 43 | Ga0209389_1000018 | 3300027296 | Bacteria | 179898 |
| 44 | Ga0316177_1151181 | 3300030731 | Bacteria | 2249 |
| 45 | Ga0307408_100158038 | 3300031548 | Bacteria | 1797 |
| 46 | Ga0307414_10257835 | 3300032004 | Bacteria | 1453 |
| 47 | Ga0439438_004695 | 3300041405 | Bacteria | 5182 |
| 48 | Ga0439466_0007541 | 3300041411 | Bacteria | 4115 |
| 49 | Ga0439466_0018824 | 3300041411 | Bacteria | 2474 |
| 50 | Ga0439432_036173 | 3300042006 | Bacteria | 1580 |
| 51 | Ga0439452_016468 | 3300042010 | Bacteria | 2007 |
| 52 | Ga0439456_011482 | 3300042013 | Bacteria | 1832 |
| 53 | Ga0439463_000685 | 3300042016 | Bacteria | 9419 |
| 54 | Ga0450904_003441 | 3300042139 | Bacteria | 1713 |
| 55 | Ga0450909_008018 | 3300042185 | Bacteria | 1532 |
| 56 | Ga0495617_009673 | 3300046452 | Bacteria | 3307 |
| 57 | Ga0495617_030161 | 3300046452 | Bacteria | 1823 |
| 58 | Ga0495617_055936 | 3300046452 | Bacteria | 1308 |
| 59 | Ga0495627_001575 | 3300046453 | Bacteria | 12922 |
| 60 | Ga0495627_015386 | 3300046453 | Bacteria | 2642 |
| 61 | Ga0495590_0024898 | 3300046457 | Bacteria | 2106 |
| 62 | Ga0495591_001051 | 3300046458 | Bacteria | 18560 |
| 63 | Ga0495591_001253 | 3300046458 | Bacteria | 16253 |
| 64 | Ga0495591_001297 | 3300046458 | Bacteria | 15823 |
| 65 | Ga0495638_0049623 | 3300046460 | Bacteria | 2623 |
| 66 | Ga0495653_0001863 | 3300046463 | Bacteria | 16657 |
| 67 | Ga0495650_0000221 | 3300046471 | Bacteria | 118284 |
| 68 | Ga0495605_0000032 | 3300046474 | Bacteria | 210550 |
| 69 | Ga0495605_0003265 | 3300046474 | Bacteria | 9735 |
| 70 | Ga0495605_0006439 | 3300046474 | Bacteria | 6748 |
| 71 | Ga0495639_0117219 | 3300046475 | Bacteria | 1268 |
| 72 | Ga0495584_0014918 | 3300046491 | Bacteria | 3958 |
| 73 | Ga0495585_0077048 | 3300046492 | Bacteria | 1810 |
| 74 | Ga0495594_0000964 | 3300046499 | Bacteria | 14958 |
| 75 | Ga0495596_0011246 | 3300046500 | Bacteria | 3866 |
| 76 | Ga0495607_0002661 | 3300046501 | Bacteria | 14311 |
| 77 | Ga0495607_0003469 | 3300046501 | Bacteria | 12075 |
| 78 | Ga0495607_0039409 | 3300046501 | Bacteria | 2821 |
| 79 | Ga0495607_0110338 | 3300046501 | Bacteria | 1459 |
| 80 | Ga0495583_0000052 | 3300046506 | Bacteria | 211902 |
| 81 | Ga0495583_0006401 | 3300046506 | Bacteria | 7705 |
| 82 | Ga0495583_0017535 | 3300046506 | Bacteria | 3797 |
| 83 | Ga0495606_0000698 | 3300046507 | Bacteria | 52041 |
| 84 | Ga0495616_0013537 | 3300046513 | Bacteria | 4597 |
| 85 | Ga0495616_0061149 | 3300046513 | Bacteria | 1847 |
| 86 | Ga0495620_0052867 | 3300046515 | Bacteria | 1722 |
| 87 | Ga0495630_0109395 | 3300046517 | Bacteria | 2093 |
| 88 | Ga0495631_0004610 | 3300046518 | Bacteria | 7297 |
| 89 | Ga0495631_0011309 | 3300046518 | Bacteria | 4393 |
| 90 | Ga0495631_0043299 | 3300046518 | Bacteria | 1986 |
| 91 | Ga0495632_0001503 | 3300046519 | Bacteria | 19285 |
| 92 | Ga0495632_0008717 | 3300046519 | Bacteria | 6186 |
| 93 | Ga0495632_0034212 | 3300046519 | Bacteria | 2602 |
| 94 | Ga0495632_0040908 | 3300046519 | Bacteria | 2331 |
| 95 | Ga0495632_0088544 | 3300046519 | Bacteria | 1470 |
| 96 | Ga0495637_0000023 | 3300046520 | Bacteria | 172407 |
| 97 | Ga0495637_0036759 | 3300046520 | Bacteria | 2130 |
| 98 | Ga0495637_0042706 | 3300046520 | Bacteria | 1938 |
| 99 | Ga0495637_0047942 | 3300046520 | Bacteria | 1801 |
| 100 | Ga0495637_0052848 | 3300046520 | Bacteria | 1693 |
| 101 | Ga0495643_0000488 | 3300046522 | Bacteria | 50207 |
| 102 | Ga0495643_0012119 | 3300046522 | Bacteria | 5212 |
| 103 | Ga0495643_0054098 | 3300046522 | Bacteria | 2150 |
| 104 | Ga0495644_0017239 | 3300046523 | Bacteria | 2761 |
| 105 | Ga0495648_0002803 | 3300046524 | Bacteria | 15688 |
| 106 | Ga0495648_0019402 | 3300046524 | Bacteria | 4780 |
| 107 | Ga0495648_0054115 | 3300046524 | Bacteria | 2426 |
| 108 | Ga0495666_0081046 | 3300046526 | Bacteria | 1535 |
| 109 | Ga0495654_0000639 | 3300046530 | Bacteria | 27630 |
| 110 | Ga0495654_0001730 | 3300046530 | Bacteria | 14663 |
| 111 | Ga0495654_0007842 | 3300046530 | Bacteria | 5937 |
| 112 | Ga0495654_0099826 | 3300046530 | Bacteria | 1337 |
| 113 | Ga0495654_0111954 | 3300046530 | Bacteria | 1244 |
| 114 | Ga0495654_0115033 | 3300046530 | Bacteria | 1223 |
| 115 | Ga0495609_0000032 | 3300046538 | Bacteria | 211021 |
| 116 | Ga0495609_0000382 | 3300046538 | Bacteria | 37599 |
| 117 | Ga0495597_0002903 | 3300046542 | Bacteria | 10426 |
| 118 | Ga0495645_0118327 | 3300046543 | Bacteria | 1868 |
| 119 | Ga0495622_0014421 | 3300046557 | Bacteria | 3669 |
| 120 | Ga0495633_0000040 | 3300046558 | Bacteria | 177876 |
| 121 | Ga0495611_0000589 | 3300046648 | Bacteria | 20938 |
| 122 | Ga0495611_0007814 | 3300046648 | Bacteria | 4540 |
| 123 | Ga0495611_0011676 | 3300046648 | Bacteria | 3726 |
| 124 | Ga0495625_0000010 | 3300046660 | Bacteria | 381775 |
| 125 | Ga0495625_0266318 | 3300046660 | Bacteria | 1107 |
| 126 | Ga0495661_0000020 | 3300046665 | Bacteria | 196901 |
| 127 | Ga0495661_0000037 | 3300046665 | Bacteria | 164234 |
| 128 | Ga0495661_0051876 | 3300046665 | Bacteria | 2474 |
| 129 | Ga0495657_0204817 | 3300046675 | Bacteria | 1201 |
| 130 | Ga0495623_0068208 | 3300046679 | Bacteria | 2218 |
| 131 | Ga0495670_0003941 | 3300046691 | Bacteria | 7287 |
| 132 | Ga0495670_0007226 | 3300046691 | Bacteria | 5462 |
| 133 | Ga0495671_0013658 | 3300046692 | Bacteria | 4389 |
| 134 | Ga0495671_0033008 | 3300046692 | Bacteria | 2639 |
| 135 | Ga0495671_0038559 | 3300046692 | Bacteria | 2414 |
| 136 | Ga0495671_0113298 | 3300046692 | Bacteria | 1324 |
| 137 | Ga0495671_0126459 | 3300046692 | Bacteria | 1246 |
| 138 | Ga0495649_0002258 | 3300046694 | Bacteria | 13696 |
| 139 | Ga0495649_0077696 | 3300046694 | Bacteria | 1776 |
| 140 | Ga0495649_0092694 | 3300046694 | Bacteria | 1608 |
| 141 | Ga0495589_0081947 | 3300046794 | Bacteria | 1569 |
| 142 | Ga0495600_0047947 | 3300046809 | Bacteria | 2787 |
| 143 | Ga0495660_0000768 | 3300046810 | Bacteria | 24134 |
| 144 | Ga0495660_0065634 | 3300046810 | Bacteria | 1936 |
| 145 | Ga0495660_0078465 | 3300046810 | Bacteria | 1735 |
| 146 | Ga0495660_0123047 | 3300046810 | Bacteria | 1310 |
| 147 | Ga0495660_0142910 | 3300046810 | Bacteria | 1188 |
| 148 | Ga0495672_0004780 | 3300047320 | Bacteria | 10925 |
| 149 | Ga0495672_0010599 | 3300047320 | Bacteria | 6552 |
| 150 | Ga0495672_0052447 | 3300047320 | Bacteria | 2395 |
| 151 | Ga0495672_0106287 | 3300047320 | Bacteria | 1513 |
| 152 | Ga0495672_0106694 | 3300047320 | Bacteria | 1509 |
| 153 | Ga0495676_0000002 | 3300047321 | Bacteria | 373918 |
| 154 | Ga0495683_0000011 | 3300047323 | Bacteria | 212053 |
| 155 | Ga0495683_0000089 | 3300047323 | Bacteria | 92081 |
| 156 | Ga0495675_0041882 | 3300047444 | Bacteria | 2918 |
| 157 | Ga0495679_001367 | 3300047446 | Bacteria | 14010 |
| 158 | Ga0495673_0003566 | 3300047469 | Bacteria | 10226 |
| 159 | Ga0495673_0011248 | 3300047469 | Bacteria | 4825 |
| 160 | Ga0495673_0041114 | 3300047469 | Bacteria | 2084 |
| 161 | Ga0495673_0104869 | 3300047469 | Bacteria | 1137 |
| 162 | Ga0495673_0104898 | 3300047469 | Bacteria | 1137 |
| 163 | Ga0495681_0002330 | 3300047470 | Bacteria | 13648 |
| 164 | Ga0495681_0009755 | 3300047470 | Bacteria | 5879 |
| 165 | Ga0495681_0011045 | 3300047470 | Bacteria | 5414 |
| 166 | Ga0495681_0030038 | 3300047470 | Bacteria | 2774 |
| 167 | Ga0495681_0055148 | 3300047470 | Bacteria | 1854 |
| 168 | Ga0495684_0057665 | 3300047471 | Bacteria | 2959 |
| 169 | Ga0495686_0009309 | 3300047472 | Bacteria | 7087 |
| 170 | Ga0495593_0056206 | 3300047673 | Bacteria | 2069 |
| 171 | Ga0495626_0000007 | 3300048091 | Bacteria | 276374 |
| 172 | Ga0496102_0085440 | 3300048905 | Bacteria | 2913 |
| 173 | Ga0496102_0175682 | 3300048905 | Bacteria | 2017 |
| 174 | Ga0496102_0359318 | 3300048905 | Bacteria | 1371 |
| 175 | Ga0496114_0014326 | 3300048917 | Bacteria | 6361 |
| 176 | Ga0496116_0095300 | 3300048919 | Bacteria | 1796 |
| 177 | Ga0496117_0004263 | 3300048920 | Bacteria | 15954 |
| 178 | Ga0496117_0101247 | 3300048920 | Bacteria | 1823 |
| 179 | Ga0496117_0112635 | 3300048920 | Bacteria | 1691 |
| 180 | Ga0496118_0003932 | 3300048921 | Bacteria | 18177 |
| 181 | Ga0496118_0046849 | 3300048921 | Bacteria | 3358 |
| 182 | Ga0496118_0074062 | 3300048921 | Bacteria | 2436 |
| 183 | Ga0496118_0142593 | 3300048921 | Bacteria | 1515 |
| 184 | Ga0496121_0006247 | 3300048924 | Bacteria | 14916 |
| 185 | Ga0496121_0184805 | 3300048924 | Bacteria | 1500 |
| 186 | Ga0496122_0001401 | 3300048925 | Bacteria | 39147 |
| 187 | Ga0496122_0001761 | 3300048925 | Bacteria | 33221 |
| 188 | Ga0496122_0057735 | 3300048925 | Bacteria | 2879 |
| 189 | Ga0496123_0000437 | 3300048926 | Bacteria | 74882 |
| 190 | Ga0496123_0004322 | 3300048926 | Bacteria | 15077 |
| 191 | Ga0496124_0021185 | 3300048927 | Bacteria | 5992 |
| 192 | Ga0496124_0061136 | 3300048927 | Bacteria | 3158 |
| 193 | Ga0496124_0082963 | 3300048927 | Bacteria | 2630 |
| 194 | Ga0496125_0024015 | 3300048928 | Bacteria | 5615 |
| 195 | Ga0495678_000033 | 3300049459 | Bacteria | 211804 |
| 196 | Ga0495678_000787 | 3300049459 | Bacteria | 28437 |
| 197 | Ga0495678_052362 | 3300049459 | Bacteria | 1572 |
| 198 | Ga0501032_0008112 | 3300049569 | Bacteria | 7657 |
| 199 | Ga0501039_0300170 | 3300049575 | Bacteria | 1263 |
| 200 | Ga0501241_003630 | 3300049758 | Bacteria | 2910 |
| 201 | nmdc:mga08x19_162434_c1 | 3300050514 | Bacteria | 1518 |
| 202 | Ga0500618_018577 | 3300053125 | Bacteria | 1718 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046452 | Ga0495617_055936 | Ga0495617_055936_49_906 | 217 |
| 2 | 3300046474 | Ga0495605_0000032 | Ga0495605_0000032_138369_139376 | 223 |
| 3 | 3300046499 | Ga0495594_0000964 | Ga0495594_0000964_3156_4163 | 223 |
| 4 | 3300046506 | Ga0495583_0000052 | Ga0495583_0000052_139729_140736 | 223 |
| 5 | 3300046518 | Ga0495631_0043299 | Ga0495631_0043299_802_1809 | 223 |
| 6 | 3300046524 | Ga0495648_0019402 | Ga0495648_0019402_992_1999 | 223 |
| 7 | 3300046538 | Ga0495609_0000032 | Ga0495609_0000032_71149_72156 | 223 |
| 8 | 3300046542 | Ga0495597_0002903 | Ga0495597_0002903_4659_5666 | 223 |
| 9 | 3300046558 | Ga0495633_0000040 | Ga0495633_0000040_37482_38489 | 223 |
| 10 | 3300046648 | Ga0495611_0007814 | Ga0495611_0007814_2709_3716 | 223 |
| 11 | 3300046665 | Ga0495661_0000037 | Ga0495661_0000037_137791_138798 | 223 |
| 12 | 3300046691 | Ga0495670_0003941 | Ga0495670_0003941_959_1966 | 223 |
| 13 | 3300046692 | Ga0495671_0013658 | Ga0495671_0013658_1555_2562 | 223 |
| 14 | 3300046810 | Ga0495660_0000768 | Ga0495660_0000768_4224_5231 | 223 |
| 15 | 3300047323 | Ga0495683_0000011 | Ga0495683_0000011_139894_140901 | 223 |
| 16 | 3300047446 | Ga0495679_001367 | Ga0495679_001367_10581_11588 | 223 |
| 17 | 3300047470 | Ga0495681_0011045 | Ga0495681_0011045_151_1158 | 223 |
| 18 | 3300049459 | Ga0495678_000033 | Ga0495678_000033_71736_72743 | 223 |
| 19 | 3300046530 | Ga0495654_0001730 | Ga0495654_0001730_2937_3938 | 226 |
| 20 | 3300046694 | Ga0495649_0002258 | Ga0495649_0002258_3121_4230 | 228 |
| 21 | iso_pu_bacteria | 2600254954 | 2600446765 | 228 |
| 22 | iso_pu_bacteria | 2600255389 | 2602010697 | 228 |
| 23 | iso_pu_bacteria | 8034962539 | 8034963823 | 228 |
| 24 | iso_pu_bacteria | 2919501602 | 2919505386 | 230 |
| 25 | iso_pu_bacteria | 2926063275 | 2926067063 | 230 |
| 26 | iso_pu_bacteria | 3007252601 | 3007256798 | 233 |
| 27 | 3300009036 | Ga0105244_10018535 | Ga0105244_100185352 | 234 |
| 28 | 3300009036 | Ga0105244_10083975 | Ga0105244_100839752 | 234 |
| 29 | 3300025728 | Ga0207655_1004518 | Ga0207655_10045182 | 234 |
| 30 | 3300025728 | Ga0207655_1059008 | Ga0207655_10590082 | 234 |
| 31 | iso_pu_bacteria | 2811994881 | 2812365901 | 235 |
| 32 | iso_pu_bacteria | 2923519811 | 2923519922 | 235 |
| 33 | 3300009011 | Ga0105251_10040434 | Ga0105251_100404342 | 236 |
| 34 | 3300046463 | Ga0495653_0001863 | Ga0495653_0001863_12122_13159 | 237 |
| 35 | 3300049758 | Ga0501241_003630 | Ga0501241_003630_1589_2530 | 237 |
| 36 | iso_pu_bacteria | 2990196909 | 2990198884 | 237 |
| 37 | 3300009011 | Ga0105251_10000060 | Ga0105251_1000006070 | 238 |
| 38 | 3300025735 | Ga0207713_1000150 | Ga0207713_100015030 | 238 |
| 39 | 3300046458 | Ga0495591_001051 | Ga0495591_001051_4073_5029 | 238 |
| 40 | 3300046518 | Ga0495631_0011309 | Ga0495631_0011309_1703_2662 | 238 |
| 41 | 3300046519 | Ga0495632_0008717 | Ga0495632_0008717_4705_5664 | 238 |
| 42 | 3300046522 | Ga0495643_0012119 | Ga0495643_0012119_3886_4845 | 238 |
| 43 | 3300047320 | Ga0495672_0106694 | Ga0495672_0106694_209_1168 | 238 |
| 44 | 3300048921 | Ga0496118_0046849 | Ga0496118_0046849_1011_1994 | 238 |
| 45 | 3300048924 | Ga0496121_0006247 | Ga0496121_0006247_4380_5333 | 238 |
| 46 | 3300048925 | Ga0496122_0001761 | Ga0496122_0001761_8186_9169 | 238 |
| 47 | 3300048926 | Ga0496123_0004322 | Ga0496123_0004322_1471_2454 | 238 |
| 48 | iso_pu_bacteria | 2808606373 | 2808904059 | 239 |
| 49 | 3300046453 | Ga0495627_001575 | Ga0495627_001575_10339_11190 | 240 |
| 50 | 3300047320 | Ga0495672_0004780 | Ga0495672_0004780_9628_10479 | 240 |
| 51 | 3300049569 | Ga0501032_0008112 | Ga0501032_0008112_4422_5279 | 241 |
| 52 | 3300049575 | Ga0501039_0300170 | Ga0501039_0300170_245_1102 | 241 |
| 53 | 3300005288 | Ga0065714_10116355 | Ga0065714_101163552 | 242 |
| 54 | 3300006177 | Ga0075362_10076448 | Ga0075362_100764482 | 242 |
| 55 | 3300032004 | Ga0307414_10257835 | Ga0307414_102578352 | 242 |
| 56 | 3300046519 | Ga0495632_0001503 | Ga0495632_0001503_16483_17442 | 242 |
| 57 | 3300046520 | Ga0495637_0047942 | Ga0495637_0047942_590_1549 | 242 |
| 58 | 3300046660 | Ga0495625_0266318 | Ga0495625_0266318_25_972 | 242 |
| 59 | 3300048927 | Ga0496124_0082963 | Ga0496124_0082963_1019_1954 | 242 |
| 60 | 3300050514 | nmdc:mga08x19_162434_c1 | nmdc:mga08x19_162434_c1_22_957 | 242 |
| 61 | 3300042006 | Ga0439432_036173 | Ga0439432_036173_486_1412 | 243 |
| 62 | 3300042013 | Ga0439456_011482 | Ga0439456_011482_114_1049 | 243 |
| 63 | 3300046543 | Ga0495645_0118327 | Ga0495645_0118327_370_1326 | 243 |
| 64 | 3300046648 | Ga0495611_0011676 | Ga0495611_0011676_243_1202 | 243 |
| 65 | 3300046471 | Ga0495650_0000221 | Ga0495650_0000221_18818_19726 | 244 |
| 66 | 3300025735 | Ga0207713_1003379 | Ga0207713_10033794 | 245 |
| 67 | 3300046452 | Ga0495617_009673 | Ga0495617_009673_170_1093 | 245 |
| 68 | 3300046519 | Ga0495632_0088544 | Ga0495632_0088544_114_1037 | 245 |
| 69 | 3300046530 | Ga0495654_0111954 | Ga0495654_0111954_183_1106 | 245 |
| 70 | 3300046692 | Ga0495671_0038559 | Ga0495671_0038559_411_1334 | 245 |
| 71 | 3300046810 | Ga0495660_0123047 | Ga0495660_0123047_329_1177 | 245 |
| 72 | 3300047469 | Ga0495673_0011248 | Ga0495673_0011248_2224_3147 | 245 |
| 73 | 3300047469 | Ga0495673_0104869 | Ga0495673_0104869_139_1062 | 245 |
| 74 | iso_pu_bacteria | 2606217733 | 2608380327 | 245 |
| 75 | 3300025728 | Ga0207655_1000645 | Ga0207655_100064539 | 246 |
| 76 | 3300041411 | Ga0439466_0018824 | Ga0439466_0018824_440_1339 | 246 |
| 77 | 3300046458 | Ga0495591_001297 | Ga0495591_001297_7352_8275 | 246 |
| 78 | 3300046474 | Ga0495605_0006439 | Ga0495605_0006439_439_1362 | 246 |
| 79 | 3300046491 | Ga0495584_0014918 | Ga0495584_0014918_927_1850 | 246 |
| 80 | 3300046492 | Ga0495585_0077048 | Ga0495585_0077048_76_999 | 246 |
| 81 | 3300046500 | Ga0495596_0011246 | Ga0495596_0011246_2769_3692 | 246 |
| 82 | 3300046501 | Ga0495607_0039409 | Ga0495607_0039409_972_1895 | 246 |
| 83 | 3300046506 | Ga0495583_0006401 | Ga0495583_0006401_181_1104 | 246 |
| 84 | 3300046515 | Ga0495620_0052867 | Ga0495620_0052867_76_999 | 246 |
| 85 | 3300046518 | Ga0495631_0004610 | Ga0495631_0004610_4345_5268 | 246 |
| 86 | 3300046519 | Ga0495632_0034212 | Ga0495632_0034212_1000_1923 | 246 |
| 87 | 3300046520 | Ga0495637_0000023 | Ga0495637_0000023_960_1883 | 246 |
| 88 | 3300046522 | Ga0495643_0054098 | Ga0495643_0054098_872_1795 | 246 |
| 89 | 3300046523 | Ga0495644_0017239 | Ga0495644_0017239_839_1762 | 246 |
| 90 | 3300046524 | Ga0495648_0054115 | Ga0495648_0054115_592_1515 | 246 |
| 91 | 3300046530 | Ga0495654_0115033 | Ga0495654_0115033_162_1085 | 246 |
| 92 | 3300046538 | Ga0495609_0000382 | Ga0495609_0000382_29122_30045 | 246 |
| 93 | 3300046557 | Ga0495622_0014421 | Ga0495622_0014421_987_1910 | 246 |
| 94 | 3300046648 | Ga0495611_0000589 | Ga0495611_0000589_14348_15271 | 246 |
| 95 | 3300046660 | Ga0495625_0000010 | Ga0495625_0000010_276555_277478 | 246 |
| 96 | 3300046665 | Ga0495661_0000020 | Ga0495661_0000020_6114_7037 | 246 |
| 97 | 3300046692 | Ga0495671_0113298 | Ga0495671_0113298_76_999 | 246 |
| 98 | 3300046810 | Ga0495660_0065634 | Ga0495660_0065634_893_1816 | 246 |
| 99 | 3300046810 | Ga0495660_0078465 | Ga0495660_0078465_432_1388 | 246 |
| 100 | 3300047320 | Ga0495672_0010599 | Ga0495672_0010599_3764_4687 | 246 |
| 101 | 3300047321 | Ga0495676_0000002 | Ga0495676_0000002_105174_106097 | 246 |
| 102 | 3300047470 | Ga0495681_0009755 | Ga0495681_0009755_382_1305 | 246 |
| 103 | 3300047472 | Ga0495686_0009309 | Ga0495686_0009309_1484_2407 | 246 |
| 104 | 3300048091 | Ga0495626_0000007 | Ga0495626_0000007_105639_106562 | 246 |
| 105 | 3300048924 | Ga0496121_0184805 | Ga0496121_0184805_200_1090 | 246 |
| 106 | 3300048927 | Ga0496124_0021185 | Ga0496124_0021185_693_1646 | 246 |
| 107 | 3300048927 | Ga0496124_0061136 | Ga0496124_0061136_1969_2874 | 246 |
| 108 | 3300053125 | Ga0500618_018577 | Ga0500618_018577_314_1417 | 246 |
| 109 | iso_pu_bacteria | 2554235132 | 2554816271 | 246 |
| 110 | iso_pu_bacteria | 8056161164 | 8056162075 | 246 |
| 111 | 3300046453 | Ga0495627_015386 | Ga0495627_015386_363_1262 | 247 |
| 112 | 3300046506 | Ga0495583_0017535 | Ga0495583_0017535_272_1231 | 247 |
| 113 | 3300046513 | Ga0495616_0013537 | Ga0495616_0013537_344_1243 | 247 |
| 114 | 3300046524 | Ga0495648_0002803 | Ga0495648_0002803_10560_11519 | 247 |
| 115 | 3300046530 | Ga0495654_0007842 | Ga0495654_0007842_3742_4701 | 247 |
| 116 | 3300046530 | Ga0495654_0099826 | Ga0495654_0099826_252_1151 | 247 |
| 117 | 3300046665 | Ga0495661_0051876 | Ga0495661_0051876_1314_2213 | 247 |
| 118 | 3300046692 | Ga0495671_0033008 | Ga0495671_0033008_1669_2628 | 247 |
| 119 | 3300046810 | Ga0495660_0142910 | Ga0495660_0142910_170_1069 | 247 |
| 120 | 3300047320 | Ga0495672_0052447 | Ga0495672_0052447_683_1582 | 247 |
| 121 | 3300047469 | Ga0495673_0003566 | Ga0495673_0003566_18_977 | 247 |
| 122 | iso_pu_bacteria | 2946006987 | 2946008542 | 247 |
| 123 | iso_pu_bacteria | 651053060 | 651176542 | 247 |
| 124 | 3300006944 | Ga0099823_1000984 | Ga0099823_100098414 | 248 |
| 125 | 3300027296 | Ga0209389_1000018 | Ga0209389_100001896 | 248 |
| 126 | 3300047470 | Ga0495681_0055148 | Ga0495681_0055148_479_1321 | 248 |
| 127 | iso_pu_bacteria | 2511231024 | 2511376169 | 248 |
| 128 | 3300042010 | Ga0439452_016468 | Ga0439452_016468_677_1612 | 249 |
| 129 | 3300046474 | Ga0495605_0003265 | Ga0495605_0003265_3344_4300 | 249 |
| 130 | 3300046522 | Ga0495643_0000488 | Ga0495643_0000488_3809_4702 | 249 |
| 131 | iso_pu_bacteria | 2808606385 | 2808977809 | 249 |
| 132 | iso_pu_bacteria | 2808606388 | 2808993289 | 249 |
| 133 | iso_pu_bacteria | 2852612431 | 2852613120 | 249 |
| 134 | iso_pu_bacteria | 2852667396 | 2852669145 | 249 |
| 135 | iso_pu_bacteria | 8054503363 | 8054507472 | 249 |
| 136 | 3300048905 | Ga0496102_0085440 | Ga0496102_0085440_1485_2438 | 250 |
| 137 | 3300002737 | JGI25162J39368_1000212 | JGI25162J39368_100021213 | 251 |
| 138 | 3300002771 | JGI25163J39215_1000503 | JGI25163J39215_10005038 | 251 |
| 139 | 3300002772 | JGI25164J39214_1000051 | JGI25164J39214_100005152 | 251 |
| 140 | 3300003214 | JGI25165J46597_1000091 | JGI25165J46597_100009152 | 251 |
| 141 | 3300009011 | Ga0105251_10103080 | Ga0105251_101030802 | 251 |
| 142 | 3300025207 | Ga0209760_100022 | Ga0209760_100022121 | 251 |
| 143 | 3300025231 | Ga0207427_100047 | Ga0207427_100047129 | 251 |
| 144 | 3300025233 | Ga0209437_100009 | Ga0209437_100009129 | 251 |
| 145 | 3300025261 | Ga0209233_1000032 | Ga0209233_1000032129 | 251 |
| 146 | 3300025711 | Ga0207696_1001395 | Ga0207696_10013956 | 251 |
| 147 | 3300046458 | Ga0495591_001253 | Ga0495591_001253_7988_8953 | 251 |
| 148 | 3300046530 | Ga0495654_0000639 | Ga0495654_0000639_580_1446 | 251 |
| 149 | 3300048905 | Ga0496102_0359318 | Ga0496102_0359318_163_1128 | 251 |
| 150 | 3300048917 | Ga0496114_0014326 | Ga0496114_0014326_4929_5822 | 251 |
| 151 | 3300048928 | Ga0496125_0024015 | Ga0496125_0024015_561_1454 | 251 |
| 152 | iso_pu_bacteria | 2619619299 | 2621298346 | 251 |
| 153 | iso_pu_bacteria | 2675903420 | 2677899883 | 251 |
| 154 | iso_pu_bacteria | 2738541265 | 2738671269 | 251 |
| 155 | iso_pu_bacteria | 2738541282 | 2738749663 | 251 |
| 156 | iso_pu_bacteria | 2738541303 | 2738858703 | 251 |
| 157 | iso_pu_bacteria | 2765235841 | 2765582808 | 251 |
| 158 | iso_pu_bacteria | 2816332298 | 2817492505 | 251 |
| 159 | iso_pu_bacteria | 2946027586 | 2946032104 | 251 |
| 160 | iso_pu_bacteria | 8054285046 | 8054285654 | 251 |
| 161 | iso_pu_bacteria | 8054929484 | 8054930107 | 251 |
| 162 | iso_pu_bacteria | 2554235231 | 2555247916 | 252 |
| 163 | 3300041405 | Ga0439438_004695 | Ga0439438_004695_3946_4842 | 253 |
| 164 | 3300041411 | Ga0439466_0007541 | Ga0439466_0007541_2285_3160 | 253 |
| 165 | 3300046513 | Ga0495616_0061149 | Ga0495616_0061149_446_1408 | 253 |
| 166 | 3300025728 | Ga0207655_1000461 | Ga0207655_100046139 | 254 |
| 167 | 3300048920 | Ga0496117_0004263 | Ga0496117_0004263_11463_12356 | 254 |
| 168 | 3300048921 | Ga0496118_0003932 | Ga0496118_0003932_14679_15572 | 254 |
| 169 | 3300048925 | Ga0496122_0001401 | Ga0496122_0001401_7835_8728 | 254 |
| 170 | 3300048926 | Ga0496123_0000437 | Ga0496123_0000437_43172_44065 | 254 |
| 171 | iso_pu_bacteria | 2738543020 | 2739287770 | 254 |
| 172 | iso_pu_bacteria | 2738543021 | 2739293082 | 254 |
| 173 | iso_pu_bacteria | 2826581358 | 2826583327 | 254 |
| 174 | iso_pu_bacteria | 2842815866 | 2842817349 | 254 |
| 175 | iso_pu_bacteria | 2842849001 | 2842850427 | 254 |
| 176 | 3300013100 | Ga0157373_10008944 | Ga0157373_100089445 | 255 |
| 177 | 3300013307 | Ga0157372_10102990 | Ga0157372_101029903 | 255 |
| 178 | 3300030731 | Ga0316177_1151181 | Ga0316177_11511812 | 255 |
| 179 | 3300042139 | Ga0450904_003441 | Ga0450904_003441_526_1422 | 255 |
| 180 | 3300046520 | Ga0495637_0042706 | Ga0495637_0042706_835_1782 | 255 |
| 181 | 3300046694 | Ga0495649_0092694 | Ga0495649_0092694_505_1452 | 255 |
| 182 | 3300047469 | Ga0495673_0104898 | Ga0495673_0104898_161_1120 | 255 |
| 183 | 3300047470 | Ga0495681_0002330 | Ga0495681_0002330_2335_3324 | 255 |
| 184 | 3300048905 | Ga0496102_0175682 | Ga0496102_0175682_137_1075 | 255 |
| 185 | 3300049459 | Ga0495678_000787 | Ga0495678_000787_19971_20930 | 255 |
| 186 | iso_pu_bacteria | 3007803356 | 3007805751 | 255 |
| 187 | iso_pu_bacteria | 8056137416 | 8056141394 | 255 |
| 188 | 3300046457 | Ga0495590_0024898 | Ga0495590_0024898_746_1717 | 256 |
| 189 | 3300046501 | Ga0495607_0002661 | Ga0495607_0002661_3387_4358 | 256 |
| 190 | 3300048920 | Ga0496117_0101247 | Ga0496117_0101247_297_1190 | 256 |
| 191 | iso_pu_bacteria | 2738543016 | 2739267525 | 256 |
| 192 | 3300048925 | Ga0496122_0057735 | Ga0496122_0057735_1771_2724 | 257 |
| 193 | iso_pu_bacteria | 2842805378 | 2842809565 | 257 |
| 194 | 3300042016 | Ga0439463_000685 | Ga0439463_000685_6898_7845 | 258 |
| 195 | iso_pu_bacteria | 2806310737 | 2807407390 | 259 |
| 196 | iso_pu_bacteria | 2806310745 | 2807455718 | 259 |
| 197 | iso_pu_bacteria | 8056115690 | 8056119769 | 259 |
| 198 | iso_pu_bacteria | 8056120720 | 8056124443 | 259 |
| 199 | 3300046507 | Ga0495606_0000698 | Ga0495606_0000698_47383_48420 | 260 |
| 200 | 3300046675 | Ga0495657_0204817 | Ga0495657_0204817_167_1120 | 260 |
| 201 | 3300046794 | Ga0495589_0081947 | Ga0495589_0081947_164_1111 | 260 |
| 202 | 3300046809 | Ga0495600_0047947 | Ga0495600_0047947_745_1698 | 260 |
| 203 | 3300047320 | Ga0495672_0106287 | Ga0495672_0106287_405_1358 | 260 |
| 204 | 3300047444 | Ga0495675_0041882 | Ga0495675_0041882_1011_1964 | 260 |
| 205 | 3300009011 | Ga0105251_10076646 | Ga0105251_100766462 | 261 |
| 206 | 3300025735 | Ga0207713_1027354 | Ga0207713_10273544 | 261 |
| 207 | 3300046692 | Ga0495671_0126459 | Ga0495671_0126459_116_1039 | 261 |
| 208 | 3300047471 | Ga0495684_0057665 | Ga0495684_0057665_1979_2932 | 262 |
| 209 | 3300048919 | Ga0496116_0095300 | Ga0496116_0095300_417_1373 | 262 |
| 210 | iso_pu_bacteria | 3007419365 | 3007421264 | 262 |
| 211 | 3300042185 | Ga0450909_008018 | Ga0450909_008018_576_1454 | 264 |
| 212 | 3300047323 | Ga0495683_0000089 | Ga0495683_0000089_18627_19736 | 264 |
| 213 | 3300048921 | Ga0496118_0142593 | Ga0496118_0142593_196_1152 | 264 |
| 214 | 3300049459 | Ga0495678_052362 | Ga0495678_052362_154_1263 | 264 |
| 215 | iso_pu_bacteria | 8055878733 | 8055879009 | 265 |
| 216 | iso_pu_bacteria | 8056569372 | 8056573247 | 267 |
| 217 | 3300006946 | Ga0079104_1000545 | Ga0079104_100054511 | 268 |
| 218 | 3300006948 | Ga0099826_10002700 | Ga0099826_100027006 | 268 |
| 219 | 3300027111 | Ga0209281_1000018 | Ga0209281_1000018444 | 268 |
| 220 | 3300046452 | Ga0495617_030161 | Ga0495617_030161_712_1671 | 268 |
| 221 | 3300046460 | Ga0495638_0049623 | Ga0495638_0049623_1478_2434 | 268 |
| 222 | 3300046691 | Ga0495670_0007226 | Ga0495670_0007226_563_1522 | 268 |
| 223 | 3300047469 | Ga0495673_0041114 | Ga0495673_0041114_851_1810 | 268 |
| 224 | 3300047470 | Ga0495681_0030038 | Ga0495681_0030038_150_1106 | 268 |
| 225 | 3300048920 | Ga0496117_0112635 | Ga0496117_0112635_243_1181 | 268 |
| 226 | 3300048921 | Ga0496118_0074062 | Ga0496118_0074062_1004_1942 | 268 |
| 227 | iso_pu_bacteria | 2511231015 | 2511321317 | 268 |
| 228 | iso_pu_bacteria | 8056125926 | 8056130210 | 268 |
| 229 | 3300046475 | Ga0495639_0117219 | Ga0495639_0117219_241_1101 | 269 |
| 230 | iso_pu_bacteria | 2713897148 | 2715753813 | 269 |
| 231 | iso_pu_bacteria | 2842832357 | 2842832714 | 269 |
| 232 | iso_pu_bacteria | 2842843487 | 2842848198 | 269 |
| 233 | iso_pu_bacteria | 2919385768 | 2919386381 | 269 |
| 234 | iso_pu_bacteria | 2919487758 | 2919491335 | 269 |
| 235 | iso_pu_bacteria | 2974289157 | 2974292144 | 269 |
| 236 | iso_pu_bacteria | 2998139840 | 2998141595 | 269 |
| 237 | iso_pu_bacteria | 3007395558 | 3007400806 | 269 |
| 238 | iso_pu_bacteria | 3007855910 | 3007856190 | 269 |
| 239 | iso_pu_bacteria | 3007861166 | 3007863167 | 269 |
| 240 | iso_pu_bacteria | 8029995093 | 8029999155 | 269 |
| 241 | iso_pu_bacteria | 8056172158 | 8056175577 | 269 |
| 242 | 3300046501 | Ga0495607_0003469 | Ga0495607_0003469_4092_5207 | 270 |
| 243 | 3300046501 | Ga0495607_0110338 | Ga0495607_0110338_500_1447 | 270 |
| 244 | 3300046519 | Ga0495632_0040908 | Ga0495632_0040908_574_1521 | 270 |
| 245 | 3300046520 | Ga0495637_0036759 | Ga0495637_0036759_387_1502 | 270 |
| 246 | 3300046520 | Ga0495637_0052848 | Ga0495637_0052848_157_1104 | 270 |
| 247 | 3300046694 | Ga0495649_0077696 | Ga0495649_0077696_666_1613 | 270 |
| 248 | iso_pu_bacteria | 2713897149 | 2715757682 | 270 |
| 249 | iso_pu_bacteria | 2818991456 | 2819654030 | 270 |
| 250 | 3300046517 | Ga0495630_0109395 | Ga0495630_0109395_755_1708 | 271 |
| 251 | iso_pu_bacteria | 2599185160 | 2599357026 | 271 |
| 252 | iso_pu_bacteria | 2599185161 | 2599362187 | 271 |
| 253 | iso_pu_bacteria | 2599185162 | 2599368507 | 271 |
| 254 | iso_pu_bacteria | 2599185163 | 2599375296 | 271 |
| 255 | iso_pu_bacteria | 2599185164 | 2599382131 | 271 |
| 256 | iso_pu_bacteria | 2599185165 | 2599388578 | 271 |
| 257 | iso_pu_bacteria | 2599185166 | 2599394154 | 271 |
| 258 | iso_pu_bacteria | 2599185168 | 2599405919 | 271 |
| 259 | iso_pu_bacteria | 2599185181 | 2599464469 | 271 |
| 260 | iso_pu_bacteria | 2599185182 | 2599468793 | 271 |
| 261 | iso_pu_bacteria | 2599185186 | 2599493492 | 271 |
| 262 | iso_pu_bacteria | 2599185356 | 2600216746 | 271 |
| 263 | iso_pu_bacteria | 2600255313 | 2601776657 | 271 |
| 264 | iso_pu_bacteria | 2667528171 | 2671098826 | 271 |
| 265 | iso_pu_bacteria | 2818991464 | 2819703947 | 271 |
| 266 | iso_pu_bacteria | 2917070673 | 2917072427 | 271 |
| 267 | iso_pu_bacteria | 2935353572 | 2935354591 | 271 |
| 268 | iso_pu_bacteria | 3007614139 | 3007617110 | 271 |
| 269 | iso_pu_bacteria | 637000220 | 637319014 | 271 |
| 270 | 3300005288 | Ga0065714_10005121 | Ga0065714_100051217 | 272 |
| 271 | 3300017792 | Ga0163161_10315586 | Ga0163161_103155862 | 272 |
| 272 | 3300031548 | Ga0307408_100158038 | Ga0307408_1001580381 | 272 |
| 273 | iso_pu_bacteria | 2511231011 | 2511293835 | 272 |
| 274 | iso_pu_bacteria | 2511231012 | 2511304855 | 272 |
| 275 | iso_pu_bacteria | 2511231020 | 2511351854 | 272 |
| 276 | iso_pu_bacteria | 2738543004 | 2739200835 | 272 |
| 277 | iso_pu_bacteria | 2738543015 | 2739261086 | 272 |
| 278 | iso_pu_bacteria | 2904550169 | 2904553221 | 272 |
| 279 | iso_pu_bacteria | 2984286254 | 2984290773 | 272 |
| 280 | 3300046526 | Ga0495666_0081046 | Ga0495666_0081046_428_1381 | 273 |
| 281 | 3300046679 | Ga0495623_0068208 | Ga0495623_0068208_543_1496 | 273 |
| 282 | 3300047673 | Ga0495593_0056206 | Ga0495593_0056206_702_1655 | 273 |
| 283 | iso_pu_bacteria | 2511231004 | 2511252473 | 273 |
| 284 | iso_pu_bacteria | 2511231006 | 2511263904 | 273 |
| 285 | iso_pu_bacteria | 2511231007 | 2511272080 | 273 |
| 286 | iso_pu_bacteria | 2511231010 | 2511292534 | 273 |
| 287 | iso_pu_bacteria | 2511231016 | 2511329361 | 273 |
| 288 | iso_pu_bacteria | 2511231018 | 2511336045 | 273 |
| 289 | iso_pu_bacteria | 2511231019 | 2511344269 | 273 |
| 290 | iso_pu_bacteria | 2597489887 | 2597856823 | 273 |
| 291 | iso_pu_bacteria | 2599185185 | 2599483846 | 273 |
| 292 | iso_pu_bacteria | 2599185257 | 2599801492 | 273 |
| 293 | iso_pu_bacteria | 2600254931 | 2600365793 | 273 |
| 294 | iso_pu_bacteria | 2600255318 | 2601795479 | 273 |
| 295 | iso_pu_bacteria | 2603880185 | 2606075548 | 273 |
| 296 | iso_pu_bacteria | 2603880199 | 2606128540 | 273 |
| 297 | iso_pu_bacteria | 2623620443 | 2624479416 | 273 |
| 298 | iso_pu_bacteria | 2623620446 | 2624493594 | 273 |
| 299 | iso_pu_bacteria | 2671180172 | 2671768441 | 273 |
| 300 | iso_pu_bacteria | 2808606382 | 2808957667 | 273 |
| 301 | iso_pu_bacteria | 2878029506 | 2878031419 | 273 |
| 302 | iso_pu_bacteria | 2919063839 | 2919064110 | 273 |
| 303 | iso_pu_bacteria | 2919456309 | 2919457132 | 273 |
| 304 | iso_pu_bacteria | 2919697872 | 2919702894 | 273 |
| 305 | iso_pu_bacteria | 3007511990 | 3007512982 | 273 |
| 306 | iso_pu_bacteria | 3007718800 | 3007722816 | 273 |
| 307 | iso_pu_bacteria | 8019775933 | 8019780225 | 273 |
| 308 | iso_pu_bacteria | 8056155041 | 8056156254 | 273 |
| 309 | iso_pu_bacteria | 8056177738 | 8056181111 | 273 |
| 310 | iso_pu_bacteria | 2511231023 | 2511370061 | 274 |
| 311 | iso_pu_bacteria | 2511231031 | 2511416307 | 274 |
| 312 | iso_pu_bacteria | 2582580891 | 2583791032 | 274 |
| 313 | iso_pu_bacteria | 2738543025 | 2739316042 | 274 |
| 314 | iso_pu_bacteria | 2740892503 | 2743736251 | 274 |
| 315 | iso_pu_bacteria | 2860339153 | 2860340042 | 274 |
| 316 | iso_pu_bacteria | 2923153595 | 2923155265 | 274 |
| 317 | iso_pu_bacteria | 2931396565 | 2931400066 | 274 |
| 318 | iso_pu_bacteria | 2969304461 | 2969306202 | 274 |
| 319 | iso_pu_bacteria | 8015687852 | 8015689486 | 274 |
| 320 | iso_pu_bacteria | 8019769354 | 8019774111 | 274 |
| 321 | iso_pu_bacteria | 8055770955 | 8055772620 | 274 |
| 322 | iso_pu_bacteria | 8057798959 | 8057799047 | 274 |
| 323 | iso_pu_bacteria | 2511231017 | 2511333879 | 275 |
| 324 | iso_pu_bacteria | 2511231021 | 2511354193 | 275 |
| 325 | iso_pu_bacteria | 2511231022 | 2511363661 | 275 |
| 326 | iso_pu_bacteria | 2599185248 | 2599770170 | 275 |
| 327 | iso_pu_bacteria | 2599185289 | 2599887630 | 275 |
| 328 | iso_pu_bacteria | 2599185291 | 2599899891 | 275 |
| 329 | iso_pu_bacteria | 2599185305 | 2599960468 | 275 |
| 330 | iso_pu_bacteria | 2599185306 | 2599965374 | 275 |
| 331 | iso_pu_bacteria | 2599185308 | 2599978487 | 275 |
| 332 | iso_pu_bacteria | 2599185311 | 2599995678 | 275 |
| 333 | iso_pu_bacteria | 2599185313 | 2600008610 | 275 |
| 334 | iso_pu_bacteria | 2599185314 | 2600010606 | 275 |
| 335 | iso_pu_bacteria | 2599185315 | 2600017492 | 275 |
| 336 | iso_pu_bacteria | 2599185316 | 2600025502 | 275 |
| 337 | iso_pu_bacteria | 2599185317 | 2600030386 | 275 |
| 338 | iso_pu_bacteria | 2599185319 | 2600041648 | 275 |
| 339 | iso_pu_bacteria | 2599185321 | 2600052316 | 275 |
| 340 | iso_pu_bacteria | 2599185323 | 2600065112 | 275 |
| 341 | iso_pu_bacteria | 2599185324 | 2600073738 | 275 |
| 342 | iso_pu_bacteria | 2599185325 | 2600078792 | 275 |
| 343 | iso_pu_bacteria | 2600254930 | 2600360818 | 275 |
| 344 | iso_pu_bacteria | 2643221589 | 2643952550 | 275 |
| 345 | iso_pu_bacteria | 2643221602 | 2644022312 | 275 |
| 346 | iso_pu_bacteria | 2643221633 | 2644187176 | 275 |
| 347 | iso_pu_bacteria | 2667528170 | 2671090291 | 275 |
| 348 | iso_pu_bacteria | 2667528176 | 2671125903 | 275 |
| 349 | iso_pu_bacteria | 2773857670 | 2774122854 | 275 |
| 350 | iso_pu_bacteria | 2784132072 | 2784315212 | 275 |
| 351 | iso_pu_bacteria | 2808606377 | 2808927344 | 275 |
| 352 | iso_pu_bacteria | 2808606381 | 2808950117 | 275 |
| 353 | iso_pu_bacteria | 3007619802 | 3007622366 | 275 |
| 354 | iso_pu_bacteria | 2511231008 | 2511278651 | 276 |
| 355 | iso_pu_bacteria | 2784132063 | 2784265679 | 277 |
| 356 | iso_pu_bacteria | 2852657418 | 2852658897 | 277 |
| 357 | iso_pu_bacteria | 2880230671 | 2880232286 | 277 |
| 358 | iso_pu_bacteria | 2904518522 | 2904521820 | 277 |
| 359 | 3300003791 | Ga0055530_10000158 | Ga0055530_100001588 | 278 |
| 360 | 3300003792 | Ga0055540_1000182 | Ga0055540_10001828 | 278 |
| 361 | 3300013100 | Ga0157373_10005441 | Ga0157373_100054416 | 278 |
| 362 | 3300015261 | Ga0182006_1009115 | Ga0182006_10091155 | 278 |
| 363 | 3300025298 | Ga0209050_1000009 | Ga0209050_1000009252 | 278 |
| 364 | 3300025303 | Ga0209051_1000008 | Ga0209051_10000089 | 278 |
| 365 | 3300025304 | Ga0209257_1014823 | Ga0209257_10148235 | 278 |
| 366 | iso_pu_bacteria | 2599185188 | 2599504070 | 278 |
| 367 | iso_pu_bacteria | 2599185300 | 2599932031 | 278 |
| 368 | iso_pu_bacteria | 2599185302 | 2599941903 | 278 |
| 369 | iso_pu_bacteria | 2599185304 | 2599952577 | 278 |
| 370 | iso_pu_bacteria | 2599185309 | 2599982067 | 278 |
| 371 | iso_pu_bacteria | 2599185310 | 2599987977 | 278 |
| 372 | iso_pu_bacteria | 2599185312 | 2599998133 | 278 |
| 373 | iso_pu_bacteria | 2599185320 | 2600046305 | 278 |
| 374 | iso_pu_bacteria | 2651869719 | 2652544725 | 278 |
| 375 | iso_pu_bacteria | 2791355520 | 2794596308 | 278 |
| 376 | iso_pu_bacteria | 2808606361 | 2808856120 | 278 |
| 377 | iso_pu_bacteria | 2808606376 | 2808923588 | 278 |
| 378 | iso_pu_bacteria | 2808606378 | 2808936129 | 278 |
| 379 | iso_pu_bacteria | 2808606380 | 2808945649 | 278 |
| 380 | iso_pu_bacteria | 2808606383 | 2808964625 | 278 |
| 381 | iso_pu_bacteria | 2808606389 | 2808999513 | 278 |
| 382 | iso_pu_bacteria | 2913036834 | 2913038473 | 278 |
| 383 | iso_pu_bacteria | 2919481497 | 2919481757 | 278 |
| 384 | iso_pu_bacteria | 2923586266 | 2923587406 | 278 |
| 385 | iso_pu_bacteria | 2931369376 | 2931370728 | 278 |
| 386 | iso_pu_bacteria | 2988728565 | 2988733468 | 278 |
| 387 | iso_pu_bacteria | 3007866637 | 3007870432 | 278 |
| 388 | iso_pu_bacteria | 8056143049 | 8056147360 | 278 |
| 389 | 2162886007 | SwRhRL2b_contig_1910630 | SwRhRL2b_0217.00004170 | 279 |
| 390 | 3300005288 | Ga0065714_10002255 | Ga0065714_1000225537 | 279 |
| 391 | 3300005289 | Ga0065704_10070596 | Ga0065704_100705965 | 279 |
| 392 | iso_pu_bacteria | 2599185212 | 2599615694 | 279 |
| 393 | iso_pu_bacteria | 2599185318 | 2600034511 | 279 |
| 394 | iso_pu_bacteria | 2599185322 | 2600057681 | 279 |
| 395 | iso_pu_bacteria | 2643221650 | 2644281735 | 279 |
| 396 | iso_pu_bacteria | 2675903515 | 2678262500 | 279 |
| 397 | iso_pu_bacteria | 2744054620 | 2745008843 | 279 |
| 398 | iso_pu_bacteria | 2825651385 | 2825653141 | 279 |
| 399 | iso_pu_bacteria | 2929144301 | 2929145931 | 279 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ja6-assembly1.cif.gz_F | cryo-electron tomography and all-atom molecular dynamics simulations reveal a novel kinase conformational switch in bacterial chemotaxis signaling | 0.8011 | 123 | 261 |
| 3ja6-assembly1.cif.gz_F | cryo-electron tomography and all-atom molecular dynamics simulations reveal a novel kinase conformational switch in bacterial chemotaxis signaling | 0.7908 | 123 | 261 |
| 2qdl-assembly1.cif.gz_A | crystal structure of scaffolding protein ttchew from thermoanaerobacter tengcongensis | 0.7852 | 124 | 251 |
| 4jpb-assembly1.cif.gz_W | the structure of a ternary complex between chea domains p4 and p5 with chew and with an unzipped fragment of tm14, a chemoreceptor analog from thermotoga maritima. | 0.7807 | 123 | 260 |
| 2qdl-assembly2.cif.gz_B | crystal structure of scaffolding protein ttchew from thermoanaerobacter tengcongensis | 0.7609 | 124 | 251 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ch4W02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 | 0.6999 | 147 | 213 | 2.40.50.180 |
| 2qdlB02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 | 0.6515 | 154 | 213 | 2.40.50.180 |
| af_P0A964_36_100_2.40.50.180 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 | 0.6371 | 147 | 212 | 2.40.50.180 |
| af_P0A964_36_100_2.40.50.180 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 | 0.5954 | 147 | 212 | 2.40.50.180 |
| 2ch4W02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);CheA-289, Domain 4 | 0.5705 | 147 | 213 | 2.40.50.180 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N3UR38-F1-model_v4 | Chemotaxis protein CheW | 0.9227 | 117 | 273 |
GO:0006935
GO:0007165 GO:0016020 |
| AF-A0A3M5E0K1-F1-model_v4 | CheW-like domain-containing protein | 0.9139 | 134 | 271 |
GO:0006935
GO:0007165 |
| AF-A0A3B8P5A4-F1-model_v4 | Chemotaxis protein CheW | 0.9066 | 127 | 273 |
GO:0006935
GO:0007165 |
| AF-A0A3B8P5A4-F1-model_v4 | Chemotaxis protein CheW | 0.9008 | 127 | 273 |
GO:0006935
GO:0007165 |
| AF-A0A3M5E0K1-F1-model_v4 | CheW-like domain-containing protein | 0.8955 | 134 | 271 |
GO:0006935
GO:0007165 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar