F434017

General Info

Members Datasets Scaffolds Average Seq Length
398 170 796 165

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100010283|Ga0075434_1000102835
Length 176
Sequence VEGESVTAIYALYSDPDHVQRAVDNLRAAGLHDRDIVVISSEPIEEYEFSARDKATWLFYAAGFGGVVGLVFATWLTTMTQKAWPIVTGNMAIVAWWPNMIIMFELTMLGAILATVITMLVAANLPKRGPKLYDPEVADGKILVGIENPPSTSVQSIERALLSGGVARLKKIGARP

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
117 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
118 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
119 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
120 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
121 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
122 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
123 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
124 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
125 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
126 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
127 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
128 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
129 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
130 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
131 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
132 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
135 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
136 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
137 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
138 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
139 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
144 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
145 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
149 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
150 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.26
Rhizosphere 97.74
Stem 0
Stem Tuber 0
Unclassified 20.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100010283 3300006871 Bacteria 8769
2 Ga0065715_10253133 3300005293 Unclassified 1161
3 Ga0065715_10298260 3300005293 Unclassified 1047
4 Ga0070676_10391667 3300005328 Bacteria 964
5 Ga0070676_10472279 3300005328 Unclassified 886
6 Ga0068869_100749609 3300005334 Bacteria 836
7 Ga0068869_101602984 3300005334 Bacteria 580
8 Ga0070666_10087743 3300005335 Bacteria 2133
9 Ga0070666_10156318 3300005335 Bacteria 1592
10 Ga0068868_100785167 3300005338 Unclassified 858
11 Ga0070691_10009458 3300005341 Bacteria 4447
12 Ga0070668_100280856 3300005347 Unclassified 1390
13 Ga0070668_100433099 3300005347 Unclassified 1128
14 Ga0070669_100078994 3300005353 Bacteria 2446
15 Ga0070669_100131471 3300005353 Bacteria 1921
16 Ga0070669_100208472 3300005353 Bacteria 1541
17 Ga0070669_101295316 3300005353 Bacteria 631
18 Ga0070675_100010258 3300005354 Bacteria 7310
19 Ga0070675_100434661 3300005354 Bacteria 1175
20 Ga0070675_101052589 3300005354 Unclassified 748
21 Ga0070671_100742790 3300005355 Bacteria 853
22 Ga0070674_100004139 3300005356 Bacteria 8241
23 Ga0070674_100335791 3300005356 Bacteria 1216
24 Ga0070673_100074452 3300005364 Bacteria 2736
25 Ga0070673_100152883 3300005364 Bacteria 1956
26 Ga0070673_100684699 3300005364 Bacteria 941
27 Ga0070667_100009296 3300005367 Bacteria 8147
28 Ga0070667_100934072 3300005367 Bacteria 808
29 Ga0070703_10219636 3300005406 Bacteria 756
30 Ga0070713_100370892 3300005436 Bacteria 1332
31 Ga0070701_10004640 3300005438 Bacteria 5592
32 Ga0070701_11030266 3300005438 Bacteria 576
33 Ga0070711_100156794 3300005439 Bacteria 1722
34 Ga0070705_100004392 3300005440 Bacteria 6864
35 Ga0070705_100012607 3300005440 Bacteria 4301
36 Ga0070705_100037867 3300005440 Bacteria 2724
37 Ga0070705_100118391 3300005440 Bacteria 1706
38 Ga0070705_100925795 3300005440 Bacteria 703
39 Ga0070700_100070006 3300005441 Bacteria 2236
40 Ga0070700_100080246 3300005441 Bacteria 2105
41 Ga0070694_100000830 3300005444 Bacteria 17335
42 Ga0070694_100002569 3300005444 Bacteria 10724
43 Ga0070694_100122366 3300005444 Bacteria 1869
44 Ga0070694_100162059 3300005444 Bacteria 1642
45 Ga0070694_100221180 3300005444 Bacteria 1420
46 Ga0070694_100855424 3300005444 Bacteria 749
47 Ga0070708_100078647 3300005445 Bacteria 2982
48 Ga0070708_100106708 3300005445 Unclassified 2571
49 Ga0070708_100302185 3300005445 Bacteria 1507
50 Ga0070708_100563807 3300005445 Bacteria 1074
51 Ga0070662_100079629 3300005457 Bacteria 2437
52 Ga0070662_100084872 3300005457 Bacteria 2366
53 Ga0070662_100146001 3300005457 Bacteria 1838
54 Ga0070662_100626797 3300005457 Bacteria 906
55 Ga0070681_10715431 3300005458 Bacteria 917
56 Ga0068867_100011395 3300005459 Bacteria 6273
57 Ga0068867_100102910 3300005459 Bacteria 2183
58 Ga0068867_100144839 3300005459 Bacteria 1861
59 Ga0070706_100357916 3300005467 Unclassified 1360
60 Ga0070706_100702280 3300005467 Bacteria 938
61 Ga0070707_100161829 3300005468 Unclassified 2181
62 Ga0070707_100282808 3300005468 Bacteria 1612
63 Ga0070707_100374625 3300005468 Unclassified 1383
64 Ga0070707_101094412 3300005468 Unclassified 763
65 Ga0070698_100007640 3300005471 Bacteria 11700
66 Ga0070698_100008089 3300005471 Bacteria 11372
67 Ga0070698_100113325 3300005471 Bacteria 2677
68 Ga0070699_100007603 3300005518 Bacteria 9421
69 Ga0070699_100034736 3300005518 Bacteria 4357
70 Ga0070699_100076243 3300005518 Bacteria 2919
71 Ga0070699_100153711 3300005518 Bacteria 2036
72 Ga0070699_100295872 3300005518 Bacteria 1452
73 Ga0070697_100081099 3300005536 Bacteria 2673
74 Ga0070697_100146528 3300005536 Bacteria 1988
75 Ga0070697_100978961 3300005536 Unclassified 752
76 Ga0070672_100130492 3300005543 Bacteria 2064
77 Ga0070672_100746530 3300005543 Bacteria 859
78 Ga0070686_100005521 3300005544 Bacteria 6999
79 Ga0070686_100351800 3300005544 Bacteria 1107
80 Ga0070695_100026842 3300005545 Bacteria 3565
81 Ga0070695_100041228 3300005545 Bacteria 2925
82 Ga0070695_100785352 3300005545 Bacteria 762
83 Ga0070695_101538938 3300005545 Unclassified 554
84 Ga0070696_100020166 3300005546 Bacteria 4519
85 Ga0070696_100020332 3300005546 Bacteria 4500
86 Ga0070696_100027310 3300005546 Bacteria 3888
87 Ga0070696_100028138 3300005546 Bacteria 3834
88 Ga0070696_100442517 3300005546 Bacteria 1024
89 Ga0070696_100485933 3300005546 Bacteria 980
90 Ga0070665_100323837 3300005548 Bacteria 1545
91 Ga0070704_100000664 3300005549 Bacteria 16619
92 Ga0070704_100095424 3300005549 Bacteria 2227
93 Ga0070704_100135352 3300005549 Bacteria 1916
94 Ga0070704_100923762 3300005549 Bacteria 786
95 Ga0068855_100624318 3300005563 Unclassified 1160
96 Ga0068854_100001270 3300005578 Bacteria 15157
97 Ga0068854_100027872 3300005578 Bacteria 3896
98 Ga0068854_100912191 3300005578 Bacteria 773
99 Ga0070702_100017568 3300005615 Bacteria 3692
100 Ga0070702_100612598 3300005615 Bacteria 818
101 Ga0068859_100966450 3300005617 Bacteria 935
102 Ga0068859_101062561 3300005617 Unclassified 890
103 Ga0068866_10771572 3300005718 Bacteria 666
104 Ga0068861_100034395 3300005719 Bacteria 3747
105 Ga0068861_100055365 3300005719 Bacteria 3024
106 Ga0068861_100347712 3300005719 Bacteria 1299
107 Ga0068870_10364564 3300005840 Bacteria 931
108 Ga0068863_100005389 3300005841 Bacteria 12612
109 Ga0068858_100646956 3300005842 Unclassified 1027
110 Ga0068858_100769454 3300005842 Unclassified 939
111 Ga0068858_101170135 3300005842 Bacteria 756
112 Ga0068860_100163282 3300005843 Unclassified 2149
113 Ga0068860_100602437 3300005843 Bacteria 1104
114 Ga0068860_100627324 3300005843 Unclassified 1082
115 Ga0068860_100668434 3300005843 Bacteria 1047
116 Ga0068862_100219771 3300005844 Bacteria 1720
117 Ga0068862_100420113 3300005844 Bacteria 1255
118 Ga0068862_100462594 3300005844 Bacteria 1198
119 Ga0068862_101483329 3300005844 Bacteria 683
120 Ga0081455_10070060 3300005937 Bacteria 2912
121 Ga0075432_10107824 3300006058 Unclassified 1035
122 Ga0068871_100102253 3300006358 Bacteria 2402
123 Ga0075428_100087123 3300006844 Bacteria 3406
124 Ga0075428_100176780 3300006844 Bacteria 2311
125 Ga0075428_100413086 3300006844 Bacteria 1446
126 Ga0075433_10028619 3300006852 Bacteria 4739
127 Ga0075433_10149619 3300006852 Bacteria 2076
128 Ga0075433_10239107 3300006852 Bacteria 1612
129 Ga0075433_10334955 3300006852 Bacteria 1338
130 Ga0075433_10386347 3300006852 Bacteria 1235
131 Ga0075433_10769425 3300006852 Bacteria 842
132 Ga0075434_100002441 3300006871 Bacteria 16356
133 Ga0075434_100285658 3300006871 Bacteria 1669
134 Ga0075434_100315700 3300006871 Unclassified 1583
135 Ga0075434_100318215 3300006871 Bacteria 1576
136 Ga0075434_100388272 3300006871 Unclassified 1417
137 Ga0075434_100423450 3300006871 Bacteria 1352
138 Ga0075434_100456120 3300006871 Bacteria 1299
139 Ga0075434_100528479 3300006871 Bacteria 1200
140 Ga0075434_100638028 3300006871 Bacteria 1084
141 Ga0075434_100653752 3300006871 Unclassified 1069
142 Ga0075434_101131658 3300006871 Bacteria 796
143 Ga0075434_101338379 3300006871 Unclassified 727
144 Ga0075429_100323793 3300006880 Unclassified 1349
145 Ga0068865_100055880 3300006881 Bacteria 2748
146 Ga0075436_100009023 3300006914 Bacteria 6822
147 Ga0075436_100019850 3300006914 Bacteria 4608
148 Ga0075436_100023827 3300006914 Bacteria 4206
149 Ga0075436_100071447 3300006914 Bacteria 2400
150 Ga0075436_100121386 3300006914 Bacteria 1828
151 Ga0075436_100458526 3300006914 Unclassified 929
152 Ga0075436_100757250 3300006914 Bacteria 721
153 Ga0097620_100966366 3300006931 Bacteria 935
154 Ga0097620_101062570 3300006931 Unclassified 890
155 Ga0075435_100000957 3300007076 Bacteria 18243
156 Ga0075435_100001928 3300007076 Bacteria 13500
157 Ga0075435_100012701 3300007076 Bacteria 6238
158 Ga0075435_100043011 3300007076 Bacteria 3616
159 Ga0075435_100086993 3300007076 Bacteria 2574
160 Ga0075435_100104633 3300007076 Bacteria 2348
161 Ga0075435_100376964 3300007076 Bacteria 1218
162 Ga0075435_100458338 3300007076 Unclassified 1100
163 Ga0075435_101204413 3300007076 Unclassified 663
164 Ga0075435_101610995 3300007076 Unclassified 570
165 Ga0105240_10285590 3300009093 Bacteria 1894
166 Ga0111539_10105853 3300009094 Bacteria 3300
167 Ga0111539_10860332 3300009094 Bacteria 1055
168 Ga0111539_11338179 3300009094 Unclassified 831
169 Ga0105245_10440441 3300009098 Bacteria 1310
170 Ga0105247_10006881 3300009101 Bacteria 7008
171 Ga0114129_10002092 3300009147 Bacteria 27445
172 Ga0114129_10002144 3300009147 Bacteria 27205
173 Ga0114129_10011486 3300009147 Bacteria 12608
174 Ga0114129_10013208 3300009147 Bacteria 11764
175 Ga0114129_10034600 3300009147 Bacteria 7136
176 Ga0114129_10054679 3300009147 Bacteria 5596
177 Ga0114129_10178719 3300009147 Bacteria 2889
178 Ga0114129_10184042 3300009147 Bacteria 2841
179 Ga0114129_10547378 3300009147 Unclassified 1505
180 Ga0114129_11181128 3300009147 Bacteria 954
181 Ga0114129_11550065 3300009147 Bacteria 813
182 Ga0105243_10008005 3300009148 Bacteria 8121
183 Ga0105243_10115322 3300009148 Bacteria 2255
184 Ga0105243_10268376 3300009148 Bacteria 1531
185 Ga0105243_10308927 3300009148 Bacteria 1436
186 Ga0105241_10405629 3300009174 Bacteria 1196
187 Ga0105242_10327690 3300009176 Bacteria 1407
188 Ga0105248_10003811 3300009177 Bacteria 16718
189 Ga0105248_10038259 3300009177 Bacteria 5369
190 Ga0105248_10191578 3300009177 Bacteria 2304
191 Ga0105248_10483989 3300009177 Bacteria 1395
192 Ga0105238_10572505 3300009551 Bacteria 1135
193 Ga0105249_10599745 3300009553 Bacteria 1156
194 Ga0105249_10976846 3300009553 Bacteria 915
195 Ga0105246_10326592 3300011119 Unclassified 1249
196 Ga0157378_11547836 3300013297 Bacteria 708
197 Ga0157380_10027326 3300014326 Bacteria 4339
198 Ga0157380_10123472 3300014326 Bacteria 2197
199 Ga0157380_10457847 3300014326 Bacteria 1227
200 Ga0157380_10492931 3300014326 Bacteria 1188
201 Ga0157380_12556043 3300014326 Bacteria 577
202 Ga0157379_10831266 3300014968 Bacteria 873
203 Ga0157379_11273628 3300014968 Bacteria 709
204 Ga0163161_10250463 3300017792 Unclassified 1380
205 Ga0207697_10184639 3300025315 Bacteria 915
206 Ga0207697_10267813 3300025315 Unclassified 757
207 Ga0207682_10088234 3300025893 Bacteria 1341
208 Ga0207688_10124791 3300025901 Bacteria 1505
209 Ga0207645_10050412 3300025907 Bacteria 2658
210 Ga0207645_10171968 3300025907 Unclassified 1420
211 Ga0207684_10108546 3300025910 Bacteria 2375
212 Ga0207684_11007486 3300025910 Unclassified 697
213 Ga0207684_11239138 3300025910 Bacteria 616
214 Ga0207654_11121050 3300025911 Bacteria 573
215 Ga0207663_10060525 3300025916 Bacteria 2400
216 Ga0207660_10459736 3300025917 Unclassified 1030
217 Ga0207662_10016305 3300025918 Bacteria 4191
218 Ga0207662_10146738 3300025918 Bacteria 1498
219 Ga0207662_10309131 3300025918 Unclassified 1053
220 Ga0207662_10354234 3300025918 Unclassified 986
221 Ga0207646_10229442 3300025922 Bacteria 1677
222 Ga0207646_10395427 3300025922 Unclassified 1248
223 Ga0207681_10054733 3300025923 Bacteria 2714
224 Ga0207681_10421454 3300025923 Bacteria 1081
225 Ga0207659_10211853 3300025926 Bacteria 1553
226 Ga0207659_10344816 3300025926 Bacteria 1234
227 Ga0207659_10365568 3300025926 Bacteria 1200
228 Ga0207687_10292136 3300025927 Bacteria 1310
229 Ga0207644_10222717 3300025931 Unclassified 1496
230 Ga0207690_10217724 3300025932 Bacteria 1459
231 Ga0207690_10263296 3300025932 Bacteria 1337
232 Ga0207706_10066712 3300025933 Bacteria 3167
233 Ga0207706_10174381 3300025933 Unclassified 1889
234 Ga0207706_10334955 3300025933 Unclassified 1316
235 Ga0207686_10637682 3300025934 Unclassified 842
236 Ga0207709_10461584 3300025935 Bacteria 984
237 Ga0207709_10645786 3300025935 Unclassified 842
238 Ga0207670_10248803 3300025936 Unclassified 1373
239 Ga0207670_10285064 3300025936 Bacteria 1289
240 Ga0207669_10009188 3300025937 Bacteria 4692
241 Ga0207669_10304900 3300025937 Bacteria 1212
242 Ga0207669_10517154 3300025937 Bacteria 958
243 Ga0207704_10264618 3300025938 Bacteria 1298
244 Ga0207704_10460311 3300025938 Bacteria 1017
245 Ga0207691_10015158 3300025940 Bacteria 7335
246 Ga0207691_10237692 3300025940 Bacteria 1576
247 Ga0207711_10173725 3300025941 Bacteria 1956
248 Ga0207711_10218383 3300025941 Bacteria 1743
249 Ga0207689_10577900 3300025942 Bacteria 945
250 Ga0207651_10061043 3300025960 Bacteria 2620
251 Ga0207651_10396426 3300025960 Bacteria 1173
252 Ga0207712_10830938 3300025961 Bacteria 813
253 Ga0207668_10478705 3300025972 Bacteria 1067
254 Ga0207640_10032254 3300025981 Bacteria 3246
255 Ga0207640_10081198 3300025981 Bacteria 2216
256 Ga0207703_10035090 3300026035 Bacteria 3985
257 Ga0207703_10515249 3300026035 Unclassified 1124
258 Ga0207703_10829382 3300026035 Bacteria 884
259 Ga0207703_10988479 3300026035 Unclassified 807
260 Ga0207708_10046789 3300026075 Bacteria 3294
261 Ga0207708_10092586 3300026075 Bacteria 2333
262 Ga0207708_10815951 3300026075 Bacteria 804
263 Ga0207641_10002280 3300026088 Bacteria 17892
264 Ga0207648_10012414 3300026089 Bacteria 7975
265 Ga0207648_10018670 3300026089 Bacteria 6273
266 Ga0207648_10676165 3300026089 Bacteria 955
267 Ga0207675_100012851 3300026118 Bacteria 7819
268 Ga0207675_100030504 3300026118 Bacteria 5023
269 Ga0207675_100168360 3300026118 Bacteria 2093
270 Ga0207675_101287340 3300026118 Bacteria 751
271 Ga0207428_10062115 3300027907 Bacteria 2955
272 Ga0207428_10170925 3300027907 Unclassified 1646
273 Ga0207428_10376040 3300027907 Bacteria 1043
274 Ga0207428_10427141 3300027907 Bacteria 968
275 Ga0268266_10177049 3300028379 Bacteria 1940
276 Ga0268265_10011521 3300028380 Bacteria 5977
277 Ga0268265_10047059 3300028380 Bacteria 3229
278 Ga0268265_10061982 3300028380 Bacteria 2872
279 Ga0268265_10583402 3300028380 Bacteria 1066
280 Ga0268264_11001096 3300028381 Bacteria 842
281 Ga0307408_100384124 3300031548 Unclassified 1201
282 Ga0307408_100525467 3300031548 Unclassified 1040
283 Ga0307408_100748098 3300031548 Unclassified 883
284 Ga0307408_100793901 3300031548 Bacteria 859
285 Ga0307406_10149200 3300031901 Unclassified 1666
286 Ga0307412_10143065 3300031911 Unclassified 1754
287 Ga0307409_100445083 3300031995 Bacteria 1249
288 Ga0307409_101058122 3300031995 Unclassified 831
289 Ga0307411_10315673 3300032005 Unclassified 1260
290 Ga0307411_10568378 3300032005 Bacteria 970
291 Ga0373930_0037930 3300034816 Bacteria 1016
292 Ga0373950_0026041 3300034818 Unclassified 1059
293 Ga0373958_0074186 3300034819 Bacteria 760
294 Ga0373959_0001798 3300034820 Bacteria 3422
295 Ga0373959_0121201 3300034820 Unclassified 640
296 Ga0373938_0002066 3300034957 Bacteria 3224
297 Ga0373928_0051520 3300035084 Unclassified 973
298 Ga0373929_0002585 3300035085 Bacteria 3321
299 Ga0373929_0109529 3300035085 Unclassified 705
300 Ga0373940_0071357 3300035088 Unclassified 1012
301 Ga0373949_0001935 3300035090 Bacteria 5580
302 Ga0373951_0043994 3300035091 Unclassified 1083
303 Ga0373952_0000158 3300035092 Bacteria 10116
304 Ga0373932_0003133 3300035112 Bacteria 4027
305 Ga0373932_0039115 3300035112 Bacteria 1359
306 Ga0373939_0001941 3300035114 Bacteria 4948
307 Ga0373939_0161574 3300035114 Bacteria 823
308 Ga0373941_0004942 3300035115 Bacteria 3105
309 Ga0373960_0000102 3300035121 Bacteria 13542
310 Ga0373961_0000621 3300035241 Bacteria 12878
311 Ga0373961_0047078 3300035241 Unclassified 1266
312 Ga0373962_0004709 3300035242 Bacteria 3291
313 Ga0373962_0210885 3300035242 Bacteria 661
314 Ga0373931_0011263 3300035691 Bacteria 4318
315 Ga0373931_0252602 3300035691 Bacteria 1073
316 Ga0439439_0032384 3300041406 Unclassified 1335
317 Ga0439433_0008868 3300041999 Bacteria 2188
318 Ga0439462_0047784 3300042015 Bacteria 1147
319 Ga0439446_0010936 3300042156 Bacteria 2454
320 Ga0439446_0134483 3300042156 Bacteria 804
321 Ga0439434_0135584 3300042435 Unclassified 809
322 Ga0439435_0036802 3300042436 Unclassified 1354
323 Ga0451576_0002116 3300045051 Bacteria 30865
324 Ga0451576_0775046 3300045051 Unclassified 1007
325 Ga0495582_0084268 3300046473 Bacteria 1767
326 Ga0495586_0219147 3300046535 Unclassified 1081
327 Ga0495586_0407930 3300046535 Unclassified 782
328 Ga0495609_0070783 3300046538 Bacteria 1533
329 Ga0495621_0217429 3300046539 Bacteria 773
330 Ga0495656_0320547 3300046615 Unclassified 798
331 Ga0495668_0451928 3300046616 Bacteria 707
332 Ga0495634_0020560 3300046642 Bacteria 4680
333 Ga0495659_0048089 3300046664 Bacteria 1544
334 Ga0495669_0063681 3300046684 Bacteria 1673
335 Ga0495677_0211927 3300047445 Bacteria 754
336 Ga0496102_0046732 3300048905 Bacteria 3932
337 Ga0496102_1494016 3300048905 Bacteria 594
338 Ga0496106_0251474 3300048909 Unclassified 1413
339 Ga0496106_0687353 3300048909 Bacteria 816
340 Ga0496108_0577782 3300048911 Unclassified 980
341 Ga0496109_0501020 3300048912 Bacteria 1146
342 Ga0496112_0094518 3300048915 Bacteria 2960
343 Ga0496112_0707591 3300048915 Bacteria 935
344 Ga0496112_0935059 3300048915 Bacteria 788
345 Ga0501076_0066698 3300049592 Bacteria 2873
346 Ga0501202_129226 3300049652 Unclassified 642
347 Ga0501079_0261113 3300049741 Bacteria 1354
348 Ga0501081_0325129 3300049743 Bacteria 1131
349 Ga0501283_004687 3300049779 Unclassified 1857
350 nmdc:mga05p37_15782_c1 3300050507 Bacteria 9083
351 nmdc:mga05p37_195005_c1 3300050507 Bacteria 2456
352 nmdc:mga05p37_39456_c1 3300050507 Bacteria 5798
353 nmdc:mga05p37_42065_c1 3300050507 Bacteria 5613
354 nmdc:mga05p37_444200_c1 3300050507 Bacteria 1503
355 nmdc:mga05p37_481943_c1 3300050507 Bacteria 1428
356 nmdc:mga05p37_512455_c1 3300050507 Bacteria 1374
357 nmdc:mga05p37_64584_c1 3300050507 Bacteria 4504
358 nmdc:mga05p37_726254_c1 3300050507 Bacteria 1099
359 nmdc:mga05p37_74916_c1 3300050507 Bacteria 4166
360 nmdc:mga09592_312766_c1 3300050508 Unclassified 1361
361 nmdc:mga09592_630473_c1 3300050508 Bacteria 916
362 nmdc:mga06r32_675380_c1 3300050510 Unclassified 1000
363 nmdc:mga08y16_311670_c1 3300050511 Unclassified 1621
364 nmdc:mga08y16_43400_c1 3300050511 Bacteria 4712
365 nmdc:mga08y16_50798_c1 3300050511 Bacteria 4339
366 nmdc:mga08y16_512023_c1 3300050511 Unclassified 1218
367 nmdc:mga0n895_1211980_c1 3300050512 Unclassified 728
368 nmdc:mga0n895_14843_c1 3300050512 Bacteria 7090
369 nmdc:mga0n895_148_c1 3300050512 Bacteria 43053
370 nmdc:mga0n895_247037_c1 3300050512 Bacteria 1811
371 nmdc:mga0n895_294897_c1 3300050512 Unclassified 1644
372 nmdc:mga0n895_300754_c1 3300050512 Bacteria 1626
373 nmdc:mga0n895_574435_c1 3300050512 Bacteria 1132
374 nmdc:mga0n895_705651_c1 3300050512 Unclassified 1005
375 nmdc:mga0n895_79509_c1 3300050512 Bacteria 3266
376 nmdc:mga0n895_856_c1 3300050512 Bacteria 21872
377 nmdc:mga0rr50_126960_c1 3300050513 Bacteria 2038
378 nmdc:mga0rr50_16876_c1 3300050513 Bacteria 4862
379 nmdc:mga0rr50_179903_c1 3300050513 Bacteria 1728
380 nmdc:mga0rr50_25353_c1 3300050513 Bacteria 4121
381 nmdc:mga0rr50_3078_c1 3300050513 Bacteria 9547
382 nmdc:mga0rr50_387832_c1 3300050513 Bacteria 1179
383 nmdc:mga0rr50_4_c1 3300050513 Bacteria 338870
384 nmdc:mga08x19_18817_c1 3300050514 Bacteria 4234
385 nmdc:mga08x19_262_c1 3300050514 Bacteria 39794
386 nmdc:mga08x19_2645_c1 3300050514 Bacteria 10832
387 nmdc:mga08x19_329881_c1 3300050514 Bacteria 1063
388 nmdc:mga08x19_345835_c1 3300050514 Bacteria 1038
389 nmdc:mga08x19_382596_c1 3300050514 Bacteria 986
390 nmdc:mga08x19_60327_c1 3300050514 Bacteria 2457
391 nmdc:mga0a205_12896_c1 3300050515 Bacteria 7753
392 nmdc:mga0a205_190359_c1 3300050515 Bacteria 1944
393 nmdc:mga0a205_197502_c1 3300050515 Bacteria 1903
394 nmdc:mga0a205_296473_c1 3300050515 Bacteria 1490
395 nmdc:mga0a205_353439_c1 3300050515 Bacteria 1337
396 nmdc:mga0a205_376094_c1 3300050515 Bacteria 1286
397 Ga0501084_1329809 3300054114 Bacteria 602
398 Ga0530510_0009401 3300061734 Bacteria 6855
399 Ga0075434_100010283
400 Ga0065715_10253133
401 Ga0065715_10298260
402 Ga0070676_10391667
403 Ga0070676_10472279
404 Ga0068869_100749609
405 Ga0068869_101602984
406 Ga0070666_10087743
407 Ga0070666_10156318
408 Ga0068868_100785167
409 Ga0070691_10009458
410 Ga0070668_100280856
411 Ga0070668_100433099
412 Ga0070669_100078994
413 Ga0070669_100131471
414 Ga0070669_100208472
415 Ga0070669_101295316
416 Ga0070675_100010258
417 Ga0070675_100434661
418 Ga0070675_101052589
419 Ga0070671_100742790
420 Ga0070674_100004139
421 Ga0070674_100335791
422 Ga0070673_100074452
423 Ga0070673_100152883
424 Ga0070673_100684699
425 Ga0070667_100009296
426 Ga0070667_100934072
427 Ga0070703_10219636
428 Ga0070713_100370892
429 Ga0070701_10004640
430 Ga0070701_11030266
431 Ga0070711_100156794
432 Ga0070705_100004392
433 Ga0070705_100012607
434 Ga0070705_100037867
435 Ga0070705_100118391
436 Ga0070705_100925795
437 Ga0070700_100070006
438 Ga0070700_100080246
439 Ga0070694_100000830
440 Ga0070694_100002569
441 Ga0070694_100122366
442 Ga0070694_100162059
443 Ga0070694_100221180
444 Ga0070694_100855424
445 Ga0070708_100078647
446 Ga0070708_100106708
447 Ga0070708_100302185
448 Ga0070708_100563807
449 Ga0070662_100079629
450 Ga0070662_100084872
451 Ga0070662_100146001
452 Ga0070662_100626797
453 Ga0070681_10715431
454 Ga0068867_100011395
455 Ga0068867_100102910
456 Ga0068867_100144839
457 Ga0070706_100357916
458 Ga0070706_100702280
459 Ga0070707_100161829
460 Ga0070707_100282808
461 Ga0070707_100374625
462 Ga0070707_101094412
463 Ga0070698_100007640
464 Ga0070698_100008089
465 Ga0070698_100113325
466 Ga0070699_100007603
467 Ga0070699_100034736
468 Ga0070699_100076243
469 Ga0070699_100153711
470 Ga0070699_100295872
471 Ga0070697_100081099
472 Ga0070697_100146528
473 Ga0070697_100978961
474 Ga0070672_100130492
475 Ga0070672_100746530
476 Ga0070686_100005521
477 Ga0070686_100351800
478 Ga0070695_100026842
479 Ga0070695_100041228
480 Ga0070695_100785352
481 Ga0070695_101538938
482 Ga0070696_100020166
483 Ga0070696_100020332
484 Ga0070696_100027310
485 Ga0070696_100028138
486 Ga0070696_100442517
487 Ga0070696_100485933
488 Ga0070665_100323837
489 Ga0070704_100000664
490 Ga0070704_100095424
491 Ga0070704_100135352
492 Ga0070704_100923762
493 Ga0068855_100624318
494 Ga0068854_100001270
495 Ga0068854_100027872
496 Ga0068854_100912191
497 Ga0070702_100017568
498 Ga0070702_100612598
499 Ga0068859_100966450
500 Ga0068859_101062561
501 Ga0068866_10771572
502 Ga0068861_100034395
503 Ga0068861_100055365
504 Ga0068861_100347712
505 Ga0068870_10364564
506 Ga0068863_100005389
507 Ga0068858_100646956
508 Ga0068858_100769454
509 Ga0068858_101170135
510 Ga0068860_100163282
511 Ga0068860_100602437
512 Ga0068860_100627324
513 Ga0068860_100668434
514 Ga0068862_100219771
515 Ga0068862_100420113
516 Ga0068862_100462594
517 Ga0068862_101483329
518 Ga0081455_10070060
519 Ga0075432_10107824
520 Ga0068871_100102253
521 Ga0075428_100087123
522 Ga0075428_100176780
523 Ga0075428_100413086
524 Ga0075433_10028619
525 Ga0075433_10149619
526 Ga0075433_10239107
527 Ga0075433_10334955
528 Ga0075433_10386347
529 Ga0075433_10769425
530 Ga0075434_100002441
531 Ga0075434_100285658
532 Ga0075434_100315700
533 Ga0075434_100318215
534 Ga0075434_100388272
535 Ga0075434_100423450
536 Ga0075434_100456120
537 Ga0075434_100528479
538 Ga0075434_100638028
539 Ga0075434_100653752
540 Ga0075434_101131658
541 Ga0075434_101338379
542 Ga0075429_100323793
543 Ga0068865_100055880
544 Ga0075436_100009023
545 Ga0075436_100019850
546 Ga0075436_100023827
547 Ga0075436_100071447
548 Ga0075436_100121386
549 Ga0075436_100458526
550 Ga0075436_100757250
551 Ga0097620_100966366
552 Ga0097620_101062570
553 Ga0075435_100000957
554 Ga0075435_100001928
555 Ga0075435_100012701
556 Ga0075435_100043011
557 Ga0075435_100086993
558 Ga0075435_100104633
559 Ga0075435_100376964
560 Ga0075435_100458338
561 Ga0075435_101204413
562 Ga0075435_101610995
563 Ga0105240_10285590
564 Ga0111539_10105853
565 Ga0111539_10860332
566 Ga0111539_11338179
567 Ga0105245_10440441
568 Ga0105247_10006881
569 Ga0114129_10002092
570 Ga0114129_10002144
571 Ga0114129_10011486
572 Ga0114129_10013208
573 Ga0114129_10034600
574 Ga0114129_10054679
575 Ga0114129_10178719
576 Ga0114129_10184042
577 Ga0114129_10547378
578 Ga0114129_11181128
579 Ga0114129_11550065
580 Ga0105243_10008005
581 Ga0105243_10115322
582 Ga0105243_10268376
583 Ga0105243_10308927
584 Ga0105241_10405629
585 Ga0105242_10327690
586 Ga0105248_10003811
587 Ga0105248_10038259
588 Ga0105248_10191578
589 Ga0105248_10483989
590 Ga0105238_10572505
591 Ga0105249_10599745
592 Ga0105249_10976846
593 Ga0105246_10326592
594 Ga0157378_11547836
595 Ga0157380_10027326
596 Ga0157380_10123472
597 Ga0157380_10457847
598 Ga0157380_10492931
599 Ga0157380_12556043
600 Ga0157379_10831266
601 Ga0157379_11273628
602 Ga0163161_10250463
603 Ga0207697_10184639
604 Ga0207697_10267813
605 Ga0207682_10088234
606 Ga0207688_10124791
607 Ga0207645_10050412
608 Ga0207645_10171968
609 Ga0207684_10108546
610 Ga0207684_11007486
611 Ga0207684_11239138
612 Ga0207654_11121050
613 Ga0207663_10060525
614 Ga0207660_10459736
615 Ga0207662_10016305
616 Ga0207662_10146738
617 Ga0207662_10309131
618 Ga0207662_10354234
619 Ga0207646_10229442
620 Ga0207646_10395427
621 Ga0207681_10054733
622 Ga0207681_10421454
623 Ga0207659_10211853
624 Ga0207659_10344816
625 Ga0207659_10365568
626 Ga0207687_10292136
627 Ga0207644_10222717
628 Ga0207690_10217724
629 Ga0207690_10263296
630 Ga0207706_10066712
631 Ga0207706_10174381
632 Ga0207706_10334955
633 Ga0207686_10637682
634 Ga0207709_10461584
635 Ga0207709_10645786
636 Ga0207670_10248803
637 Ga0207670_10285064
638 Ga0207669_10009188
639 Ga0207669_10304900
640 Ga0207669_10517154
641 Ga0207704_10264618
642 Ga0207704_10460311
643 Ga0207691_10015158
644 Ga0207691_10237692
645 Ga0207711_10173725
646 Ga0207711_10218383
647 Ga0207689_10577900
648 Ga0207651_10061043
649 Ga0207651_10396426
650 Ga0207712_10830938
651 Ga0207668_10478705
652 Ga0207640_10032254
653 Ga0207640_10081198
654 Ga0207703_10035090
655 Ga0207703_10515249
656 Ga0207703_10829382
657 Ga0207703_10988479
658 Ga0207708_10046789
659 Ga0207708_10092586
660 Ga0207708_10815951
661 Ga0207641_10002280
662 Ga0207648_10012414
663 Ga0207648_10018670
664 Ga0207648_10676165
665 Ga0207675_100012851
666 Ga0207675_100030504
667 Ga0207675_100168360
668 Ga0207675_101287340
669 Ga0207428_10062115
670 Ga0207428_10170925
671 Ga0207428_10376040
672 Ga0207428_10427141
673 Ga0268266_10177049
674 Ga0268265_10011521
675 Ga0268265_10047059
676 Ga0268265_10061982
677 Ga0268265_10583402
678 Ga0268264_11001096
679 Ga0307408_100384124
680 Ga0307408_100525467
681 Ga0307408_100748098
682 Ga0307408_100793901
683 Ga0307406_10149200
684 Ga0307412_10143065
685 Ga0307409_100445083
686 Ga0307409_101058122
687 Ga0307411_10315673
688 Ga0307411_10568378
689 Ga0373930_0037930
690 Ga0373950_0026041
691 Ga0373958_0074186
692 Ga0373959_0001798
693 Ga0373959_0121201
694 Ga0373938_0002066
695 Ga0373928_0051520
696 Ga0373929_0002585
697 Ga0373929_0109529
698 Ga0373940_0071357
699 Ga0373949_0001935
700 Ga0373951_0043994
701 Ga0373952_0000158
702 Ga0373932_0003133
703 Ga0373932_0039115
704 Ga0373939_0001941
705 Ga0373939_0161574
706 Ga0373941_0004942
707 Ga0373960_0000102
708 Ga0373961_0000621
709 Ga0373961_0047078
710 Ga0373962_0004709
711 Ga0373962_0210885
712 Ga0373931_0011263
713 Ga0373931_0252602
714 Ga0439439_0032384
715 Ga0439433_0008868
716 Ga0439462_0047784
717 Ga0439446_0010936
718 Ga0439446_0134483
719 Ga0439434_0135584
720 Ga0439435_0036802
721 Ga0451576_0002116
722 Ga0451576_0775046
723 Ga0495582_0084268
724 Ga0495586_0219147
725 Ga0495586_0407930
726 Ga0495609_0070783
727 Ga0495621_0217429
728 Ga0495656_0320547
729 Ga0495668_0451928
730 Ga0495634_0020560
731 Ga0495659_0048089
732 Ga0495669_0063681
733 Ga0495677_0211927
734 Ga0496102_0046732
735 Ga0496102_1494016
736 Ga0496106_0251474
737 Ga0496106_0687353
738 Ga0496108_0577782
739 Ga0496109_0501020
740 Ga0496112_0094518
741 Ga0496112_0707591
742 Ga0496112_0935059
743 Ga0501076_0066698
744 Ga0501202_129226
745 Ga0501079_0261113
746 Ga0501081_0325129
747 Ga0501283_004687
748 nmdc:mga05p37_15782_c1
749 nmdc:mga05p37_195005_c1
750 nmdc:mga05p37_39456_c1
751 nmdc:mga05p37_42065_c1
752 nmdc:mga05p37_444200_c1
753 nmdc:mga05p37_481943_c1
754 nmdc:mga05p37_512455_c1
755 nmdc:mga05p37_64584_c1
756 nmdc:mga05p37_726254_c1
757 nmdc:mga05p37_74916_c1
758 nmdc:mga09592_312766_c1
759 nmdc:mga09592_630473_c1
760 nmdc:mga06r32_675380_c1
761 nmdc:mga08y16_311670_c1
762 nmdc:mga08y16_43400_c1
763 nmdc:mga08y16_50798_c1
764 nmdc:mga08y16_512023_c1
765 nmdc:mga0n895_1211980_c1
766 nmdc:mga0n895_14843_c1
767 nmdc:mga0n895_148_c1
768 nmdc:mga0n895_247037_c1
769 nmdc:mga0n895_294897_c1
770 nmdc:mga0n895_300754_c1
771 nmdc:mga0n895_574435_c1
772 nmdc:mga0n895_705651_c1
773 nmdc:mga0n895_79509_c1
774 nmdc:mga0n895_856_c1
775 nmdc:mga0rr50_126960_c1
776 nmdc:mga0rr50_16876_c1
777 nmdc:mga0rr50_179903_c1
778 nmdc:mga0rr50_25353_c1
779 nmdc:mga0rr50_3078_c1
780 nmdc:mga0rr50_387832_c1
781 nmdc:mga0rr50_4_c1
782 nmdc:mga08x19_18817_c1
783 nmdc:mga08x19_262_c1
784 nmdc:mga08x19_2645_c1
785 nmdc:mga08x19_329881_c1
786 nmdc:mga08x19_345835_c1
787 nmdc:mga08x19_382596_c1
788 nmdc:mga08x19_60327_c1
789 nmdc:mga0a205_12896_c1
790 nmdc:mga0a205_190359_c1
791 nmdc:mga0a205_197502_c1
792 nmdc:mga0a205_296473_c1
793 nmdc:mga0a205_353439_c1
794 nmdc:mga0a205_376094_c1
795 Ga0501084_1329809
796 Ga0530510_0009401

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11821

ActD

Alternative complex III, ActD subunit

7

171

0.92

Map