F433972

General Info

Members Datasets Scaffolds Average Seq Length
398 197 398 125

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100954634|Ga0070660_1009546341
Length 118
Sequence MQWGVILTVAVGGALGSVMRYLVAGTVQPAWWPGFPFGIFVVNITGGLVMGLITALAALKLNLAPEMRAFLTTGILGGYTTFSTFSLDSALLIERIGSVVLSILALFAGLWLVRALYA

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
140 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
141 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
142 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
143 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
152 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
160 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
172 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
173 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
174 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
193 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
194 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
195 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
196 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
197 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.76
Nodule 0
Rhizoplane 1.26
Rhizosphere 95.23
Stem 0
Stem Tuber 0
Unclassified 1.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100283802 3300005329 Bacteria 1575
2 Ga0070683_100525329 3300005329 Bacteria 1131
3 Ga0070690_100030770 3300005330 Bacteria 3340
4 Ga0068869_101964801 3300005334 Bacteria 525
5 Ga0070666_10059356 3300005335 Bacteria 2587
6 Ga0070680_100171152 3300005336 Bacteria 1827
7 Ga0068868_100035570 3300005338 Bacteria 3851
8 Ga0068868_100058427 3300005338 Bacteria 3048
9 Ga0068868_100310268 3300005338 Bacteria 1342
10 Ga0070660_100331302 3300005339 Bacteria 1252
11 Ga0070660_100954634 3300005339 Bacteria 724
12 Ga0070660_101105909 3300005339 Bacteria 671
13 Ga0070691_10000485 3300005341 Bacteria 14891
14 Ga0070661_100091838 3300005344 Bacteria 2249
15 Ga0070661_100285307 3300005344 Bacteria 1282
16 Ga0070675_100368351 3300005354 Bacteria 1277
17 Ga0070675_101354111 3300005354 Bacteria 656
18 Ga0070671_100027071 3300005355 Bacteria 4717
19 Ga0070671_101058375 3300005355 Bacteria 712
20 Ga0070674_100444209 3300005356 Bacteria 1069
21 Ga0070674_100448061 3300005356 Bacteria 1065
22 Ga0070673_100055311 3300005364 Bacteria 3126
23 Ga0070673_102050146 3300005364 Bacteria 543
24 Ga0070667_100042703 3300005367 Bacteria 3804
25 Ga0070667_100431363 3300005367 Bacteria 1202
26 Ga0070709_10003897 3300005434 Bacteria 8045
27 Ga0070709_10555292 3300005434 Bacteria 879
28 Ga0070714_100172470 3300005435 Bacteria 1964
29 Ga0070713_100000012 3300005436 Bacteria 137708
30 Ga0070713_100894940 3300005436 Bacteria 854
31 Ga0070713_101137977 3300005436 Bacteria 755
32 Ga0070710_10095001 3300005437 Bacteria 1765
33 Ga0070701_10146857 3300005438 Bacteria 1354
34 Ga0070711_100136996 3300005439 Bacteria 1831
35 Ga0070700_100260700 3300005441 Bacteria 1248
36 Ga0070663_100300876 3300005455 Bacteria 1284
37 Ga0070678_100005277 3300005456 Bacteria 7446
38 Ga0070678_100137290 3300005456 Bacteria 1952
39 Ga0070678_100408034 3300005456 Bacteria 1182
40 Ga0070662_100017414 3300005457 Bacteria 4845
41 Ga0070681_10128764 3300005458 Bacteria 2464
42 Ga0070681_10297586 3300005458 Bacteria 1523
43 Ga0068867_100033651 3300005459 Bacteria 3713
44 Ga0068867_101406293 3300005459 Unclassified 647
45 Ga0068867_101430395 3300005459 Bacteria 642
46 Ga0070699_100824848 3300005518 Bacteria 849
47 Ga0070679_100066863 3300005530 Bacteria 3584
48 Ga0070679_100302715 3300005530 Bacteria 1549
49 Ga0070684_100858198 3300005535 Bacteria 850
50 Ga0068853_100005952 3300005539 Bacteria 9634
51 Ga0068853_100352238 3300005539 Bacteria 1370
52 Ga0068853_101098437 3300005539 Bacteria 767
53 Ga0068853_102311986 3300005539 Archaea 521
54 Ga0070672_100026197 3300005543 Bacteria 4335
55 Ga0070693_100032363 3300005547 Bacteria 2875
56 Ga0070693_100436693 3300005547 Bacteria 916
57 Ga0070693_100503894 3300005547 Bacteria 859
58 Ga0070693_100874711 3300005547 Bacteria 672
59 Ga0070693_101422673 3300005547 Bacteria 540
60 Ga0070665_100000359 3300005548 Bacteria 67900
61 Ga0070665_100154409 3300005548 Bacteria 2297
62 Ga0070665_100189306 3300005548 Bacteria 2059
63 Ga0070665_100808317 3300005548 Bacteria 951
64 Ga0070665_101171742 3300005548 Bacteria 779
65 Ga0068855_101746548 3300005563 Unclassified 633
66 Ga0070664_100364360 3300005564 Bacteria 1317
67 Ga0070664_100561302 3300005564 Bacteria 1056
68 Ga0070664_100733132 3300005564 Bacteria 922
69 Ga0068857_100002087 3300005577 Bacteria 16235
70 Ga0068857_100030650 3300005577 Bacteria 4750
71 Ga0068854_100117393 3300005578 Bacteria 2015
72 Ga0068856_100001032 3300005614 Bacteria 29659
73 Ga0068856_100002049 3300005614 Bacteria 20920
74 Ga0068856_100102200 3300005614 Bacteria 2860
75 Ga0068856_102187543 3300005614 Bacteria 562
76 Ga0070702_100870577 3300005615 Bacteria 703
77 Ga0068852_100345624 3300005616 Bacteria 1451
78 Ga0068852_101514929 3300005616 Bacteria 693
79 Ga0068859_101572724 3300005617 Bacteria 726
80 Ga0068864_100043985 3300005618 Bacteria 3825
81 Ga0068864_100179496 3300005618 Bacteria 1935
82 Ga0068866_10036795 3300005718 Bacteria 2399
83 Ga0068866_10099714 3300005718 Bacteria 1600
84 Ga0068861_100634153 3300005719 Bacteria 985
85 Ga0068851_10290148 3300005834 Bacteria 938
86 Ga0068870_10311103 3300005840 Bacteria 998
87 Ga0068870_10939952 3300005840 Bacteria 613
88 Ga0068863_100541999 3300005841 Bacteria 1148
89 Ga0068858_100008177 3300005842 Bacteria 10059
90 Ga0068858_100611954 3300005842 Bacteria 1057
91 Ga0068860_100580133 3300005843 Bacteria 1125
92 Ga0070715_10190134 3300006163 Bacteria 1036
93 Ga0070712_100000821 3300006175 Bacteria 18441
94 Ga0070712_100000902 3300006175 Bacteria 17764
95 Ga0097621_100003892 3300006237 Bacteria 10347
96 Ga0097621_100421140 3300006237 Bacteria 1198
97 Ga0097621_101015728 3300006237 Bacteria 776
98 Ga0097621_101230314 3300006237 Bacteria 706
99 Ga0097621_101259579 3300006237 Bacteria 698
100 Ga0097621_102381752 3300006237 Bacteria 507
101 Ga0097621_102418502 3300006237 Bacteria 503
102 Ga0068871_100003982 3300006358 Bacteria 10211
103 Ga0068871_100028289 3300006358 Bacteria 4394
104 Ga0068871_100303926 3300006358 Bacteria 1401
105 Ga0068871_100528112 3300006358 Bacteria 1066
106 Ga0068871_100592243 3300006358 Bacteria 1008
107 Ga0068871_100718602 3300006358 Bacteria 916
108 Ga0075434_100010318 3300006871 Bacteria 8759
109 Ga0075434_100038090 3300006871 Bacteria 4763
110 Ga0068865_100080839 3300006881 Bacteria 2332
111 Ga0075436_100001059 3300006914 Bacteria 18544
112 Ga0075436_100100081 3300006914 Bacteria 2018
113 Ga0097620_101572590 3300006931 Bacteria 726
114 Ga0075435_100031942 3300007076 Bacteria 4154
115 Ga0075435_100123028 3300007076 Bacteria 2166
116 Ga0105240_10029762 3300009093 Bacteria 7106
117 Ga0105240_10061836 3300009093 Bacteria 4664
118 Ga0105240_10088284 3300009093 Bacteria 3794
119 Ga0105240_10464009 3300009093 Bacteria 1414
120 Ga0105240_11040613 3300009093 Bacteria 874
121 Ga0105245_10274118 3300009098 Bacteria 1646
122 Ga0105245_10448205 3300009098 Bacteria 1299
123 Ga0105243_10005642 3300009148 Bacteria 9744
124 Ga0105241_10022396 3300009174 Bacteria 4680
125 Ga0105241_10057112 3300009174 Bacteria 2993
126 Ga0105241_10120305 3300009174 Bacteria 2113
127 Ga0105241_10126506 3300009174 Bacteria 2064
128 Ga0105241_10608586 3300009174 Bacteria 988
129 Ga0105242_10035801 3300009176 Bacteria 3981
130 Ga0105242_10145967 3300009176 Bacteria 2058
131 Ga0105242_10270749 3300009176 Bacteria 1538
132 Ga0105242_10545078 3300009176 Bacteria 1111
133 Ga0105242_10561247 3300009176 Bacteria 1096
134 Ga0105242_10768305 3300009176 Bacteria 951
135 Ga0105248_12438989 3300009177 Bacteria 596
136 Ga0105237_10003253 3300009545 Bacteria 19420
137 Ga0105237_10337894 3300009545 Bacteria 1510
138 Ga0105238_10001939 3300009551 Bacteria 20807
139 Ga0105238_10101952 3300009551 Bacteria 2852
140 Ga0105238_10160630 3300009551 Bacteria 2223
141 Ga0105238_10412448 3300009551 Bacteria 1344
142 Ga0105238_10844496 3300009551 Bacteria 933
143 Ga0105249_10688862 3300009553 Bacteria 1081
144 Ga0105249_12494353 3300009553 Bacteria 589
145 Ga0105239_10208885 3300010375 Bacteria 2188
146 Ga0105239_10305613 3300010375 Bacteria 1792
147 Ga0105239_10601472 3300010375 Bacteria 1254
148 Ga0105239_10847979 3300010375 Bacteria 1048
149 Ga0105246_10003749 3300011119 Bacteria 9208
150 Ga0157373_10000820 3300013100 Bacteria 24076
151 Ga0157373_11030602 3300013100 Unclassified 615
152 Ga0157373_11157243 3300013100 Unclassified 582
153 Ga0157370_10003448 3300013104 Bacteria 18559
154 Ga0157370_11226344 3300013104 Bacteria 676
155 Ga0157369_10001535 3300013105 Bacteria 28280
156 Ga0157369_10412214 3300013105 Bacteria 1401
157 Ga0157374_10063664 3300013296 Bacteria 3459
158 Ga0157374_10084367 3300013296 Bacteria 3019
159 Ga0157374_10269166 3300013296 Bacteria 1679
160 Ga0157374_10505371 3300013296 Bacteria 1213
161 Ga0157374_10565034 3300013296 Bacteria 1146
162 Ga0157374_10596616 3300013296 Bacteria 1114
163 Ga0157374_11283738 3300013296 Bacteria 754
164 Ga0157378_10085784 3300013297 Bacteria 2853
165 Ga0157378_10669223 3300013297 Bacteria 1055
166 Ga0157378_10742643 3300013297 Bacteria 1004
167 Ga0157378_10975084 3300013297 Bacteria 881
168 Ga0163162_10282879 3300013306 Bacteria 1790
169 Ga0163162_10305069 3300013306 Bacteria 1724
170 Ga0163162_10384691 3300013306 Bacteria 1536
171 Ga0157372_10008268 3300013307 Bacteria 11062
172 Ga0157372_10072243 3300013307 Bacteria 3888
173 Ga0157372_10481087 3300013307 Bacteria 1447
174 Ga0157375_10220642 3300013308 Bacteria 2054
175 Ga0163163_10091996 3300014325 Bacteria 3048
176 Ga0163163_10253747 3300014325 Bacteria 1810
177 Ga0163163_10417755 3300014325 Bacteria 1400
178 Ga0163163_10475236 3300014325 Bacteria 1311
179 Ga0157379_10034193 3300014968 Bacteria 4530
180 Ga0157379_10039502 3300014968 Bacteria 4210
181 Ga0157379_11825114 3300014968 Bacteria 598
182 Ga0157379_11942618 3300014968 Bacteria 581
183 Ga0157376_10136195 3300014969 Bacteria 2198
184 Ga0157376_10272893 3300014969 Bacteria 1589
185 Ga0157376_10510289 3300014969 Bacteria 1183
186 Ga0182007_10172631 3300015262 Bacteria 744
187 Ga0163161_10094633 3300017792 Bacteria 2215
188 Ga0213876_10000421 3300021384 Bacteria 35344
189 Ga0207642_10082177 3300025899 Bacteria 1568
190 Ga0207688_10024170 3300025901 Bacteria 3331
191 Ga0207680_10366276 3300025903 Bacteria 1014
192 Ga0207685_10087251 3300025905 Bacteria 1305
193 Ga0207699_10000164 3300025906 Bacteria 41177
194 Ga0207645_10043723 3300025907 Bacteria 2867
195 Ga0207643_10121739 3300025908 Bacteria 1546
196 Ga0207705_10015982 3300025909 Bacteria 5388
197 Ga0207654_10068962 3300025911 Bacteria 2094
198 Ga0207654_10084159 3300025911 Bacteria 1922
199 Ga0207654_10132026 3300025911 Bacteria 1582
200 Ga0207654_11082679 3300025911 Bacteria 584
201 Ga0207707_10282950 3300025912 Bacteria 1436
202 Ga0207695_10053555 3300025913 Bacteria 4220
203 Ga0207695_10077288 3300025913 Bacteria 3381
204 Ga0207695_10181050 3300025913 Bacteria 2028
205 Ga0207695_10226228 3300025913 Bacteria 1777
206 Ga0207695_10480677 3300025913 Bacteria 1124
207 Ga0207671_10090587 3300025914 Bacteria 2304
208 Ga0207671_10375327 3300025914 Bacteria 1129
209 Ga0207693_10001210 3300025915 Bacteria 23009
210 Ga0207693_10001929 3300025915 Bacteria 18163
211 Ga0207663_10206736 3300025916 Bacteria 1420
212 Ga0207660_10134048 3300025917 Bacteria 1888
213 Ga0207660_10189836 3300025917 Bacteria 1599
214 Ga0207657_10313682 3300025919 Bacteria 1241
215 Ga0207657_11122084 3300025919 Bacteria 600
216 Ga0207649_10275805 3300025920 Bacteria 1221
217 Ga0207649_10777888 3300025920 Bacteria 746
218 Ga0207652_10123686 3300025921 Bacteria 2303
219 Ga0207694_10012134 3300025924 Bacteria 6497
220 Ga0207694_10040659 3300025924 Bacteria 3581
221 Ga0207694_10353009 3300025924 Bacteria 1217
222 Ga0207694_10708269 3300025924 Bacteria 849
223 Ga0207694_11023582 3300025924 Bacteria 699
224 Ga0207694_11415852 3300025924 Bacteria 587
225 Ga0207650_10570214 3300025925 Bacteria 950
226 Ga0207650_11775456 3300025925 Bacteria 522
227 Ga0207659_10921638 3300025926 Bacteria 751
228 Ga0207687_10054264 3300025927 Bacteria 2803
229 Ga0207687_10231042 3300025927 Bacteria 1461
230 Ga0207687_10389791 3300025927 Bacteria 1143
231 Ga0207700_10000295 3300025928 Bacteria 29631
232 Ga0207700_10265784 3300025928 Bacteria 1470
233 Ga0207700_10376335 3300025928 Bacteria 1241
234 Ga0207644_10399798 3300025931 Bacteria 1123
235 Ga0207644_10941585 3300025931 Bacteria 724
236 Ga0207690_10317910 3300025932 Bacteria 1223
237 Ga0207706_10038019 3300025933 Bacteria 4270
238 Ga0207686_10003934 3300025934 Bacteria 7966
239 Ga0207686_10027553 3300025934 Bacteria 3329
240 Ga0207686_10113505 3300025934 Bacteria 1832
241 Ga0207686_10217991 3300025934 Bacteria 1376
242 Ga0207686_10517660 3300025934 Bacteria 928
243 Ga0207686_11481221 3300025934 Unclassified 559
244 Ga0207709_10001826 3300025935 Bacteria 14215
245 Ga0207709_10744591 3300025935 Bacteria 787
246 Ga0207670_10086639 3300025936 Bacteria 2204
247 Ga0207669_10053800 3300025937 Bacteria 2428
248 Ga0207669_10170662 3300025937 Bacteria 1548
249 Ga0207704_10041056 3300025938 Bacteria 2709
250 Ga0207665_10724415 3300025939 Bacteria 783
251 Ga0207691_10166506 3300025940 Bacteria 1931
252 Ga0207689_10133362 3300025942 Bacteria 2045
253 Ga0207689_11106372 3300025942 Unclassified 668
254 Ga0207661_10232516 3300025944 Bacteria 1633
255 Ga0207661_10455637 3300025944 Bacteria 1165
256 Ga0207679_10341627 3300025945 Bacteria 1302
257 Ga0207679_10595298 3300025945 Bacteria 996
258 Ga0207679_11139612 3300025945 Bacteria 716
259 Ga0207667_10012207 3300025949 Bacteria 9924
260 Ga0207667_10435528 3300025949 Bacteria 1333
261 Ga0207667_11318108 3300025949 Bacteria 698
262 Ga0207651_10026303 3300025960 Bacteria 3632
263 Ga0207712_10775356 3300025961 Bacteria 841
264 Ga0207712_11117401 3300025961 Bacteria 702
265 Ga0207712_11165482 3300025961 Bacteria 687
266 Ga0207658_10125924 3300025986 Bacteria 2050
267 Ga0207677_10024943 3300026023 Bacteria 3723
268 Ga0207677_11113140 3300026023 Bacteria 720
269 Ga0207703_10093920 3300026035 Bacteria 2527
270 Ga0207703_10550737 3300026035 Bacteria 1087
271 Ga0207639_10212380 3300026041 Bacteria 1666
272 Ga0207639_11514538 3300026041 Bacteria 629
273 Ga0207702_10000315 3300026078 Bacteria 55383
274 Ga0207702_10256300 3300026078 Bacteria 1645
275 Ga0207641_11512924 3300026088 Bacteria 673
276 Ga0207648_10471701 3300026089 Bacteria 1145
277 Ga0207648_10561002 3300026089 Bacteria 1050
278 Ga0207676_10083186 3300026095 Bacteria 2606
279 Ga0207676_11303547 3300026095 Bacteria 721
280 Ga0207674_10001605 3300026116 Bacteria 29115
281 Ga0207674_10027878 3300026116 Bacteria 5967
282 Ga0207674_10498564 3300026116 Bacteria 1176
283 Ga0207675_100097291 3300026118 Bacteria 2771
284 Ga0207683_10006426 3300026121 Bacteria 10062
285 Ga0207683_10042913 3300026121 Bacteria 3950
286 Ga0207683_10134549 3300026121 Bacteria 2225
287 Ga0207683_10163010 3300026121 Bacteria 2017
288 Ga0207698_10284618 3300026142 Bacteria 1531
289 Ga0207698_11386198 3300026142 Bacteria 718
290 Ga0268266_10000557 3300028379 Bacteria 51935
291 Ga0268266_10086409 3300028379 Bacteria 2742
292 Ga0268266_10113035 3300028379 Bacteria 2408
293 Ga0268266_10181559 3300028379 Bacteria 1916
294 Ga0268266_10185118 3300028379 Bacteria 1898
295 Ga0268266_10226754 3300028379 Bacteria 1719
296 Ga0268266_10948820 3300028379 Bacteria 832
297 Ga0268266_11133673 3300028379 Bacteria 756
298 Ga0268264_10090595 3300028381 Bacteria 2636
299 Ga0265318_10154165 3300028577 Bacteria 843
300 Ga0265338_10002896 3300028800 Bacteria 24981
301 Ga0265338_10100342 3300028800 Bacteria 2361
302 Ga0265338_10305688 3300028800 Bacteria 1155
303 Ga0265338_10588172 3300028800 Bacteria 776
304 Ga0265330_10052374 3300031235 Bacteria 1788
305 Ga0265330_10266307 3300031235 Bacteria 722
306 Ga0265332_10011969 3300031238 Bacteria 3852
307 Ga0265328_10236743 3300031239 Bacteria 697
308 Ga0265325_10000782 3300031241 Bacteria 23019
309 Ga0265325_10005867 3300031241 Bacteria 7525
310 Ga0265340_10132588 3300031247 Bacteria 1142
311 Ga0265340_10153638 3300031247 Bacteria 1048
312 Ga0265339_10006891 3300031249 Bacteria 7406
313 Ga0265339_10031743 3300031249 Bacteria 2984
314 Ga0265339_10045533 3300031249 Bacteria 2414
315 Ga0265339_10222319 3300031249 Bacteria 923
316 Ga0265331_10000186 3300031250 Bacteria 76149
317 Ga0265331_10002324 3300031250 Bacteria 12963
318 Ga0265331_10054096 3300031250 Bacteria 1912
319 Ga0265327_10000392 3300031251 Bacteria 82296
320 Ga0265327_10299933 3300031251 Bacteria 708
321 Ga0265316_10035280 3300031344 Bacteria 4054
322 Ga0265316_10409036 3300031344 Bacteria 976
323 Ga0265316_10473663 3300031344 Bacteria 897
324 Ga0307513_10836906 3300031456 Unclassified 627
325 Ga0265313_10024969 3300031595 Bacteria 3178
326 Ga0265313_10210547 3300031595 Bacteria 805
327 Ga0265314_10055017 3300031711 Bacteria 2750
328 Ga0265342_10086818 3300031712 Bacteria 1799
329 Ga0265342_10094831 3300031712 Bacteria 1707
330 Ga0265342_10125861 3300031712 Bacteria 1439
331 Ga0265342_10182712 3300031712 Bacteria 1148
332 Ga0373934_0338399 3300035086 Bacteria 626
333 Ga0373955_0974949 3300035172 Bacteria 522
334 Ga0373935_0014263 3300035692 Bacteria 4797
335 Ga0373933_0110894 3300035724 Bacteria 1711
336 Ga0373937_0002620 3300036401 Bacteria 14997
337 Ga0373937_0285465 3300036401 Bacteria 1559
338 Ga0373937_0378486 3300036401 Bacteria 1342
339 Ga0373937_0457539 3300036401 Bacteria 1212
340 Ga0373937_0891862 3300036401 Bacteria 838
341 Ga0373925_0316435 3300037068 Bacteria 1262
342 Ga0373925_0529491 3300037068 Bacteria 968
343 Ga0436365_1372302 3300039437 Bacteria 1318
344 Ga0436365_1637588 3300039437 Bacteria 49130
345 Ga0436363_1465032 3300039450 Bacteria 3781
346 Ga0451807_2121146 3300041486 Bacteria 716
347 Ga0451853_3472860 3300041512 Bacteria 564
348 Ga0439448_0301002 3300042005 Bacteria 569
349 Ga0495580_0383602 3300046472 Bacteria 949
350 Ga0495606_0129995 3300046507 Bacteria 1498
351 Ga0495606_0361899 3300046507 Bacteria 767
352 Ga0495608_0580412 3300046511 Bacteria 674
353 Ga0495587_0300103 3300046536 Bacteria 898
354 Ga0495645_0700909 3300046543 Bacteria 615
355 Ga0495667_0796819 3300046559 Bacteria 583
356 Ga0495623_0307167 3300046679 Bacteria 875
357 Ga0495600_0779257 3300046809 Bacteria 571
358 Ga0495672_0424524 3300047320 Bacteria 604
359 Ga0495681_0159656 3300047470 Bacteria 940
360 Ga0495684_0859635 3300047471 Bacteria 588
361 Ga0495602_0027947 3300048088 Bacteria 5410
362 Ga0495602_0285206 3300048088 Bacteria 1215
363 Ga0495602_0459687 3300048088 Bacteria 897
364 Ga0496102_0036697 3300048905 Bacteria 4417
365 Ga0496104_1265801 3300048907 Bacteria 641
366 Ga0496107_0576114 3300048910 Bacteria 833
367 Ga0496109_1115541 3300048912 Bacteria 726
368 Ga0496126_0000480 3300048929 Bacteria 79257
369 Ga0501033_0007458 3300049570 Bacteria 8518
370 Ga0501033_0073466 3300049570 Bacteria 2511
371 Ga0501034_0482684 3300049571 Bacteria 1155
372 Ga0501036_0892689 3300049572 Bacteria 730
373 Ga0501043_0079029 3300049579 Bacteria 2585
374 Ga0501047_0029471 3300049581 Bacteria 5291
375 Ga0501047_0073866 3300049581 Bacteria 3283
376 Ga0501047_0924236 3300049581 Bacteria 686
377 Ga0501073_0209306 3300049589 Bacteria 1348
378 Ga0501080_0095027 3300049742 Bacteria 2768
379 Ga0501080_0777524 3300049742 Bacteria 841
380 Ga0501035_0020021 3300049822 Bacteria 6147
381 Ga0501035_0070491 3300049822 Bacteria 3096
382 Ga0501035_0977151 3300049822 Bacteria 667
383 Ga0501044_0021397 3300049823 Bacteria 6901
384 Ga0501044_0086595 3300049823 Bacteria 3164
385 nmdc:mga0n895_37478_c1 3300050512 Bacteria 4691
386 nmdc:mga0n895_58873_c1 3300050512 Bacteria 3789
387 nmdc:mga0rr50_136425_c1 3300050513 Bacteria 1970
388 nmdc:mga0rr50_152642_c1 3300050513 Bacteria 1868
389 nmdc:mga08x19_177_c1 3300050514 Bacteria 51482
390 nmdc:mga08x19_91143_c1 3300050514 Bacteria 2012
391 Ga0500643_000003 3300053087 Bacteria 876659
392 Ga0500646_0236377 3300053090 Unclassified 638
393 Ga0500650_0293273 3300053098 Unclassified 721
394 Ga0500568_0009719 3300053139 Bacteria 4552
395 Ga0500568_0034754 3300053139 Bacteria 2061
396 Ga0500645_017595 3300053730 Bacteria 2239
397 Ga0500645_225534 3300053730 Unclassified 501
398 Ga0501084_0148809 3300054114 Bacteria 1973

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_11226344 Ga0157370_112263441 104
2 3300039450 Ga0436363_1465032 Ga0436363_1465032_20_349 109
3 3300005339 Ga0070660_100954634 Ga0070660_1009546341 116
4 3300005547 Ga0070693_100503894 Ga0070693_1005038942 117
5 3300005842 Ga0068858_100611954 Ga0068858_1006119542 117
6 3300006358 Ga0068871_100718602 Ga0068871_1007186022 117
7 3300009174 Ga0105241_10126506 Ga0105241_101265063 117
8 3300031251 Ga0265327_10000392 Ga0265327_1000039297 118
9 3300039437 Ga0436365_1637588 Ga0436365_1637588_3599_3967 122
10 3300005330 Ga0070690_100030770 Ga0070690_1000307703 123
11 3300005334 Ga0068869_101964801 Ga0068869_1019648011 123
12 3300005335 Ga0070666_10059356 Ga0070666_100593562 123
13 3300005336 Ga0070680_100171152 Ga0070680_1001711522 123
14 3300005338 Ga0068868_100035570 Ga0068868_1000355705 123
15 3300005338 Ga0068868_100058427 Ga0068868_1000584272 123
16 3300005338 Ga0068868_100310268 Ga0068868_1003102682 123
17 3300005339 Ga0070660_100331302 Ga0070660_1003313022 123
18 3300005339 Ga0070660_101105909 Ga0070660_1011059092 123
19 3300005344 Ga0070661_100091838 Ga0070661_1000918383 123
20 3300005344 Ga0070661_100285307 Ga0070661_1002853072 123
21 3300005354 Ga0070675_100368351 Ga0070675_1003683511 123
22 3300005354 Ga0070675_101354111 Ga0070675_1013541111 123
23 3300005355 Ga0070671_100027071 Ga0070671_1000270713 123
24 3300005355 Ga0070671_101058375 Ga0070671_1010583751 123
25 3300005356 Ga0070674_100444209 Ga0070674_1004442092 123
26 3300005356 Ga0070674_100448061 Ga0070674_1004480612 123
27 3300005364 Ga0070673_100055311 Ga0070673_1000553112 123
28 3300005364 Ga0070673_102050146 Ga0070673_1020501461 123
29 3300005367 Ga0070667_100042703 Ga0070667_1000427036 123
30 3300005367 Ga0070667_100431363 Ga0070667_1004313632 123
31 3300005434 Ga0070709_10555292 Ga0070709_105552922 123
32 3300005436 Ga0070713_101137977 Ga0070713_1011379772 123
33 3300005438 Ga0070701_10146857 Ga0070701_101468572 123
34 3300005441 Ga0070700_100260700 Ga0070700_1002607002 123
35 3300005455 Ga0070663_100300876 Ga0070663_1003008762 123
36 3300005456 Ga0070678_100005277 Ga0070678_1000052775 123
37 3300005456 Ga0070678_100137290 Ga0070678_1001372902 123
38 3300005456 Ga0070678_100408034 Ga0070678_1004080342 123
39 3300005457 Ga0070662_100017414 Ga0070662_1000174145 123
40 3300005458 Ga0070681_10128764 Ga0070681_101287642 123
41 3300005458 Ga0070681_10297586 Ga0070681_102975862 123
42 3300005459 Ga0068867_100033651 Ga0068867_1000336512 123
43 3300005459 Ga0068867_101430395 Ga0068867_1014303952 123
44 3300005530 Ga0070679_100066863 Ga0070679_1000668632 123
45 3300005535 Ga0070684_100858198 Ga0070684_1008581982 123
46 3300005539 Ga0068853_100352238 Ga0068853_1003522382 123
47 3300005539 Ga0068853_101098437 Ga0068853_1010984371 123
48 3300005539 Ga0068853_102311986 Ga0068853_1023119861 123
49 3300005543 Ga0070672_100026197 Ga0070672_1000261972 123
50 3300005547 Ga0070693_100436693 Ga0070693_1004366932 123
51 3300005547 Ga0070693_100874711 Ga0070693_1008747112 123
52 3300005547 Ga0070693_101422673 Ga0070693_1014226732 123
53 3300005548 Ga0070665_100000359 Ga0070665_1000003596 123
54 3300005548 Ga0070665_100189306 Ga0070665_1001893062 123
55 3300005548 Ga0070665_100808317 Ga0070665_1008083172 123
56 3300005564 Ga0070664_100364360 Ga0070664_1003643602 123
57 3300005564 Ga0070664_100733132 Ga0070664_1007331322 123
58 3300005577 Ga0068857_100030650 Ga0068857_1000306503 123
59 3300005614 Ga0068856_100102200 Ga0068856_1001022004 123
60 3300005615 Ga0070702_100870577 Ga0070702_1008705771 123
61 3300005616 Ga0068852_101514929 Ga0068852_1015149292 123
62 3300005617 Ga0068859_101572724 Ga0068859_1015727242 123
63 3300005618 Ga0068864_100043985 Ga0068864_1000439855 123
64 3300005618 Ga0068864_100179496 Ga0068864_1001794962 123
65 3300005718 Ga0068866_10036795 Ga0068866_100367953 123
66 3300005718 Ga0068866_10099714 Ga0068866_100997142 123
67 3300005719 Ga0068861_100634153 Ga0068861_1006341532 123
68 3300005834 Ga0068851_10290148 Ga0068851_102901482 123
69 3300005840 Ga0068870_10311103 Ga0068870_103111032 123
70 3300005840 Ga0068870_10939952 Ga0068870_109399521 123
71 3300005842 Ga0068858_100008177 Ga0068858_10000817715 123
72 3300005843 Ga0068860_100580133 Ga0068860_1005801332 123
73 3300006237 Ga0097621_100003892 Ga0097621_1000038925 123
74 3300006237 Ga0097621_100421140 Ga0097621_1004211402 123
75 3300006237 Ga0097621_101259579 Ga0097621_1012595792 123
76 3300006237 Ga0097621_102381752 Ga0097621_1023817521 123
77 3300006358 Ga0068871_100003982 Ga0068871_1000039825 123
78 3300006358 Ga0068871_100028289 Ga0068871_1000282896 123
79 3300006358 Ga0068871_100528112 Ga0068871_1005281122 123
80 3300006358 Ga0068871_100592243 Ga0068871_1005922432 123
81 3300006881 Ga0068865_100080839 Ga0068865_1000808392 123
82 3300006931 Ga0097620_101572590 Ga0097620_1015725902 123
83 3300009093 Ga0105240_10061836 Ga0105240_100618366 123
84 3300009093 Ga0105240_10464009 Ga0105240_104640092 123
85 3300009093 Ga0105240_11040613 Ga0105240_110406132 123
86 3300009098 Ga0105245_10274118 Ga0105245_102741182 123
87 3300009098 Ga0105245_10448205 Ga0105245_104482052 123
88 3300009148 Ga0105243_10005642 Ga0105243_100056425 123
89 3300009174 Ga0105241_10022396 Ga0105241_100223962 123
90 3300009174 Ga0105241_10608586 Ga0105241_106085862 123
91 3300009176 Ga0105242_10035801 Ga0105242_100358013 123
92 3300009176 Ga0105242_10145967 Ga0105242_101459672 123
93 3300009176 Ga0105242_10270749 Ga0105242_102707492 123
94 3300009176 Ga0105242_10545078 Ga0105242_105450782 123
95 3300009176 Ga0105242_10768305 Ga0105242_107683052 123
96 3300009177 Ga0105248_12438989 Ga0105248_124389892 123
97 3300009545 Ga0105237_10337894 Ga0105237_103378942 123
98 3300009551 Ga0105238_10101952 Ga0105238_101019524 123
99 3300009551 Ga0105238_10412448 Ga0105238_104124482 123
100 3300009551 Ga0105238_10844496 Ga0105238_108444962 123
101 3300009553 Ga0105249_10688862 Ga0105249_106888621 123
102 3300009553 Ga0105249_12494353 Ga0105249_124943532 123
103 3300010375 Ga0105239_10208885 Ga0105239_102088851 123
104 3300010375 Ga0105239_10847979 Ga0105239_108479792 123
105 3300011119 Ga0105246_10003749 Ga0105246_1000374913 123
106 3300013100 Ga0157373_11030602 Ga0157373_110306022 123
107 3300013100 Ga0157373_11157243 Ga0157373_111572432 123
108 3300013105 Ga0157369_10412214 Ga0157369_104122141 123
109 3300013296 Ga0157374_10063664 Ga0157374_100636644 123
110 3300013296 Ga0157374_10269166 Ga0157374_102691662 123
111 3300013296 Ga0157374_10505371 Ga0157374_105053712 123
112 3300013296 Ga0157374_10596616 Ga0157374_105966162 123
113 3300013296 Ga0157374_11283738 Ga0157374_112837382 123
114 3300013297 Ga0157378_10085784 Ga0157378_100857844 123
115 3300013297 Ga0157378_10669223 Ga0157378_106692232 123
116 3300013297 Ga0157378_10742643 Ga0157378_107426432 123
117 3300013306 Ga0163162_10305069 Ga0163162_103050692 123
118 3300013306 Ga0163162_10384691 Ga0163162_103846912 123
119 3300013307 Ga0157372_10072243 Ga0157372_100722432 123
120 3300013308 Ga0157375_10220642 Ga0157375_102206422 123
121 3300014325 Ga0163163_10091996 Ga0163163_100919963 123
122 3300014325 Ga0163163_10253747 Ga0163163_102537472 123
123 3300014325 Ga0163163_10417755 Ga0163163_104177552 123
124 3300014968 Ga0157379_11825114 Ga0157379_118251142 123
125 3300014968 Ga0157379_11942618 Ga0157379_119426182 123
126 3300014969 Ga0157376_10136195 Ga0157376_101361952 123
127 3300014969 Ga0157376_10510289 Ga0157376_105102892 123
128 3300017792 Ga0163161_10094633 Ga0163161_100946332 123
129 3300025899 Ga0207642_10082177 Ga0207642_100821772 123
130 3300025901 Ga0207688_10024170 Ga0207688_100241703 123
131 3300025903 Ga0207680_10366276 Ga0207680_103662761 123
132 3300025907 Ga0207645_10043723 Ga0207645_100437234 123
133 3300025908 Ga0207643_10121739 Ga0207643_101217392 123
134 3300025909 Ga0207705_10015982 Ga0207705_100159822 123
135 3300025911 Ga0207654_10068962 Ga0207654_100689622 123
136 3300025911 Ga0207654_10084159 Ga0207654_100841592 123
137 3300025912 Ga0207707_10282950 Ga0207707_102829502 123
138 3300025913 Ga0207695_10181050 Ga0207695_101810502 123
139 3300025913 Ga0207695_10226228 Ga0207695_102262283 123
140 3300025913 Ga0207695_10480677 Ga0207695_104806772 123
141 3300025914 Ga0207671_10375327 Ga0207671_103753272 123
142 3300025917 Ga0207660_10134048 Ga0207660_101340482 123
143 3300025919 Ga0207657_10313682 Ga0207657_103136822 123
144 3300025920 Ga0207649_10275805 Ga0207649_102758052 123
145 3300025920 Ga0207649_10777888 Ga0207649_107778882 123
146 3300025921 Ga0207652_10123686 Ga0207652_101236862 123
147 3300025924 Ga0207694_10040659 Ga0207694_100406592 123
148 3300025924 Ga0207694_10708269 Ga0207694_107082692 123
149 3300025924 Ga0207694_11023582 Ga0207694_110235822 123
150 3300025924 Ga0207694_11415852 Ga0207694_114158522 123
151 3300025925 Ga0207650_10570214 Ga0207650_105702142 123
152 3300025925 Ga0207650_11775456 Ga0207650_117754562 123
153 3300025926 Ga0207659_10921638 Ga0207659_109216381 123
154 3300025927 Ga0207687_10054264 Ga0207687_100542644 123
155 3300025927 Ga0207687_10231042 Ga0207687_102310422 123
156 3300025927 Ga0207687_10389791 Ga0207687_103897912 123
157 3300025928 Ga0207700_10265784 Ga0207700_102657842 123
158 3300025931 Ga0207644_10399798 Ga0207644_103997982 123
159 3300025931 Ga0207644_10941585 Ga0207644_109415852 123
160 3300025932 Ga0207690_10317910 Ga0207690_103179102 123
161 3300025933 Ga0207706_10038019 Ga0207706_100380193 123
162 3300025934 Ga0207686_10003934 Ga0207686_100039344 123
163 3300025934 Ga0207686_10027553 Ga0207686_100275535 123
164 3300025934 Ga0207686_10113505 Ga0207686_101135052 123
165 3300025934 Ga0207686_10217991 Ga0207686_102179912 123
166 3300025934 Ga0207686_10517660 Ga0207686_105176602 123
167 3300025935 Ga0207709_10001826 Ga0207709_1000182617 123
168 3300025935 Ga0207709_10744591 Ga0207709_107445912 123
169 3300025936 Ga0207670_10086639 Ga0207670_100866391 123
170 3300025937 Ga0207669_10053800 Ga0207669_100538003 123
171 3300025937 Ga0207669_10170662 Ga0207669_101706622 123
172 3300025938 Ga0207704_10041056 Ga0207704_100410562 123
173 3300025940 Ga0207691_10166506 Ga0207691_101665061 123
174 3300025942 Ga0207689_10133362 Ga0207689_101333622 123
175 3300025942 Ga0207689_11106372 Ga0207689_111063722 123
176 3300025945 Ga0207679_10341627 Ga0207679_103416272 123
177 3300025945 Ga0207679_10595298 Ga0207679_105952982 123
178 3300025945 Ga0207679_11139612 Ga0207679_111396122 123
179 3300025949 Ga0207667_10435528 Ga0207667_104355282 123
180 3300025960 Ga0207651_10026303 Ga0207651_100263032 123
181 3300025961 Ga0207712_11117401 Ga0207712_111174012 123
182 3300025961 Ga0207712_11165482 Ga0207712_111654822 123
183 3300025986 Ga0207658_10125924 Ga0207658_101259242 123
184 3300026023 Ga0207677_10024943 Ga0207677_100249434 123
185 3300026023 Ga0207677_11113140 Ga0207677_111131402 123
186 3300026035 Ga0207703_10093920 Ga0207703_100939202 123
187 3300026041 Ga0207639_11514538 Ga0207639_115145382 123
188 3300026078 Ga0207702_10256300 Ga0207702_102563002 123
189 3300026089 Ga0207648_10561002 Ga0207648_105610021 123
190 3300026095 Ga0207676_10083186 Ga0207676_100831862 123
191 3300026116 Ga0207674_10027878 Ga0207674_100278784 123
192 3300026116 Ga0207674_10498564 Ga0207674_104985642 123
193 3300026118 Ga0207675_100097291 Ga0207675_1000972912 123
194 3300026121 Ga0207683_10006426 Ga0207683_100064267 123
195 3300026121 Ga0207683_10042913 Ga0207683_100429134 123
196 3300026121 Ga0207683_10134549 Ga0207683_101345492 123
197 3300026121 Ga0207683_10163010 Ga0207683_101630103 123
198 3300026142 Ga0207698_11386198 Ga0207698_113861981 123
199 3300028379 Ga0268266_10000557 Ga0268266_1000055733 123
200 3300028379 Ga0268266_10113035 Ga0268266_101130352 123
201 3300028379 Ga0268266_10181559 Ga0268266_101815592 123
202 3300028379 Ga0268266_10185118 Ga0268266_101851182 123
203 3300028379 Ga0268266_10226754 Ga0268266_102267543 123
204 3300028381 Ga0268264_10090595 Ga0268264_100905953 123
205 3300028577 Ga0265318_10154165 Ga0265318_101541652 123
206 3300028800 Ga0265338_10002896 Ga0265338_1000289615 123
207 3300031238 Ga0265332_10011969 Ga0265332_100119692 123
208 3300031247 Ga0265340_10132588 Ga0265340_101325882 123
209 3300031456 Ga0307513_10836906 Ga0307513_108369062 123
210 3300031711 Ga0265314_10055017 Ga0265314_100550172 123
211 3300039437 Ga0436365_1372302 Ga0436365_1372302_794_1171 123
212 3300041512 Ga0451853_3472860 Ga0451853_3472860_60_437 123
213 3300042005 Ga0439448_0301002 Ga0439448_0301002_61_432 123
214 3300046507 Ga0495606_0361899 Ga0495606_0361899_122_499 123
215 3300046543 Ga0495645_0700909 Ga0495645_0700909_41_418 123
216 3300046809 Ga0495600_0779257 Ga0495600_0779257_102_479 123
217 3300047320 Ga0495672_0424524 Ga0495672_0424524_210_587 123
218 3300047470 Ga0495681_0159656 Ga0495681_0159656_494_871 123
219 3300049570 Ga0501033_0007458 Ga0501033_0007458_6436_6813 123
220 3300049572 Ga0501036_0892689 Ga0501036_0892689_264_641 123
221 3300049581 Ga0501047_0029471 Ga0501047_0029471_1335_1712 123
222 3300049589 Ga0501073_0209306 Ga0501073_0209306_90_470 123
223 3300049742 Ga0501080_0777524 Ga0501080_0777524_138_515 123
224 3300049822 Ga0501035_0020021 Ga0501035_0020021_3126_3503 123
225 3300049822 Ga0501035_0977151 Ga0501035_0977151_70_447 123
226 3300049823 Ga0501044_0086595 Ga0501044_0086595_1639_2016 123
227 3300053087 Ga0500643_000003 Ga0500643_000003_40132_40512 123
228 3300053090 Ga0500646_0236377 Ga0500646_0236377_84_464 123
229 3300053098 Ga0500650_0293273 Ga0500650_0293273_259_636 123
230 3300053139 Ga0500568_0009719 Ga0500568_0009719_295_675 123
231 3300053139 Ga0500568_0034754 Ga0500568_0034754_719_1096 123
232 3300053730 Ga0500645_017595 Ga0500645_017595_1546_1923 123
233 3300053730 Ga0500645_225534 Ga0500645_225534_66_446 123
234 3300054114 Ga0501084_0148809 Ga0501084_0148809_203_583 123
235 3300028800 Ga0265338_10305688 Ga0265338_103056882 124
236 3300031241 Ga0265325_10005867 Ga0265325_100058676 124
237 3300031249 Ga0265339_10045533 Ga0265339_100455333 124
238 3300031250 Ga0265331_10054096 Ga0265331_100540962 124
239 3300031595 Ga0265313_10024969 Ga0265313_100249693 124
240 3300031712 Ga0265342_10182712 Ga0265342_101827122 124
241 3300049581 Ga0501047_0924236 Ga0501047_0924236_255_632 124
242 3300021384 Ga0213876_10000421 Ga0213876_1000042142 125
243 3300036401 Ga0373937_0285465 Ga0373937_0285465_545_922 125
244 3300041486 Ga0451807_2121146 Ga0451807_2121146_145_528 125
245 3300046511 Ga0495608_0580412 Ga0495608_0580412_176_553 125
246 3300046559 Ga0495667_0796819 Ga0495667_0796819_160_537 125
247 3300047471 Ga0495684_0859635 Ga0495684_0859635_180_557 125
248 3300005329 Ga0070683_100283802 Ga0070683_1002838022 126
249 3300005329 Ga0070683_100525329 Ga0070683_1005253292 126
250 3300005341 Ga0070691_10000485 Ga0070691_1000048513 126
251 3300005434 Ga0070709_10003897 Ga0070709_100038979 126
252 3300005435 Ga0070714_100172470 Ga0070714_1001724702 126
253 3300005436 Ga0070713_100000012 Ga0070713_100000012144 126
254 3300005436 Ga0070713_100894940 Ga0070713_1008949401 126
255 3300005437 Ga0070710_10095001 Ga0070710_100950012 126
256 3300005439 Ga0070711_100136996 Ga0070711_1001369962 126
257 3300005459 Ga0068867_101406293 Ga0068867_1014062932 126
258 3300005518 Ga0070699_100824848 Ga0070699_1008248482 126
259 3300005530 Ga0070679_100302715 Ga0070679_1003027152 126
260 3300005539 Ga0068853_100005952 Ga0068853_1000059528 126
261 3300005547 Ga0070693_100032363 Ga0070693_1000323631 126
262 3300005548 Ga0070665_100154409 Ga0070665_1001544092 126
263 3300005548 Ga0070665_101171742 Ga0070665_1011717422 126
264 3300005563 Ga0068855_101746548 Ga0068855_1017465482 126
265 3300005564 Ga0070664_100561302 Ga0070664_1005613022 126
266 3300005577 Ga0068857_100002087 Ga0068857_10000208711 126
267 3300005578 Ga0068854_100117393 Ga0068854_1001173932 126
268 3300005614 Ga0068856_100001032 Ga0068856_10000103231 126
269 3300005614 Ga0068856_100002049 Ga0068856_10000204915 126
270 3300005614 Ga0068856_102187543 Ga0068856_1021875431 126
271 3300005616 Ga0068852_100345624 Ga0068852_1003456242 126
272 3300005841 Ga0068863_100541999 Ga0068863_1005419991 126
273 3300006163 Ga0070715_10190134 Ga0070715_101901341 126
274 3300006175 Ga0070712_100000821 Ga0070712_10000082113 126
275 3300006175 Ga0070712_100000902 Ga0070712_10000090230 126
276 3300006237 Ga0097621_101015728 Ga0097621_1010157282 126
277 3300006237 Ga0097621_101230314 Ga0097621_1012303141 126
278 3300006237 Ga0097621_102418502 Ga0097621_1024185021 126
279 3300006358 Ga0068871_100303926 Ga0068871_1003039262 126
280 3300006871 Ga0075434_100010318 Ga0075434_1000103185 126
281 3300006871 Ga0075434_100038090 Ga0075434_1000380905 126
282 3300006914 Ga0075436_100001059 Ga0075436_1000010598 126
283 3300006914 Ga0075436_100100081 Ga0075436_1001000812 126
284 3300007076 Ga0075435_100031942 Ga0075435_1000319422 126
285 3300007076 Ga0075435_100123028 Ga0075435_1001230282 126
286 3300009093 Ga0105240_10029762 Ga0105240_100297629 126
287 3300009093 Ga0105240_10088284 Ga0105240_100882842 126
288 3300009174 Ga0105241_10057112 Ga0105241_100571123 126
289 3300009174 Ga0105241_10120305 Ga0105241_101203052 126
290 3300009176 Ga0105242_10561247 Ga0105242_105612472 126
291 3300009545 Ga0105237_10003253 Ga0105237_100032539 126
292 3300009551 Ga0105238_10001939 Ga0105238_1000193931 126
293 3300009551 Ga0105238_10160630 Ga0105238_101606303 126
294 3300010375 Ga0105239_10305613 Ga0105239_103056132 126
295 3300010375 Ga0105239_10601472 Ga0105239_106014722 126
296 3300013100 Ga0157373_10000820 Ga0157373_100008208 126
297 3300013104 Ga0157370_10003448 Ga0157370_100034482 126
298 3300013105 Ga0157369_10001535 Ga0157369_1000153531 126
299 3300013296 Ga0157374_10084367 Ga0157374_100843672 126
300 3300013296 Ga0157374_10565034 Ga0157374_105650342 126
301 3300013297 Ga0157378_10975084 Ga0157378_109750842 126
302 3300013306 Ga0163162_10282879 Ga0163162_102828791 126
303 3300013307 Ga0157372_10008268 Ga0157372_100082682 126
304 3300013307 Ga0157372_10481087 Ga0157372_104810872 126
305 3300014325 Ga0163163_10475236 Ga0163163_104752362 126
306 3300014968 Ga0157379_10034193 Ga0157379_100341934 126
307 3300014968 Ga0157379_10039502 Ga0157379_100395025 126
308 3300014969 Ga0157376_10272893 Ga0157376_102728932 126
309 3300015262 Ga0182007_10172631 Ga0182007_101726311 126
310 3300025905 Ga0207685_10087251 Ga0207685_100872512 126
311 3300025906 Ga0207699_10000164 Ga0207699_100001649 126
312 3300025911 Ga0207654_10132026 Ga0207654_101320262 126
313 3300025911 Ga0207654_11082679 Ga0207654_110826792 126
314 3300025913 Ga0207695_10053555 Ga0207695_100535554 126
315 3300025913 Ga0207695_10077288 Ga0207695_100772884 126
316 3300025914 Ga0207671_10090587 Ga0207671_100905872 126
317 3300025915 Ga0207693_10001210 Ga0207693_100012106 126
318 3300025915 Ga0207693_10001929 Ga0207693_100019292 126
319 3300025916 Ga0207663_10206736 Ga0207663_102067362 126
320 3300025917 Ga0207660_10189836 Ga0207660_101898362 126
321 3300025919 Ga0207657_11122084 Ga0207657_111220842 126
322 3300025924 Ga0207694_10012134 Ga0207694_100121343 126
323 3300025924 Ga0207694_10353009 Ga0207694_103530092 126
324 3300025928 Ga0207700_10000295 Ga0207700_1000029531 126
325 3300025928 Ga0207700_10376335 Ga0207700_103763352 126
326 3300025934 Ga0207686_11481221 Ga0207686_114812211 126
327 3300025939 Ga0207665_10724415 Ga0207665_107244151 126
328 3300025944 Ga0207661_10232516 Ga0207661_102325163 126
329 3300025944 Ga0207661_10455637 Ga0207661_104556372 126
330 3300025949 Ga0207667_10012207 Ga0207667_100122075 126
331 3300025949 Ga0207667_11318108 Ga0207667_113181081 126
332 3300025961 Ga0207712_10775356 Ga0207712_107753561 126
333 3300026035 Ga0207703_10550737 Ga0207703_105507371 126
334 3300026041 Ga0207639_10212380 Ga0207639_102123802 126
335 3300026078 Ga0207702_10000315 Ga0207702_1000031520 126
336 3300026088 Ga0207641_11512924 Ga0207641_115129241 126
337 3300026089 Ga0207648_10471701 Ga0207648_104717011 126
338 3300026095 Ga0207676_11303547 Ga0207676_113035472 126
339 3300026116 Ga0207674_10001605 Ga0207674_1000160510 126
340 3300026142 Ga0207698_10284618 Ga0207698_102846182 126
341 3300028379 Ga0268266_10086409 Ga0268266_100864093 126
342 3300028379 Ga0268266_10948820 Ga0268266_109488202 126
343 3300028379 Ga0268266_11133673 Ga0268266_111336732 126
344 3300028800 Ga0265338_10100342 Ga0265338_101003422 126
345 3300028800 Ga0265338_10588172 Ga0265338_105881722 126
346 3300031235 Ga0265330_10052374 Ga0265330_100523742 126
347 3300031235 Ga0265330_10266307 Ga0265330_102663072 126
348 3300031239 Ga0265328_10236743 Ga0265328_102367431 126
349 3300031241 Ga0265325_10000782 Ga0265325_1000078218 126
350 3300031247 Ga0265340_10153638 Ga0265340_101536382 126
351 3300031249 Ga0265339_10006891 Ga0265339_100068912 126
352 3300031249 Ga0265339_10031743 Ga0265339_100317432 126
353 3300031249 Ga0265339_10222319 Ga0265339_102223192 126
354 3300031250 Ga0265331_10000186 Ga0265331_1000018661 126
355 3300031250 Ga0265331_10002324 Ga0265331_1000232411 126
356 3300031251 Ga0265327_10299933 Ga0265327_102999332 126
357 3300031344 Ga0265316_10035280 Ga0265316_100352802 126
358 3300031344 Ga0265316_10409036 Ga0265316_104090361 126
359 3300031344 Ga0265316_10473663 Ga0265316_104736632 126
360 3300031595 Ga0265313_10210547 Ga0265313_102105472 126
361 3300031712 Ga0265342_10086818 Ga0265342_100868182 126
362 3300031712 Ga0265342_10094831 Ga0265342_100948312 126
363 3300031712 Ga0265342_10125861 Ga0265342_101258612 126
364 3300035086 Ga0373934_0338399 Ga0373934_0338399_185_565 126
365 3300035172 Ga0373955_0974949 Ga0373955_0974949_33_413 126
366 3300035692 Ga0373935_0014263 Ga0373935_0014263_3436_3816 126
367 3300035724 Ga0373933_0110894 Ga0373933_0110894_591_971 126
368 3300036401 Ga0373937_0002620 Ga0373937_0002620_14295_14675 126
369 3300036401 Ga0373937_0378486 Ga0373937_0378486_803_1183 126
370 3300036401 Ga0373937_0457539 Ga0373937_0457539_128_514 126
371 3300036401 Ga0373937_0891862 Ga0373937_0891862_344_724 126
372 3300037068 Ga0373925_0316435 Ga0373925_0316435_129_509 126
373 3300037068 Ga0373925_0529491 Ga0373925_0529491_410_790 126
374 3300046472 Ga0495580_0383602 Ga0495580_0383602_109_489 126
375 3300046507 Ga0495606_0129995 Ga0495606_0129995_256_642 126
376 3300046536 Ga0495587_0300103 Ga0495587_0300103_387_773 126
377 3300046679 Ga0495623_0307167 Ga0495623_0307167_146_532 126
378 3300048088 Ga0495602_0027947 Ga0495602_0027947_1076_1462 126
379 3300048088 Ga0495602_0285206 Ga0495602_0285206_404_784 126
380 3300048088 Ga0495602_0459687 Ga0495602_0459687_121_507 126
381 3300048905 Ga0496102_0036697 Ga0496102_0036697_3949_4329 126
382 3300048907 Ga0496104_1265801 Ga0496104_1265801_246_626 126
383 3300048910 Ga0496107_0576114 Ga0496107_0576114_288_668 126
384 3300048912 Ga0496109_1115541 Ga0496109_1115541_161_541 126
385 3300048929 Ga0496126_0000480 Ga0496126_0000480_33509_33901 126
386 3300049570 Ga0501033_0073466 Ga0501033_0073466_28_414 126
387 3300049571 Ga0501034_0482684 Ga0501034_0482684_597_983 126
388 3300049579 Ga0501043_0079029 Ga0501043_0079029_2126_2512 126
389 3300049581 Ga0501047_0073866 Ga0501047_0073866_1440_1826 126
390 3300049742 Ga0501080_0095027 Ga0501080_0095027_1292_1678 126
391 3300049822 Ga0501035_0070491 Ga0501035_0070491_1305_1691 126
392 3300049823 Ga0501044_0021397 Ga0501044_0021397_1733_2119 126
393 3300050512 nmdc:mga0n895_37478_c1 nmdc:mga0n895_37478_c1_1168_1548 126
394 3300050512 nmdc:mga0n895_58873_c1 nmdc:mga0n895_58873_c1_2797_3177 126
395 3300050513 nmdc:mga0rr50_136425_c1 nmdc:mga0rr50_136425_c1_1452_1832 126
396 3300050513 nmdc:mga0rr50_152642_c1 nmdc:mga0rr50_152642_c1_1190_1570 126
397 3300050514 nmdc:mga08x19_177_c1 nmdc:mga08x19_177_c1_5149_5529 126
398 3300050514 nmdc:mga08x19_91143_c1 nmdc:mga08x19_91143_c1_155_535 126

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02537

CRCB

CrcB-like protein, Camphor Resistance (CrcB)

7

116

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5a40-assembly2.cif.gz_C crystal structure of a dual topology fluoride ion channel. 0.9282 2 125
6bqo-assembly2.cif.gz_B-2 structure of a dual topology fluoride channel with monobody s8 0.9227 2 126
6bqo-assembly1.cif.gz_A structure of a dual topology fluoride channel with monobody s8 0.9226 2 125
6bx5-assembly1.cif.gz_A the crystal structure of fluoride channel fluc ec2 with monobody s12 0.9208 2 125
5a43-assembly1.cif.gz_B crystal structure of a dual topology fluoride ion channel. 0.92 2 125
ID Description Score Start End Superfamily
af_Q2FXE6_4_114_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9157 8 119 1.10.287.70
af_P9WP61_13_121_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9135 8 119 1.10.287.70
af_P37002_6_119_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9074 8 121 1.10.287.70
af_Q58918_7_116_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9047 9 119 1.10.287.70
af_P9WP63_10_123_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9017 8 120 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A2E7HMT0-F1-model_v4 Fluoride-specific ion channel FluC 0.9584 2 125 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A7K2RV55-F1-model_v4 deleted 0.9582 2 124
AF-A0A4S2UUV9-F1-model_v4 Fluoride-specific ion channel FluC 0.9577 5 124 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A212KMN6-F1-model_v4 Fluoride-specific ion channel FluC 0.9574 1 124 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A1C5DPZ2-F1-model_v4 Fluoride-specific ion channel FluC 0.9572 5 124 GO:0005886
GO:0046872
GO:0062054
GO:0140114

Feature Viewer

pLDDT pTM Quality
93.77 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map