F433884
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 397 | 297 | 382 | 192 |
Family's Representative Sequence
| Representative Sequence | 3300049589|Ga0501073_0000025|Ga0501073_0000025_48525_49172 |
| Length | 215 |
| Sequence | MSSNVGSSDDRRPLPKGTPVSEVRIAIVLGSTRPGRRGEAVARWVLEQATARGDAHYELVDLADFPLPHLDEPMPPSAGRYEYEHTKTWSDKIDDFDGFVFVTPEYNHAPSGVLKNALDYLYAEWNDKAAGIVSYGVAASGLRAAEALRPILGELQIADVRQSVGISLIHDFENFTTFVPGPQHAQQLGVQLDQVLAWSAALRGVRETKAALAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221676 | Paenibacillus sp. Root444D2 | Isolate | Unclassified |
| 2 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 3 | 2816332186 | Peribacillus frigoritolerans 3612 | Isolate | Unclassified |
| 4 | 2842682962 | Bacillus sp. R-72492 | Isolate | Unclassified |
| 5 | 2849139964 | Bacillus sp. R-71875 | Isolate | Unclassified |
| 6 | 2852643534 | Leifsonia sp. AK011 | Isolate | Rhizosphere |
| 7 | 2857581216 | Bacillus sp. R-71922 | Isolate | Unclassified |
| 8 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 9 | 2980182181 | Paenibacillus cymbidii R196 | Isolate | Unclassified |
| 10 | 3001267043 | Bacillus sp. FJAT-49870 | Isolate | Rhizosphere |
| 11 | 3006978542 | Bacillus sp. FJAT-49705 | Isolate | Rhizosphere |
| 12 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 107 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 111 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 112 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 170 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 171 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 172 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 173 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 174 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 175 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 176 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 177 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 178 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 179 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 180 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 181 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 182 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 183 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 186 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 187 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 189 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 190 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 192 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 195 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 198 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 199 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 200 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 202 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 203 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 204 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 205 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 206 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 207 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 208 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 209 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 210 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 211 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 212 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 213 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 214 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 215 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 258 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 259 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 260 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 261 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 262 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 265 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 266 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 267 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 268 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 269 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 270 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 271 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 286 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 294 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 295 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 296 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 297 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.46 |
| Metatranscriptomes | 1.76 |
| Isolates | 3.78 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.02 |
| Nodule | 0 |
| Rhizoplane | 7.56 |
| Rhizosphere | 85.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055540_1011397 | 3300003792 | Bacteria | 2870 |
| 2 | Ga0055540_1013120 | 3300003792 | Bacteria | 2551 |
| 3 | Ga0070690_100114210 | 3300005330 | Bacteria | 1805 |
| 4 | Ga0068869_100191231 | 3300005334 | Bacteria | 1609 |
| 5 | Ga0068869_100206505 | 3300005334 | Bacteria | 1551 |
| 6 | Ga0070666_10051337 | 3300005335 | Bacteria | 2776 |
| 7 | Ga0070680_100472018 | 3300005336 | Bacteria | 1072 |
| 8 | Ga0070682_100067290 | 3300005337 | Bacteria | 2281 |
| 9 | Ga0070682_100261149 | 3300005337 | Bacteria | 1253 |
| 10 | Ga0068868_100125880 | 3300005338 | Bacteria | 2093 |
| 11 | Ga0068868_100439631 | 3300005338 | Bacteria | 1132 |
| 12 | Ga0070660_100088431 | 3300005339 | Bacteria | 2440 |
| 13 | Ga0070689_100103663 | 3300005340 | Bacteria | 2255 |
| 14 | Ga0070691_10024694 | 3300005341 | Bacteria | 2794 |
| 15 | Ga0070687_100108870 | 3300005343 | Bacteria | 1565 |
| 16 | Ga0070668_100014989 | 3300005347 | Bacteria | 5790 |
| 17 | Ga0070669_100155547 | 3300005353 | Bacteria | 1773 |
| 18 | Ga0070669_100388290 | 3300005353 | Bacteria | 1140 |
| 19 | Ga0070671_100159750 | 3300005355 | Bacteria | 1905 |
| 20 | Ga0070674_100228335 | 3300005356 | Bacteria | 1451 |
| 21 | Ga0070673_100396287 | 3300005364 | Bacteria | 1234 |
| 22 | Ga0070688_100077560 | 3300005365 | Bacteria | 2141 |
| 23 | Ga0070667_100557469 | 3300005367 | Bacteria | 1054 |
| 24 | Ga0070709_10021462 | 3300005434 | Bacteria | 3761 |
| 25 | Ga0070709_10240983 | 3300005434 | Bacteria | 1298 |
| 26 | Ga0070714_100104270 | 3300005435 | Bacteria | 2502 |
| 27 | Ga0070714_100307187 | 3300005435 | Bacteria | 1480 |
| 28 | Ga0070713_100124028 | 3300005436 | Bacteria | 2269 |
| 29 | Ga0070711_100067228 | 3300005439 | Bacteria | 2513 |
| 30 | Ga0070711_100084035 | 3300005439 | Bacteria | 2276 |
| 31 | Ga0070711_100830001 | 3300005439 | Bacteria | 785 |
| 32 | Ga0070705_100078371 | 3300005440 | Bacteria | 2021 |
| 33 | Ga0070705_100143295 | 3300005440 | Bacteria | 1575 |
| 34 | Ga0070700_100091882 | 3300005441 | Bacteria | 1983 |
| 35 | Ga0070700_100370815 | 3300005441 | Bacteria | 1067 |
| 36 | Ga0070694_100132076 | 3300005444 | Bacteria | 1805 |
| 37 | Ga0070694_100235745 | 3300005444 | Bacteria | 1378 |
| 38 | Ga0070708_100080459 | 3300005445 | Bacteria | 2948 |
| 39 | Ga0070708_100183446 | 3300005445 | Bacteria | 1956 |
| 40 | Ga0070708_100468482 | 3300005445 | Bacteria | 1188 |
| 41 | Ga0070678_100050634 | 3300005456 | Bacteria | 3006 |
| 42 | Ga0070706_100002761 | 3300005467 | Bacteria | 17559 |
| 43 | Ga0070706_100054694 | 3300005467 | Bacteria | 3684 |
| 44 | Ga0070706_100099188 | 3300005467 | Bacteria | 2706 |
| 45 | Ga0070706_100947258 | 3300005467 | Bacteria | 794 |
| 46 | Ga0070707_100051129 | 3300005468 | Bacteria | 3961 |
| 47 | Ga0070707_100148457 | 3300005468 | Bacteria | 2282 |
| 48 | Ga0070698_100033337 | 3300005471 | Bacteria | 5335 |
| 49 | Ga0070698_100229798 | 3300005471 | Bacteria | 1788 |
| 50 | Ga0070699_100003018 | 3300005518 | Bacteria | 14944 |
| 51 | Ga0070699_100020184 | 3300005518 | Bacteria | 5743 |
| 52 | Ga0070679_100490385 | 3300005530 | Bacteria | 1173 |
| 53 | Ga0070684_100081345 | 3300005535 | Bacteria | 2866 |
| 54 | Ga0068853_100020256 | 3300005539 | Bacteria | 5530 |
| 55 | Ga0068853_100405521 | 3300005539 | Bacteria | 1277 |
| 56 | Ga0070672_100176705 | 3300005543 | Bacteria | 1778 |
| 57 | Ga0070686_100159182 | 3300005544 | Bacteria | 1589 |
| 58 | Ga0070695_100230901 | 3300005545 | Bacteria | 1337 |
| 59 | Ga0070695_100400328 | 3300005545 | Bacteria | 1041 |
| 60 | Ga0070696_100039880 | 3300005546 | Bacteria | 3242 |
| 61 | Ga0070665_100723349 | 3300005548 | Bacteria | 1008 |
| 62 | Ga0070704_100021889 | 3300005549 | Bacteria | 4152 |
| 63 | Ga0070704_100071067 | 3300005549 | Bacteria | 2527 |
| 64 | Ga0068855_100966029 | 3300005563 | Bacteria | 897 |
| 65 | Ga0070664_100180196 | 3300005564 | Bacteria | 1877 |
| 66 | Ga0068854_100693948 | 3300005578 | Bacteria | 878 |
| 67 | Ga0068856_100332749 | 3300005614 | Bacteria | 1536 |
| 68 | Ga0068859_100176273 | 3300005617 | Bacteria | 2220 |
| 69 | Ga0068859_101408106 | 3300005617 | Bacteria | 769 |
| 70 | Ga0068864_100017718 | 3300005618 | Bacteria | 5941 |
| 71 | Ga0068864_100233064 | 3300005618 | Bacteria | 1703 |
| 72 | Ga0068866_10221520 | 3300005718 | Bacteria | 1142 |
| 73 | Ga0068861_100486916 | 3300005719 | Bacteria | 1112 |
| 74 | Ga0068870_10060397 | 3300005840 | Bacteria | 2035 |
| 75 | Ga0068870_10082960 | 3300005840 | Bacteria | 1776 |
| 76 | Ga0068863_100151286 | 3300005841 | Bacteria | 2220 |
| 77 | Ga0068858_100188101 | 3300005842 | Bacteria | 1951 |
| 78 | Ga0068860_100135601 | 3300005843 | Bacteria | 2364 |
| 79 | Ga0068860_100860561 | 3300005843 | Bacteria | 921 |
| 80 | Ga0068862_100590995 | 3300005844 | Bacteria | 1065 |
| 81 | Ga0081539_10002869 | 3300005985 | Bacteria | 22908 |
| 82 | Ga0070717_10170516 | 3300006028 | Bacteria | 1892 |
| 83 | Ga0070717_10329539 | 3300006028 | Bacteria | 1362 |
| 84 | Ga0075364_10320044 | 3300006051 | Bacteria | 1056 |
| 85 | Ga0075432_10204530 | 3300006058 | Bacteria | 783 |
| 86 | Ga0070715_10042508 | 3300006163 | Bacteria | 1911 |
| 87 | Ga0070712_100555861 | 3300006175 | Bacteria | 967 |
| 88 | Ga0075367_10006233 | 3300006178 | Bacteria | 6010 |
| 89 | Ga0097621_100225153 | 3300006237 | Bacteria | 1635 |
| 90 | Ga0068871_100169358 | 3300006358 | Bacteria | 1871 |
| 91 | Ga0068871_100207928 | 3300006358 | Bacteria | 1692 |
| 92 | Ga0075433_10129239 | 3300006852 | Bacteria | 2244 |
| 93 | Ga0075434_100090488 | 3300006871 | Bacteria | 3061 |
| 94 | Ga0075434_100103481 | 3300006871 | Bacteria | 2855 |
| 95 | Ga0075434_100199446 | 3300006871 | Bacteria | 2021 |
| 96 | Ga0075434_100811819 | 3300006871 | Bacteria | 951 |
| 97 | Ga0068865_100378701 | 3300006881 | Bacteria | 1154 |
| 98 | Ga0075436_100151733 | 3300006914 | Bacteria | 1631 |
| 99 | Ga0097620_100176282 | 3300006931 | Bacteria | 2220 |
| 100 | Ga0097620_101407943 | 3300006931 | Bacteria | 769 |
| 101 | Ga0075435_100041731 | 3300007076 | Bacteria | 3668 |
| 102 | Ga0105251_10027793 | 3300009011 | Bacteria | 2862 |
| 103 | Ga0105244_10234446 | 3300009036 | Bacteria | 858 |
| 104 | Ga0105240_10137468 | 3300009093 | Bacteria | 2925 |
| 105 | Ga0105240_10902086 | 3300009093 | Bacteria | 951 |
| 106 | Ga0105245_10206796 | 3300009098 | Bacteria | 1887 |
| 107 | Ga0105247_10008906 | 3300009101 | Bacteria | 6115 |
| 108 | Ga0105243_10360844 | 3300009148 | Bacteria | 1337 |
| 109 | Ga0105243_10411304 | 3300009148 | Bacteria | 1259 |
| 110 | Ga0105242_10337516 | 3300009176 | Bacteria | 1388 |
| 111 | Ga0105237_10073882 | 3300009545 | Bacteria | 3401 |
| 112 | Ga0105237_10155215 | 3300009545 | Bacteria | 2285 |
| 113 | Ga0105237_10441591 | 3300009545 | Bacteria | 1307 |
| 114 | Ga0105238_10243135 | 3300009551 | Bacteria | 1777 |
| 115 | Ga0105249_10068027 | 3300009553 | Bacteria | 3284 |
| 116 | Ga0105239_10605428 | 3300010375 | Bacteria | 1250 |
| 117 | Ga0105246_10077066 | 3300011119 | Bacteria | 2364 |
| 118 | Ga0157336_1004856 | 3300012477 | Bacteria | 866 |
| 119 | Ga0157373_10004566 | 3300013100 | Bacteria | 10413 |
| 120 | Ga0157373_10048298 | 3300013100 | Bacteria | 3034 |
| 121 | Ga0157371_10139676 | 3300013102 | Bacteria | 1726 |
| 122 | Ga0157370_10115682 | 3300013104 | Bacteria | 2505 |
| 123 | Ga0157370_10230950 | 3300013104 | Bacteria | 1712 |
| 124 | Ga0157369_10157941 | 3300013105 | Bacteria | 2394 |
| 125 | Ga0157374_10202547 | 3300013296 | Bacteria | 1944 |
| 126 | Ga0163162_10026942 | 3300013306 | Bacteria | 5683 |
| 127 | Ga0157372_10505681 | 3300013307 | Bacteria | 1409 |
| 128 | Ga0157375_10218709 | 3300013308 | Bacteria | 2063 |
| 129 | Ga0157375_10447721 | 3300013308 | Bacteria | 1457 |
| 130 | Ga0163163_10076498 | 3300014325 | Unclassified | 3342 |
| 131 | Ga0163163_10609726 | 3300014325 | Bacteria | 1155 |
| 132 | Ga0157380_10090163 | 3300014326 | Bacteria | 2528 |
| 133 | Ga0157377_10060740 | 3300014745 | Bacteria | 2159 |
| 134 | Ga0157376_10036691 | 3300014969 | Bacteria | 3973 |
| 135 | Ga0163161_10010895 | 3300017792 | Bacteria | 6305 |
| 136 | Ga0206355_1575719 | 3300020076 | Bacteria | 1280 |
| 137 | Ga0206352_10599261 | 3300020078 | Bacteria | 890 |
| 138 | Ga0206354_11181771 | 3300020081 | Bacteria | 1490 |
| 139 | Ga0206353_10695539 | 3300020082 | Bacteria | 1188 |
| 140 | Ga0213874_10127833 | 3300021377 | Bacteria | 870 |
| 141 | Ga0213875_10000715 | 3300021388 | Bacteria | 25429 |
| 142 | Ga0209025_1023365 | 3300025294 | Bacteria | 3234 |
| 143 | Ga0209051_1001324 | 3300025303 | Bacteria | 21635 |
| 144 | Ga0209051_1001675 | 3300025303 | Bacteria | 17855 |
| 145 | Ga0207656_10020351 | 3300025321 | Bacteria | 2637 |
| 146 | Ga0207656_10574599 | 3300025321 | Bacteria | 575 |
| 147 | Ga0207653_10012625 | 3300025885 | Bacteria | 2637 |
| 148 | Ga0207692_10219468 | 3300025898 | Bacteria | 1126 |
| 149 | Ga0207642_10147238 | 3300025899 | Bacteria | 1249 |
| 150 | Ga0207688_10027612 | 3300025901 | Bacteria | 3122 |
| 151 | Ga0207688_10320359 | 3300025901 | Bacteria | 951 |
| 152 | Ga0207680_10287600 | 3300025903 | Bacteria | 1143 |
| 153 | Ga0207680_10366142 | 3300025903 | Bacteria | 1014 |
| 154 | Ga0207647_10037093 | 3300025904 | Bacteria | 3093 |
| 155 | Ga0207685_10023454 | 3300025905 | Bacteria | 2101 |
| 156 | Ga0207699_10033489 | 3300025906 | Bacteria | 2904 |
| 157 | Ga0207699_10076384 | 3300025906 | Bacteria | 2063 |
| 158 | Ga0207643_10024607 | 3300025908 | Bacteria | 3322 |
| 159 | Ga0207684_10004190 | 3300025910 | Bacteria | 13693 |
| 160 | Ga0207684_10006648 | 3300025910 | Bacteria | 10509 |
| 161 | Ga0207684_10269418 | 3300025910 | Bacteria | 1469 |
| 162 | Ga0207684_10655353 | 3300025910 | Bacteria | 894 |
| 163 | Ga0207654_10209783 | 3300025911 | Bacteria | 1287 |
| 164 | Ga0207695_10316068 | 3300025913 | Bacteria | 1451 |
| 165 | Ga0207693_10006578 | 3300025915 | Bacteria | 9620 |
| 166 | Ga0207693_10052776 | 3300025915 | Bacteria | 3189 |
| 167 | Ga0207660_10391228 | 3300025917 | Bacteria | 1118 |
| 168 | Ga0207662_10041543 | 3300025918 | Bacteria | 2708 |
| 169 | Ga0207662_10088089 | 3300025918 | Bacteria | 1906 |
| 170 | Ga0207657_10189019 | 3300025919 | Bacteria | 1662 |
| 171 | Ga0207646_10008232 | 3300025922 | Bacteria | 10472 |
| 172 | Ga0207646_10519426 | 3300025922 | Bacteria | 1072 |
| 173 | Ga0207681_10082819 | 3300025923 | Bacteria | 2269 |
| 174 | Ga0207681_10471505 | 3300025923 | Bacteria | 1024 |
| 175 | Ga0207694_10174943 | 3300025924 | Bacteria | 1739 |
| 176 | Ga0207659_10226515 | 3300025926 | Bacteria | 1506 |
| 177 | Ga0207687_10108686 | 3300025927 | Bacteria | 2054 |
| 178 | Ga0207700_10277344 | 3300025928 | Bacteria | 1441 |
| 179 | Ga0207700_10465924 | 3300025928 | Bacteria | 1115 |
| 180 | Ga0207664_10119539 | 3300025929 | Bacteria | 2203 |
| 181 | Ga0207664_10154494 | 3300025929 | Bacteria | 1952 |
| 182 | Ga0207644_10336104 | 3300025931 | Bacteria | 1224 |
| 183 | Ga0207690_10124776 | 3300025932 | Bacteria | 1876 |
| 184 | Ga0207690_10479440 | 3300025932 | Bacteria | 1004 |
| 185 | Ga0207706_10099129 | 3300025933 | Bacteria | 2563 |
| 186 | Ga0207709_10147934 | 3300025935 | Bacteria | 1623 |
| 187 | Ga0207670_10053420 | 3300025936 | Bacteria | 2722 |
| 188 | Ga0207670_10341054 | 3300025936 | Bacteria | 1184 |
| 189 | Ga0207665_10082356 | 3300025939 | Bacteria | 2217 |
| 190 | Ga0207665_10100065 | 3300025939 | Bacteria | 2022 |
| 191 | Ga0207691_10071527 | 3300025940 | Bacteria | 3130 |
| 192 | Ga0207711_10342929 | 3300025941 | Bacteria | 1383 |
| 193 | Ga0207689_10052504 | 3300025942 | Bacteria | 3359 |
| 194 | Ga0207689_10211196 | 3300025942 | Bacteria | 1603 |
| 195 | Ga0207661_10267765 | 3300025944 | Bacteria | 1524 |
| 196 | Ga0207667_10244838 | 3300025949 | Bacteria | 1834 |
| 197 | Ga0207667_10296367 | 3300025949 | Bacteria | 1652 |
| 198 | Ga0207651_10388049 | 3300025960 | Bacteria | 1185 |
| 199 | Ga0207712_10559389 | 3300025961 | Bacteria | 985 |
| 200 | Ga0207668_10431594 | 3300025972 | Bacteria | 1120 |
| 201 | Ga0207658_10069039 | 3300025986 | Bacteria | 2669 |
| 202 | Ga0207677_10024026 | 3300026023 | Bacteria | 3778 |
| 203 | Ga0207677_10076824 | 3300026023 | Bacteria | 2379 |
| 204 | Ga0207639_10116277 | 3300026041 | Bacteria | 2189 |
| 205 | Ga0207678_10052312 | 3300026067 | Bacteria | 3524 |
| 206 | Ga0207678_10062667 | 3300026067 | Bacteria | 3196 |
| 207 | Ga0207708_10034183 | 3300026075 | Bacteria | 3866 |
| 208 | Ga0207708_10277419 | 3300026075 | Bacteria | 1357 |
| 209 | Ga0207702_10531198 | 3300026078 | Bacteria | 1149 |
| 210 | Ga0207641_10499733 | 3300026088 | Bacteria | 1181 |
| 211 | Ga0207648_10165129 | 3300026089 | Bacteria | 1956 |
| 212 | Ga0207676_10713894 | 3300026095 | Bacteria | 972 |
| 213 | Ga0207674_10018405 | 3300026116 | Bacteria | 7594 |
| 214 | Ga0207675_100049578 | 3300026118 | Bacteria | 3918 |
| 215 | Ga0207675_100606303 | 3300026118 | Bacteria | 1098 |
| 216 | Ga0207683_10016970 | 3300026121 | Bacteria | 6197 |
| 217 | Ga0207683_10023622 | 3300026121 | Bacteria | 5289 |
| 218 | Ga0207698_10170331 | 3300026142 | Bacteria | 1916 |
| 219 | Ga0207698_10638647 | 3300026142 | Bacteria | 1053 |
| 220 | Ga0207428_10672335 | 3300027907 | Bacteria | 742 |
| 221 | Ga0268266_10161985 | 3300028379 | Bacteria | 2025 |
| 222 | Ga0268266_10864195 | 3300028379 | Bacteria | 874 |
| 223 | Ga0268265_10090899 | 3300028380 | Bacteria | 2440 |
| 224 | Ga0268264_10379436 | 3300028381 | Bacteria | 1353 |
| 225 | Ga0307515_10229489 | 3300028794 | Bacteria | 1653 |
| 226 | Ga0307515_10302297 | 3300028794 | Bacteria | 1284 |
| 227 | Ga0307512_10074208 | 3300030522 | Bacteria | 2500 |
| 228 | Ga0307509_10248144 | 3300031507 | Bacteria | 1566 |
| 229 | Ga0307405_10685301 | 3300031731 | Bacteria | 847 |
| 230 | Ga0307518_10379877 | 3300031838 | Bacteria | 802 |
| 231 | Ga0307507_10086550 | 3300033179 | Bacteria | 2716 |
| 232 | Ga0307507_10261694 | 3300033179 | Bacteria | 1103 |
| 233 | Ga0373930_0059339 | 3300034816 | Bacteria | 851 |
| 234 | Ga0373948_0050041 | 3300034817 | Bacteria | 896 |
| 235 | Ga0373958_0035179 | 3300034819 | Bacteria | 1002 |
| 236 | Ga0373926_0000481 | 3300035083 | Bacteria | 10558 |
| 237 | Ga0373928_0084440 | 3300035084 | Bacteria | 806 |
| 238 | Ga0373929_0007875 | 3300035085 | Bacteria | 1956 |
| 239 | Ga0373934_0005465 | 3300035086 | Bacteria | 4703 |
| 240 | Ga0373944_0001985 | 3300035089 | Bacteria | 5181 |
| 241 | Ga0373951_0028555 | 3300035091 | Bacteria | 1308 |
| 242 | Ga0373923_0011900 | 3300035111 | Bacteria | 3203 |
| 243 | Ga0373936_0001923 | 3300035113 | Bacteria | 7675 |
| 244 | Ga0373939_0014909 | 3300035114 | Bacteria | 2024 |
| 245 | Ga0373939_0061737 | 3300035114 | Bacteria | 1195 |
| 246 | Ga0373945_0003715 | 3300035116 | Bacteria | 4810 |
| 247 | Ga0373953_0004159 | 3300035117 | Bacteria | 4589 |
| 248 | Ga0373954_0004938 | 3300035118 | Bacteria | 5760 |
| 249 | Ga0373943_0005979 | 3300035170 | Bacteria | 5462 |
| 250 | Ga0373955_0008996 | 3300035172 | Bacteria | 4661 |
| 251 | Ga0373942_0009141 | 3300035207 | Bacteria | 2315 |
| 252 | Ga0373961_0093510 | 3300035241 | Bacteria | 964 |
| 253 | Ga0373962_0058434 | 3300035242 | Bacteria | 1128 |
| 254 | Ga0373962_0071679 | 3300035242 | Bacteria | 1037 |
| 255 | Ga0373931_0099228 | 3300035691 | Bacteria | 1635 |
| 256 | Ga0373931_0207882 | 3300035691 | Bacteria | 1172 |
| 257 | Ga0373935_0000226 | 3300035692 | Bacteria | 27564 |
| 258 | Ga0373927_0001109 | 3300035695 | Bacteria | 20443 |
| 259 | Ga0373933_0015466 | 3300035724 | Bacteria | 4253 |
| 260 | Ga0373947_0030651 | 3300035725 | Bacteria | 3161 |
| 261 | Ga0373925_0005454 | 3300037068 | Bacteria | 9473 |
| 262 | Ga0395900_0356808 | 3300037418 | Unclassified | 1434 |
| 263 | Ga0436364_1059010 | 3300037853 | Bacteria | 60327 |
| 264 | Ga0436360_0677530 | 3300039438 | Bacteria | 1277 |
| 265 | Ga0466972_0003144 | 3300044658 | Bacteria | 8197 |
| 266 | Ga0466965_0023216 | 3300044683 | Bacteria | 2994 |
| 267 | Ga0466966_0009818 | 3300044684 | Bacteria | 6344 |
| 268 | Ga0466966_0022445 | 3300044684 | Bacteria | 4141 |
| 269 | Ga0466961_0049816 | 3300044693 | Bacteria | 2676 |
| 270 | Ga0466963_0113965 | 3300044694 | Bacteria | 1857 |
| 271 | Ga0466963_0154842 | 3300044694 | Bacteria | 1593 |
| 272 | Ga0466964_0040098 | 3300044706 | Bacteria | 1890 |
| 273 | Ga0466968_0071778 | 3300044735 | Bacteria | 1508 |
| 274 | Ga0466968_0118844 | 3300044735 | Bacteria | 1194 |
| 275 | Ga0466970_0019133 | 3300044765 | Bacteria | 3549 |
| 276 | Ga0466957_0163878 | 3300044842 | Bacteria | 1445 |
| 277 | Ga0466959_0062922 | 3300045049 | Bacteria | 2696 |
| 278 | Ga0466958_0027487 | 3300045836 | Bacteria | 3368 |
| 279 | Ga0466958_0048938 | 3300045836 | Bacteria | 2556 |
| 280 | Ga0466958_0185169 | 3300045836 | Bacteria | 1322 |
| 281 | Ga0495627_063795 | 3300046453 | Bacteria | 1085 |
| 282 | Ga0495592_0004625 | 3300046454 | Bacteria | 10082 |
| 283 | Ga0495603_0006041 | 3300046455 | Bacteria | 7240 |
| 284 | Ga0495629_0007247 | 3300046459 | Bacteria | 8169 |
| 285 | Ga0495629_0454720 | 3300046459 | Bacteria | 867 |
| 286 | Ga0495641_0004177 | 3300046461 | Bacteria | 10377 |
| 287 | Ga0495651_0026018 | 3300046462 | Bacteria | 4555 |
| 288 | Ga0495580_0010059 | 3300046472 | Bacteria | 7393 |
| 289 | Ga0495582_0002725 | 3300046473 | Bacteria | 9868 |
| 290 | Ga0495639_0003351 | 3300046475 | Bacteria | 6947 |
| 291 | Ga0495662_0000330 | 3300046476 | Bacteria | 20617 |
| 292 | Ga0495664_0055289 | 3300046477 | Bacteria | 2362 |
| 293 | Ga0495594_0004876 | 3300046499 | Bacteria | 6908 |
| 294 | Ga0495608_0013593 | 3300046511 | Bacteria | 5646 |
| 295 | Ga0495618_0000107 | 3300046514 | Bacteria | 60640 |
| 296 | Ga0495618_0025463 | 3300046514 | Bacteria | 3671 |
| 297 | Ga0495630_0006764 | 3300046517 | Bacteria | 8168 |
| 298 | Ga0495666_0024750 | 3300046526 | Bacteria | 2965 |
| 299 | Ga0495665_0006498 | 3300046531 | Bacteria | 6313 |
| 300 | Ga0495640_0012364 | 3300046533 | Bacteria | 6523 |
| 301 | Ga0495640_0042948 | 3300046533 | Bacteria | 3151 |
| 302 | Ga0495586_0029450 | 3300046535 | Bacteria | 2937 |
| 303 | Ga0495587_0003495 | 3300046536 | Bacteria | 10460 |
| 304 | Ga0495609_0038845 | 3300046538 | Unclassified | 2145 |
| 305 | Ga0495645_0010626 | 3300046543 | Bacteria | 6462 |
| 306 | Ga0495667_0027919 | 3300046559 | Bacteria | 3799 |
| 307 | Ga0495588_0046159 | 3300046674 | Bacteria | 2234 |
| 308 | Ga0495599_0005475 | 3300046678 | Bacteria | 7595 |
| 309 | Ga0495623_0009059 | 3300046679 | Bacteria | 6455 |
| 310 | Ga0495646_0024844 | 3300046680 | Bacteria | 3770 |
| 311 | Ga0495647_0010800 | 3300046681 | Bacteria | 3118 |
| 312 | Ga0495658_0008596 | 3300046683 | Bacteria | 5065 |
| 313 | Ga0495613_0003215 | 3300046689 | Bacteria | 12228 |
| 314 | Ga0495624_0007424 | 3300046690 | Bacteria | 7690 |
| 315 | Ga0495624_0066960 | 3300046690 | Bacteria | 2242 |
| 316 | Ga0495600_0041437 | 3300046809 | Bacteria | 3001 |
| 317 | Ga0495581_0007583 | 3300047315 | Bacteria | 6272 |
| 318 | Ga0495581_0314691 | 3300047315 | Bacteria | 915 |
| 319 | Ga0495604_0023139 | 3300047317 | Bacteria | 4958 |
| 320 | Ga0495674_0018498 | 3300047319 | Bacteria | 6484 |
| 321 | Ga0495676_0022504 | 3300047321 | Bacteria | 5481 |
| 322 | Ga0495675_0000440 | 3300047444 | Bacteria | 27746 |
| 323 | Ga0495593_0002885 | 3300047673 | Bacteria | 10364 |
| 324 | Ga0495602_0162434 | 3300048088 | Bacteria | 1742 |
| 325 | Ga0495602_0367629 | 3300048088 | Bacteria | 1034 |
| 326 | Ga0495614_0008142 | 3300048089 | Bacteria | 4660 |
| 327 | Ga0496100_0344392 | 3300048903 | Bacteria | 1124 |
| 328 | Ga0496101_0102112 | 3300048904 | Bacteria | 2148 |
| 329 | Ga0496101_0580398 | 3300048904 | Bacteria | 886 |
| 330 | Ga0496102_0354075 | 3300048905 | Bacteria | 1382 |
| 331 | Ga0496102_0608389 | 3300048905 | Bacteria | 1016 |
| 332 | Ga0496104_0000174 | 3300048907 | Bacteria | 57056 |
| 333 | Ga0496104_0261761 | 3300048907 | Bacteria | 1642 |
| 334 | Ga0496104_0346877 | 3300048907 | Bacteria | 1397 |
| 335 | Ga0496104_0420983 | 3300048907 | Bacteria | 1248 |
| 336 | Ga0496105_0098346 | 3300048908 | Bacteria | 2416 |
| 337 | Ga0496105_0604577 | 3300048908 | Bacteria | 850 |
| 338 | Ga0496106_0118332 | 3300048909 | Bacteria | 2068 |
| 339 | Ga0496106_0172606 | 3300048909 | Bacteria | 1714 |
| 340 | Ga0496107_0145409 | 3300048910 | Bacteria | 1753 |
| 341 | Ga0496107_0166111 | 3300048910 | Bacteria | 1636 |
| 342 | Ga0496108_0050581 | 3300048911 | Bacteria | 3478 |
| 343 | Ga0496108_0817138 | 3300048911 | Bacteria | 803 |
| 344 | Ga0496109_0011607 | 3300048912 | Bacteria | 7576 |
| 345 | Ga0496109_0051182 | 3300048912 | Bacteria | 3761 |
| 346 | Ga0496110_0000040 | 3300048913 | Bacteria | 62867 |
| 347 | Ga0496110_0120198 | 3300048913 | Bacteria | 2366 |
| 348 | Ga0496110_1098371 | 3300048913 | Bacteria | 703 |
| 349 | Ga0496111_0003974 | 3300048914 | Bacteria | 9283 |
| 350 | Ga0496112_0260343 | 3300048915 | Bacteria | 1684 |
| 351 | Ga0496113_0071636 | 3300048916 | Bacteria | 2636 |
| 352 | Ga0496113_0128642 | 3300048916 | Bacteria | 1985 |
| 353 | Ga0496114_0042478 | 3300048917 | Bacteria | 3769 |
| 354 | Ga0496114_0208835 | 3300048917 | Bacteria | 1712 |
| 355 | Ga0496115_0263081 | 3300048918 | Bacteria | 1418 |
| 356 | Ga0496126_0024905 | 3300048929 | Bacteria | 5770 |
| 357 | Ga0496126_0136497 | 3300048929 | Bacteria | 2115 |
| 358 | Ga0501305_001274 | 3300049161 | Bacteria | 2424 |
| 359 | Ga0501312_041699 | 3300049528 | Bacteria | 752 |
| 360 | Ga0501316_051477 | 3300049532 | Bacteria | 594 |
| 361 | Ga0501033_0020361 | 3300049570 | Bacteria | 5010 |
| 362 | Ga0501034_0003177 | 3300049571 | Bacteria | 18899 |
| 363 | Ga0501036_0381575 | 3300049572 | Bacteria | 1176 |
| 364 | Ga0501037_0065475 | 3300049573 | Bacteria | 2648 |
| 365 | Ga0501047_0013259 | 3300049581 | Bacteria | 7807 |
| 366 | Ga0501068_0648654 | 3300049584 | Bacteria | 689 |
| 367 | Ga0501070_0099142 | 3300049586 | Bacteria | 2410 |
| 368 | Ga0501070_0637074 | 3300049586 | Bacteria | 847 |
| 369 | Ga0501073_0000025 | 3300049589 | Bacteria | 127490 |
| 370 | Ga0501074_0095426 | 3300049590 | Bacteria | 2130 |
| 371 | Ga0501080_0015153 | 3300049742 | Bacteria | 7102 |
| 372 | Ga0501044_0003295 | 3300049823 | Bacteria | 18189 |
| 373 | nmdc:mga0yw44_10723_c1 | 3300050492 | Bacteria | 4694 |
| 374 | nmdc:mga0n895_38273_c1 | 3300050512 | Bacteria | 4646 |
| 375 | nmdc:mga0rr50_426466_c1 | 3300050513 | Bacteria | 1122 |
| 376 | nmdc:mga0rr50_776321_c1 | 3300050513 | Bacteria | 818 |
| 377 | nmdc:mga0a205_47198_c1 | 3300050515 | Bacteria | 4155 |
| 378 | Ga0495601_0010558 | 3300053077 | Bacteria | 5499 |
| 379 | Ga0495612_0001401 | 3300053078 | Bacteria | 9918 |
| 380 | Ga0495595_0004553 | 3300053084 | Bacteria | 5575 |
| 381 | Ga0501082_0854602 | 3300060353 | Bacteria | 796 |
| 382 | Ga0466962_0055348 | 3300061719 | Bacteria | 1896 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048904 | Ga0496101_0580398 | Ga0496101_0580398_335_868 | 168 |
| 2 | 3300025321 | Ga0207656_10574599 | Ga0207656_105745991 | 170 |
| 3 | iso_pu_bacteria | 2643221676 | 2644421188 | 174 |
| 4 | iso_pu_bacteria | 2816332186 | 2816864752 | 176 |
| 5 | iso_pu_bacteria | 2842682962 | 2842683595 | 176 |
| 6 | iso_pu_bacteria | 2849139964 | 2849142137 | 176 |
| 7 | iso_pu_bacteria | 2857581216 | 2857581520 | 176 |
| 8 | iso_pu_bacteria | 3006978542 | 3006983783 | 176 |
| 9 | 3300025294 | Ga0209025_1023365 | Ga0209025_10233652 | 178 |
| 10 | 3300049161 | Ga0501305_001274 | Ga0501305_001274_130_738 | 178 |
| 11 | 3300049528 | Ga0501312_041699 | Ga0501312_041699_138_734 | 178 |
| 12 | iso_pu_bacteria | 2980182181 | 2980187114 | 178 |
| 13 | 3300044658 | Ga0466972_0003144 | Ga0466972_0003144_1949_2521 | 181 |
| 14 | 3300044683 | Ga0466965_0023216 | Ga0466965_0023216_98_670 | 181 |
| 15 | 3300044735 | Ga0466968_0118844 | Ga0466968_0118844_581_1153 | 181 |
| 16 | iso_pu_bacteria | 2945941187 | 2945944323 | 181 |
| 17 | iso_pu_bacteria | 3001267043 | 3001270190 | 181 |
| 18 | iso_pu_bacteria | 2791355406 | 2793980840 | 183 |
| 19 | iso_pu_bacteria | 8047893842 | 8047900599 | 183 |
| 20 | iso_pu_bacteria | 8048356638 | 8048358301 | 183 |
| 21 | iso_pu_bacteria | 8048369669 | 8048377542 | 183 |
| 22 | iso_pu_bacteria | 8048379754 | 8048386639 | 183 |
| 23 | 3300049532 | Ga0501316_051477 | Ga0501316_051477_13_573 | 184 |
| 24 | 3300014325 | Ga0163163_10076498 | Ga0163163_100764982 | 185 |
| 25 | 3300037418 | Ga0395900_0356808 | Ga0395900_0356808_100_657 | 185 |
| 26 | 3300044694 | Ga0466963_0113965 | Ga0466963_0113965_578_1141 | 185 |
| 27 | 3300044706 | Ga0466964_0040098 | Ga0466964_0040098_1253_1816 | 185 |
| 28 | 3300044735 | Ga0466968_0071778 | Ga0466968_0071778_502_1065 | 185 |
| 29 | 3300044842 | Ga0466957_0163878 | Ga0466957_0163878_709_1266 | 185 |
| 30 | 3300045836 | Ga0466958_0185169 | Ga0466958_0185169_605_1168 | 185 |
| 31 | 3300048905 | Ga0496102_0608389 | Ga0496102_0608389_13_570 | 185 |
| 32 | 3300048916 | Ga0496113_0071636 | Ga0496113_0071636_289_858 | 185 |
| 33 | 3300005530 | Ga0070679_100490385 | Ga0070679_1004903852 | 186 |
| 34 | 3300013100 | Ga0157373_10004566 | Ga0157373_100045662 | 187 |
| 35 | 3300046538 | Ga0495609_0038845 | Ga0495609_0038845_274_837 | 187 |
| 36 | 3300047315 | Ga0495581_0314691 | Ga0495581_0314691_45_611 | 187 |
| 37 | 3300025942 | Ga0207689_10211196 | Ga0207689_102111963 | 188 |
| 38 | 3300031731 | Ga0307405_10685301 | Ga0307405_106853012 | 188 |
| 39 | iso_pu_bacteria | 2852643534 | 2852643740 | 188 |
| 40 | 3300005330 | Ga0070690_100114210 | Ga0070690_1001142102 | 189 |
| 41 | 3300005334 | Ga0068869_100191231 | Ga0068869_1001912312 | 189 |
| 42 | 3300005334 | Ga0068869_100206505 | Ga0068869_1002065051 | 189 |
| 43 | 3300005335 | Ga0070666_10051337 | Ga0070666_100513372 | 189 |
| 44 | 3300005336 | Ga0070680_100472018 | Ga0070680_1004720182 | 189 |
| 45 | 3300005337 | Ga0070682_100067290 | Ga0070682_1000672903 | 189 |
| 46 | 3300005337 | Ga0070682_100261149 | Ga0070682_1002611492 | 189 |
| 47 | 3300005338 | Ga0068868_100125880 | Ga0068868_1001258802 | 189 |
| 48 | 3300005338 | Ga0068868_100439631 | Ga0068868_1004396311 | 189 |
| 49 | 3300005339 | Ga0070660_100088431 | Ga0070660_1000884313 | 189 |
| 50 | 3300005340 | Ga0070689_100103663 | Ga0070689_1001036631 | 189 |
| 51 | 3300005341 | Ga0070691_10024694 | Ga0070691_100246943 | 189 |
| 52 | 3300005343 | Ga0070687_100108870 | Ga0070687_1001088702 | 189 |
| 53 | 3300005347 | Ga0070668_100014989 | Ga0070668_1000149897 | 189 |
| 54 | 3300005353 | Ga0070669_100155547 | Ga0070669_1001555471 | 189 |
| 55 | 3300005353 | Ga0070669_100388290 | Ga0070669_1003882902 | 189 |
| 56 | 3300005356 | Ga0070674_100228335 | Ga0070674_1002283352 | 189 |
| 57 | 3300005364 | Ga0070673_100396287 | Ga0070673_1003962872 | 189 |
| 58 | 3300005365 | Ga0070688_100077560 | Ga0070688_1000775603 | 189 |
| 59 | 3300005367 | Ga0070667_100557469 | Ga0070667_1005574691 | 189 |
| 60 | 3300005434 | Ga0070709_10021462 | Ga0070709_100214622 | 189 |
| 61 | 3300005434 | Ga0070709_10240983 | Ga0070709_102409832 | 189 |
| 62 | 3300005435 | Ga0070714_100104270 | Ga0070714_1001042703 | 189 |
| 63 | 3300005435 | Ga0070714_100307187 | Ga0070714_1003071872 | 189 |
| 64 | 3300005436 | Ga0070713_100124028 | Ga0070713_1001240283 | 189 |
| 65 | 3300005439 | Ga0070711_100067228 | Ga0070711_1000672282 | 189 |
| 66 | 3300005439 | Ga0070711_100084035 | Ga0070711_1000840353 | 189 |
| 67 | 3300005439 | Ga0070711_100830001 | Ga0070711_1008300012 | 189 |
| 68 | 3300005440 | Ga0070705_100078371 | Ga0070705_1000783712 | 189 |
| 69 | 3300005440 | Ga0070705_100143295 | Ga0070705_1001432952 | 189 |
| 70 | 3300005441 | Ga0070700_100091882 | Ga0070700_1000918822 | 189 |
| 71 | 3300005441 | Ga0070700_100370815 | Ga0070700_1003708152 | 189 |
| 72 | 3300005444 | Ga0070694_100132076 | Ga0070694_1001320762 | 189 |
| 73 | 3300005444 | Ga0070694_100235745 | Ga0070694_1002357452 | 189 |
| 74 | 3300005445 | Ga0070708_100080459 | Ga0070708_1000804593 | 189 |
| 75 | 3300005445 | Ga0070708_100183446 | Ga0070708_1001834462 | 189 |
| 76 | 3300005445 | Ga0070708_100468482 | Ga0070708_1004684821 | 189 |
| 77 | 3300005456 | Ga0070678_100050634 | Ga0070678_1000506343 | 189 |
| 78 | 3300005467 | Ga0070706_100002761 | Ga0070706_10000276111 | 189 |
| 79 | 3300005467 | Ga0070706_100054694 | Ga0070706_1000546945 | 189 |
| 80 | 3300005467 | Ga0070706_100099188 | Ga0070706_1000991882 | 189 |
| 81 | 3300005467 | Ga0070706_100947258 | Ga0070706_1009472581 | 189 |
| 82 | 3300005468 | Ga0070707_100051129 | Ga0070707_1000511294 | 189 |
| 83 | 3300005468 | Ga0070707_100148457 | Ga0070707_1001484572 | 189 |
| 84 | 3300005471 | Ga0070698_100033337 | Ga0070698_1000333372 | 189 |
| 85 | 3300005471 | Ga0070698_100229798 | Ga0070698_1002297982 | 189 |
| 86 | 3300005518 | Ga0070699_100003018 | Ga0070699_1000030182 | 189 |
| 87 | 3300005518 | Ga0070699_100020184 | Ga0070699_1000201846 | 189 |
| 88 | 3300005535 | Ga0070684_100081345 | Ga0070684_1000813454 | 189 |
| 89 | 3300005539 | Ga0068853_100020256 | Ga0068853_1000202567 | 189 |
| 90 | 3300005539 | Ga0068853_100405521 | Ga0068853_1004055212 | 189 |
| 91 | 3300005543 | Ga0070672_100176705 | Ga0070672_1001767052 | 189 |
| 92 | 3300005544 | Ga0070686_100159182 | Ga0070686_1001591822 | 189 |
| 93 | 3300005545 | Ga0070695_100230901 | Ga0070695_1002309012 | 189 |
| 94 | 3300005545 | Ga0070695_100400328 | Ga0070695_1004003281 | 189 |
| 95 | 3300005546 | Ga0070696_100039880 | Ga0070696_1000398802 | 189 |
| 96 | 3300005548 | Ga0070665_100723349 | Ga0070665_1007233492 | 189 |
| 97 | 3300005549 | Ga0070704_100021889 | Ga0070704_1000218894 | 189 |
| 98 | 3300005549 | Ga0070704_100071067 | Ga0070704_1000710673 | 189 |
| 99 | 3300005563 | Ga0068855_100966029 | Ga0068855_1009660291 | 189 |
| 100 | 3300005564 | Ga0070664_100180196 | Ga0070664_1001801962 | 189 |
| 101 | 3300005578 | Ga0068854_100693948 | Ga0068854_1006939481 | 189 |
| 102 | 3300005614 | Ga0068856_100332749 | Ga0068856_1003327492 | 189 |
| 103 | 3300005617 | Ga0068859_100176273 | Ga0068859_1001762732 | 189 |
| 104 | 3300005617 | Ga0068859_101408106 | Ga0068859_1014081061 | 189 |
| 105 | 3300005618 | Ga0068864_100017718 | Ga0068864_1000177182 | 189 |
| 106 | 3300005618 | Ga0068864_100233064 | Ga0068864_1002330642 | 189 |
| 107 | 3300005718 | Ga0068866_10221520 | Ga0068866_102215201 | 189 |
| 108 | 3300005719 | Ga0068861_100486916 | Ga0068861_1004869162 | 189 |
| 109 | 3300005840 | Ga0068870_10060397 | Ga0068870_100603971 | 189 |
| 110 | 3300005840 | Ga0068870_10082960 | Ga0068870_100829602 | 189 |
| 111 | 3300005841 | Ga0068863_100151286 | Ga0068863_1001512863 | 189 |
| 112 | 3300005842 | Ga0068858_100188101 | Ga0068858_1001881013 | 189 |
| 113 | 3300005843 | Ga0068860_100135601 | Ga0068860_1001356012 | 189 |
| 114 | 3300005843 | Ga0068860_100860561 | Ga0068860_1008605611 | 189 |
| 115 | 3300005844 | Ga0068862_100590995 | Ga0068862_1005909952 | 189 |
| 116 | 3300005985 | Ga0081539_10002869 | Ga0081539_1000286923 | 189 |
| 117 | 3300006028 | Ga0070717_10170516 | Ga0070717_101705162 | 189 |
| 118 | 3300006028 | Ga0070717_10329539 | Ga0070717_103295393 | 189 |
| 119 | 3300006058 | Ga0075432_10204530 | Ga0075432_102045301 | 189 |
| 120 | 3300006163 | Ga0070715_10042508 | Ga0070715_100425083 | 189 |
| 121 | 3300006175 | Ga0070712_100555861 | Ga0070712_1005558612 | 189 |
| 122 | 3300006178 | Ga0075367_10006233 | Ga0075367_100062331 | 189 |
| 123 | 3300006237 | Ga0097621_100225153 | Ga0097621_1002251531 | 189 |
| 124 | 3300006358 | Ga0068871_100169358 | Ga0068871_1001693581 | 189 |
| 125 | 3300006358 | Ga0068871_100207928 | Ga0068871_1002079282 | 189 |
| 126 | 3300006852 | Ga0075433_10129239 | Ga0075433_101292393 | 189 |
| 127 | 3300006871 | Ga0075434_100090488 | Ga0075434_1000904884 | 189 |
| 128 | 3300006871 | Ga0075434_100103481 | Ga0075434_1001034812 | 189 |
| 129 | 3300006871 | Ga0075434_100199446 | Ga0075434_1001994462 | 189 |
| 130 | 3300006871 | Ga0075434_100811819 | Ga0075434_1008118192 | 189 |
| 131 | 3300006881 | Ga0068865_100378701 | Ga0068865_1003787012 | 189 |
| 132 | 3300006914 | Ga0075436_100151733 | Ga0075436_1001517331 | 189 |
| 133 | 3300006931 | Ga0097620_100176282 | Ga0097620_1001762822 | 189 |
| 134 | 3300006931 | Ga0097620_101407943 | Ga0097620_1014079431 | 189 |
| 135 | 3300007076 | Ga0075435_100041731 | Ga0075435_1000417311 | 189 |
| 136 | 3300009011 | Ga0105251_10027793 | Ga0105251_100277932 | 189 |
| 137 | 3300009036 | Ga0105244_10234446 | Ga0105244_102344461 | 189 |
| 138 | 3300009093 | Ga0105240_10137468 | Ga0105240_101374681 | 189 |
| 139 | 3300009093 | Ga0105240_10902086 | Ga0105240_109020862 | 189 |
| 140 | 3300009098 | Ga0105245_10206796 | Ga0105245_102067963 | 189 |
| 141 | 3300009101 | Ga0105247_10008906 | Ga0105247_100089066 | 189 |
| 142 | 3300009148 | Ga0105243_10360844 | Ga0105243_103608442 | 189 |
| 143 | 3300009148 | Ga0105243_10411304 | Ga0105243_104113042 | 189 |
| 144 | 3300009176 | Ga0105242_10337516 | Ga0105242_103375162 | 189 |
| 145 | 3300009545 | Ga0105237_10073882 | Ga0105237_100738824 | 189 |
| 146 | 3300009545 | Ga0105237_10155215 | Ga0105237_101552154 | 189 |
| 147 | 3300009545 | Ga0105237_10441591 | Ga0105237_104415912 | 189 |
| 148 | 3300009551 | Ga0105238_10243135 | Ga0105238_102431351 | 189 |
| 149 | 3300009553 | Ga0105249_10068027 | Ga0105249_100680274 | 189 |
| 150 | 3300010375 | Ga0105239_10605428 | Ga0105239_106054282 | 189 |
| 151 | 3300011119 | Ga0105246_10077066 | Ga0105246_100770662 | 189 |
| 152 | 3300012477 | Ga0157336_1004856 | Ga0157336_10048561 | 189 |
| 153 | 3300013100 | Ga0157373_10048298 | Ga0157373_100482981 | 189 |
| 154 | 3300013102 | Ga0157371_10139676 | Ga0157371_101396762 | 189 |
| 155 | 3300013104 | Ga0157370_10115682 | Ga0157370_101156821 | 189 |
| 156 | 3300013104 | Ga0157370_10230950 | Ga0157370_102309502 | 189 |
| 157 | 3300013105 | Ga0157369_10157941 | Ga0157369_101579412 | 189 |
| 158 | 3300013296 | Ga0157374_10202547 | Ga0157374_102025472 | 189 |
| 159 | 3300013306 | Ga0163162_10026942 | Ga0163162_100269422 | 189 |
| 160 | 3300013307 | Ga0157372_10505681 | Ga0157372_105056811 | 189 |
| 161 | 3300013308 | Ga0157375_10218709 | Ga0157375_102187092 | 189 |
| 162 | 3300013308 | Ga0157375_10447721 | Ga0157375_104477211 | 189 |
| 163 | 3300014325 | Ga0163163_10609726 | Ga0163163_106097262 | 189 |
| 164 | 3300014326 | Ga0157380_10090163 | Ga0157380_100901633 | 189 |
| 165 | 3300014745 | Ga0157377_10060740 | Ga0157377_100607402 | 189 |
| 166 | 3300014969 | Ga0157376_10036691 | Ga0157376_100366917 | 189 |
| 167 | 3300017792 | Ga0163161_10010895 | Ga0163161_100108955 | 189 |
| 168 | 3300020076 | Ga0206355_1575719 | Ga0206355_15757192 | 189 |
| 169 | 3300020078 | Ga0206352_10599261 | Ga0206352_105992611 | 189 |
| 170 | 3300020081 | Ga0206354_11181771 | Ga0206354_111817711 | 189 |
| 171 | 3300020082 | Ga0206353_10695539 | Ga0206353_106955391 | 189 |
| 172 | 3300021377 | Ga0213874_10127833 | Ga0213874_101278332 | 189 |
| 173 | 3300021388 | Ga0213875_10000715 | Ga0213875_1000071514 | 189 |
| 174 | 3300025321 | Ga0207656_10020351 | Ga0207656_100203512 | 189 |
| 175 | 3300025885 | Ga0207653_10012625 | Ga0207653_100126251 | 189 |
| 176 | 3300025898 | Ga0207692_10219468 | Ga0207692_102194681 | 189 |
| 177 | 3300025899 | Ga0207642_10147238 | Ga0207642_101472381 | 189 |
| 178 | 3300025901 | Ga0207688_10027612 | Ga0207688_100276123 | 189 |
| 179 | 3300025901 | Ga0207688_10320359 | Ga0207688_103203591 | 189 |
| 180 | 3300025903 | Ga0207680_10287600 | Ga0207680_102876001 | 189 |
| 181 | 3300025903 | Ga0207680_10366142 | Ga0207680_103661421 | 189 |
| 182 | 3300025904 | Ga0207647_10037093 | Ga0207647_100370932 | 189 |
| 183 | 3300025905 | Ga0207685_10023454 | Ga0207685_100234542 | 189 |
| 184 | 3300025906 | Ga0207699_10033489 | Ga0207699_100334895 | 189 |
| 185 | 3300025906 | Ga0207699_10076384 | Ga0207699_100763842 | 189 |
| 186 | 3300025908 | Ga0207643_10024607 | Ga0207643_100246073 | 189 |
| 187 | 3300025910 | Ga0207684_10004190 | Ga0207684_1000419011 | 189 |
| 188 | 3300025910 | Ga0207684_10006648 | Ga0207684_100066483 | 189 |
| 189 | 3300025910 | Ga0207684_10269418 | Ga0207684_102694181 | 189 |
| 190 | 3300025910 | Ga0207684_10655353 | Ga0207684_106553532 | 189 |
| 191 | 3300025911 | Ga0207654_10209783 | Ga0207654_102097832 | 189 |
| 192 | 3300025913 | Ga0207695_10316068 | Ga0207695_103160681 | 189 |
| 193 | 3300025915 | Ga0207693_10006578 | Ga0207693_100065787 | 189 |
| 194 | 3300025915 | Ga0207693_10052776 | Ga0207693_100527763 | 189 |
| 195 | 3300025917 | Ga0207660_10391228 | Ga0207660_103912282 | 189 |
| 196 | 3300025918 | Ga0207662_10041543 | Ga0207662_100415434 | 189 |
| 197 | 3300025918 | Ga0207662_10088089 | Ga0207662_100880893 | 189 |
| 198 | 3300025919 | Ga0207657_10189019 | Ga0207657_101890192 | 189 |
| 199 | 3300025922 | Ga0207646_10008232 | Ga0207646_100082328 | 189 |
| 200 | 3300025922 | Ga0207646_10519426 | Ga0207646_105194262 | 189 |
| 201 | 3300025923 | Ga0207681_10082819 | Ga0207681_100828192 | 189 |
| 202 | 3300025923 | Ga0207681_10471505 | Ga0207681_104715051 | 189 |
| 203 | 3300025924 | Ga0207694_10174943 | Ga0207694_101749432 | 189 |
| 204 | 3300025926 | Ga0207659_10226515 | Ga0207659_102265152 | 189 |
| 205 | 3300025927 | Ga0207687_10108686 | Ga0207687_101086862 | 189 |
| 206 | 3300025928 | Ga0207700_10277344 | Ga0207700_102773441 | 189 |
| 207 | 3300025928 | Ga0207700_10465924 | Ga0207700_104659242 | 189 |
| 208 | 3300025929 | Ga0207664_10119539 | Ga0207664_101195393 | 189 |
| 209 | 3300025929 | Ga0207664_10154494 | Ga0207664_101544942 | 189 |
| 210 | 3300025932 | Ga0207690_10124776 | Ga0207690_101247761 | 189 |
| 211 | 3300025932 | Ga0207690_10479440 | Ga0207690_104794402 | 189 |
| 212 | 3300025933 | Ga0207706_10099129 | Ga0207706_100991293 | 189 |
| 213 | 3300025935 | Ga0207709_10147934 | Ga0207709_101479342 | 189 |
| 214 | 3300025936 | Ga0207670_10053420 | Ga0207670_100534202 | 189 |
| 215 | 3300025936 | Ga0207670_10341054 | Ga0207670_103410541 | 189 |
| 216 | 3300025939 | Ga0207665_10082356 | Ga0207665_100823562 | 189 |
| 217 | 3300025939 | Ga0207665_10100065 | Ga0207665_101000652 | 189 |
| 218 | 3300025940 | Ga0207691_10071527 | Ga0207691_100715271 | 189 |
| 219 | 3300025941 | Ga0207711_10342929 | Ga0207711_103429292 | 189 |
| 220 | 3300025942 | Ga0207689_10052504 | Ga0207689_100525042 | 189 |
| 221 | 3300025944 | Ga0207661_10267765 | Ga0207661_102677652 | 189 |
| 222 | 3300025949 | Ga0207667_10244838 | Ga0207667_102448382 | 189 |
| 223 | 3300025949 | Ga0207667_10296367 | Ga0207667_102963672 | 189 |
| 224 | 3300025960 | Ga0207651_10388049 | Ga0207651_103880491 | 189 |
| 225 | 3300025961 | Ga0207712_10559389 | Ga0207712_105593891 | 189 |
| 226 | 3300025972 | Ga0207668_10431594 | Ga0207668_104315941 | 189 |
| 227 | 3300025986 | Ga0207658_10069039 | Ga0207658_100690395 | 189 |
| 228 | 3300026023 | Ga0207677_10024026 | Ga0207677_100240264 | 189 |
| 229 | 3300026023 | Ga0207677_10076824 | Ga0207677_100768242 | 189 |
| 230 | 3300026041 | Ga0207639_10116277 | Ga0207639_101162772 | 189 |
| 231 | 3300026067 | Ga0207678_10052312 | Ga0207678_100523123 | 189 |
| 232 | 3300026067 | Ga0207678_10062667 | Ga0207678_100626673 | 189 |
| 233 | 3300026075 | Ga0207708_10034183 | Ga0207708_100341832 | 189 |
| 234 | 3300026075 | Ga0207708_10277419 | Ga0207708_102774192 | 189 |
| 235 | 3300026078 | Ga0207702_10531198 | Ga0207702_105311982 | 189 |
| 236 | 3300026088 | Ga0207641_10499733 | Ga0207641_104997331 | 189 |
| 237 | 3300026089 | Ga0207648_10165129 | Ga0207648_101651292 | 189 |
| 238 | 3300026095 | Ga0207676_10713894 | Ga0207676_107138941 | 189 |
| 239 | 3300026116 | Ga0207674_10018405 | Ga0207674_100184055 | 189 |
| 240 | 3300026118 | Ga0207675_100049578 | Ga0207675_1000495784 | 189 |
| 241 | 3300026118 | Ga0207675_100606303 | Ga0207675_1006063031 | 189 |
| 242 | 3300026121 | Ga0207683_10016970 | Ga0207683_100169702 | 189 |
| 243 | 3300026121 | Ga0207683_10023622 | Ga0207683_100236221 | 189 |
| 244 | 3300026142 | Ga0207698_10170331 | Ga0207698_101703312 | 189 |
| 245 | 3300026142 | Ga0207698_10638647 | Ga0207698_106386472 | 189 |
| 246 | 3300027907 | Ga0207428_10672335 | Ga0207428_106723351 | 189 |
| 247 | 3300028379 | Ga0268266_10161985 | Ga0268266_101619853 | 189 |
| 248 | 3300028379 | Ga0268266_10864195 | Ga0268266_108641952 | 189 |
| 249 | 3300028380 | Ga0268265_10090899 | Ga0268265_100908992 | 189 |
| 250 | 3300028381 | Ga0268264_10379436 | Ga0268264_103794362 | 189 |
| 251 | 3300030522 | Ga0307512_10074208 | Ga0307512_100742083 | 189 |
| 252 | 3300031507 | Ga0307509_10248144 | Ga0307509_102481441 | 189 |
| 253 | 3300031838 | Ga0307518_10379877 | Ga0307518_103798771 | 189 |
| 254 | 3300033179 | Ga0307507_10086550 | Ga0307507_100865505 | 189 |
| 255 | 3300033179 | Ga0307507_10261694 | Ga0307507_102616942 | 189 |
| 256 | 3300034816 | Ga0373930_0059339 | Ga0373930_0059339_245_826 | 189 |
| 257 | 3300034817 | Ga0373948_0050041 | Ga0373948_0050041_285_863 | 189 |
| 258 | 3300034819 | Ga0373958_0035179 | Ga0373958_0035179_140_721 | 189 |
| 259 | 3300035083 | Ga0373926_0000481 | Ga0373926_0000481_3244_3825 | 189 |
| 260 | 3300035084 | Ga0373928_0084440 | Ga0373928_0084440_159_740 | 189 |
| 261 | 3300035085 | Ga0373929_0007875 | Ga0373929_0007875_946_1524 | 189 |
| 262 | 3300035086 | Ga0373934_0005465 | Ga0373934_0005465_3427_4008 | 189 |
| 263 | 3300035089 | Ga0373944_0001985 | Ga0373944_0001985_1446_2027 | 189 |
| 264 | 3300035091 | Ga0373951_0028555 | Ga0373951_0028555_446_1027 | 189 |
| 265 | 3300035111 | Ga0373923_0011900 | Ga0373923_0011900_2378_2959 | 189 |
| 266 | 3300035113 | Ga0373936_0001923 | Ga0373936_0001923_1078_1659 | 189 |
| 267 | 3300035114 | Ga0373939_0014909 | Ga0373939_0014909_556_1134 | 189 |
| 268 | 3300035114 | Ga0373939_0061737 | Ga0373939_0061737_285_866 | 189 |
| 269 | 3300035116 | Ga0373945_0003715 | Ga0373945_0003715_2331_2912 | 189 |
| 270 | 3300035117 | Ga0373953_0004159 | Ga0373953_0004159_804_1385 | 189 |
| 271 | 3300035118 | Ga0373954_0004938 | Ga0373954_0004938_1957_2538 | 189 |
| 272 | 3300035170 | Ga0373943_0005979 | Ga0373943_0005979_2359_2940 | 189 |
| 273 | 3300035172 | Ga0373955_0008996 | Ga0373955_0008996_840_1421 | 189 |
| 274 | 3300035207 | Ga0373942_0009141 | Ga0373942_0009141_159_737 | 189 |
| 275 | 3300035241 | Ga0373961_0093510 | Ga0373961_0093510_26_607 | 189 |
| 276 | 3300035242 | Ga0373962_0058434 | Ga0373962_0058434_222_803 | 189 |
| 277 | 3300035242 | Ga0373962_0071679 | Ga0373962_0071679_77_655 | 189 |
| 278 | 3300035691 | Ga0373931_0099228 | Ga0373931_0099228_643_1221 | 189 |
| 279 | 3300035691 | Ga0373931_0207882 | Ga0373931_0207882_361_942 | 189 |
| 280 | 3300035692 | Ga0373935_0000226 | Ga0373935_0000226_24780_25361 | 189 |
| 281 | 3300035695 | Ga0373927_0001109 | Ga0373927_0001109_2377_2958 | 189 |
| 282 | 3300035724 | Ga0373933_0015466 | Ga0373933_0015466_1295_1876 | 189 |
| 283 | 3300035725 | Ga0373947_0030651 | Ga0373947_0030651_235_816 | 189 |
| 284 | 3300037068 | Ga0373925_0005454 | Ga0373925_0005454_6541_7122 | 189 |
| 285 | 3300037853 | Ga0436364_1059010 | Ga0436364_1059010_5501_6088 | 189 |
| 286 | 3300039438 | Ga0436360_0677530 | Ga0436360_0677530_52_627 | 189 |
| 287 | 3300044684 | Ga0466966_0009818 | Ga0466966_0009818_5439_6014 | 189 |
| 288 | 3300044684 | Ga0466966_0022445 | Ga0466966_0022445_2418_2993 | 189 |
| 289 | 3300044693 | Ga0466961_0049816 | Ga0466961_0049816_746_1321 | 189 |
| 290 | 3300044694 | Ga0466963_0154842 | Ga0466963_0154842_832_1407 | 189 |
| 291 | 3300044765 | Ga0466970_0019133 | Ga0466970_0019133_2040_2615 | 189 |
| 292 | 3300045049 | Ga0466959_0062922 | Ga0466959_0062922_831_1406 | 189 |
| 293 | 3300045836 | Ga0466958_0027487 | Ga0466958_0027487_2145_2720 | 189 |
| 294 | 3300045836 | Ga0466958_0048938 | Ga0466958_0048938_268_843 | 189 |
| 295 | 3300046453 | Ga0495627_063795 | Ga0495627_063795_308_889 | 189 |
| 296 | 3300046454 | Ga0495592_0004625 | Ga0495592_0004625_2346_2927 | 189 |
| 297 | 3300046455 | Ga0495603_0006041 | Ga0495603_0006041_4297_4878 | 189 |
| 298 | 3300046459 | Ga0495629_0007247 | Ga0495629_0007247_5291_5872 | 189 |
| 299 | 3300046459 | Ga0495629_0454720 | Ga0495629_0454720_134_709 | 189 |
| 300 | 3300046461 | Ga0495641_0004177 | Ga0495641_0004177_2337_2918 | 189 |
| 301 | 3300046462 | Ga0495651_0026018 | Ga0495651_0026018_2204_2785 | 189 |
| 302 | 3300046472 | Ga0495580_0010059 | Ga0495580_0010059_2357_2938 | 189 |
| 303 | 3300046473 | Ga0495582_0002725 | Ga0495582_0002725_2357_2938 | 189 |
| 304 | 3300046475 | Ga0495639_0003351 | Ga0495639_0003351_2356_2937 | 189 |
| 305 | 3300046476 | Ga0495662_0000330 | Ga0495662_0000330_2370_2951 | 189 |
| 306 | 3300046477 | Ga0495664_0055289 | Ga0495664_0055289_1689_2264 | 189 |
| 307 | 3300046499 | Ga0495594_0004876 | Ga0495594_0004876_3950_4531 | 189 |
| 308 | 3300046511 | Ga0495608_0013593 | Ga0495608_0013593_2357_2938 | 189 |
| 309 | 3300046514 | Ga0495618_0000107 | Ga0495618_0000107_11842_12414 | 189 |
| 310 | 3300046514 | Ga0495618_0025463 | Ga0495618_0025463_2141_2722 | 189 |
| 311 | 3300046517 | Ga0495630_0006764 | Ga0495630_0006764_2378_2959 | 189 |
| 312 | 3300046526 | Ga0495666_0024750 | Ga0495666_0024750_351_932 | 189 |
| 313 | 3300046531 | Ga0495665_0006498 | Ga0495665_0006498_2378_2959 | 189 |
| 314 | 3300046533 | Ga0495640_0012364 | Ga0495640_0012364_3569_4150 | 189 |
| 315 | 3300046533 | Ga0495640_0042948 | Ga0495640_0042948_426_1001 | 189 |
| 316 | 3300046535 | Ga0495586_0029450 | Ga0495586_0029450_74_655 | 189 |
| 317 | 3300046536 | Ga0495587_0003495 | Ga0495587_0003495_7676_8257 | 189 |
| 318 | 3300046543 | Ga0495645_0010626 | Ga0495645_0010626_2356_2937 | 189 |
| 319 | 3300046559 | Ga0495667_0027919 | Ga0495667_0027919_845_1426 | 189 |
| 320 | 3300046674 | Ga0495588_0046159 | Ga0495588_0046159_1376_1957 | 189 |
| 321 | 3300046678 | Ga0495599_0005475 | Ga0495599_0005475_2331_2912 | 189 |
| 322 | 3300046679 | Ga0495623_0009059 | Ga0495623_0009059_2350_2931 | 189 |
| 323 | 3300046680 | Ga0495646_0024844 | Ga0495646_0024844_845_1426 | 189 |
| 324 | 3300046681 | Ga0495647_0010800 | Ga0495647_0010800_2126_2707 | 189 |
| 325 | 3300046683 | Ga0495658_0008596 | Ga0495658_0008596_1078_1659 | 189 |
| 326 | 3300046689 | Ga0495613_0003215 | Ga0495613_0003215_9238_9819 | 189 |
| 327 | 3300046690 | Ga0495624_0007424 | Ga0495624_0007424_6782_7363 | 189 |
| 328 | 3300046690 | Ga0495624_0066960 | Ga0495624_0066960_1567_2145 | 189 |
| 329 | 3300046809 | Ga0495600_0041437 | Ga0495600_0041437_75_656 | 189 |
| 330 | 3300047315 | Ga0495581_0007583 | Ga0495581_0007583_2371_2952 | 189 |
| 331 | 3300047317 | Ga0495604_0023139 | Ga0495604_0023139_2378_2959 | 189 |
| 332 | 3300047319 | Ga0495674_0018498 | Ga0495674_0018498_2378_2959 | 189 |
| 333 | 3300047321 | Ga0495676_0022504 | Ga0495676_0022504_2378_2959 | 189 |
| 334 | 3300047444 | Ga0495675_0000440 | Ga0495675_0000440_2181_2762 | 189 |
| 335 | 3300047673 | Ga0495593_0002885 | Ga0495593_0002885_2040_2621 | 189 |
| 336 | 3300048088 | Ga0495602_0162434 | Ga0495602_0162434_845_1426 | 189 |
| 337 | 3300048088 | Ga0495602_0367629 | Ga0495602_0367629_234_809 | 189 |
| 338 | 3300048089 | Ga0495614_0008142 | Ga0495614_0008142_555_1136 | 189 |
| 339 | 3300048903 | Ga0496100_0344392 | Ga0496100_0344392_416_997 | 189 |
| 340 | 3300048904 | Ga0496101_0102112 | Ga0496101_0102112_719_1336 | 189 |
| 341 | 3300048905 | Ga0496102_0354075 | Ga0496102_0354075_285_863 | 189 |
| 342 | 3300048907 | Ga0496104_0000174 | Ga0496104_0000174_28808_29380 | 189 |
| 343 | 3300048907 | Ga0496104_0261761 | Ga0496104_0261761_824_1402 | 189 |
| 344 | 3300048907 | Ga0496104_0346877 | Ga0496104_0346877_145_726 | 189 |
| 345 | 3300048907 | Ga0496104_0420983 | Ga0496104_0420983_609_1190 | 189 |
| 346 | 3300048908 | Ga0496105_0098346 | Ga0496105_0098346_688_1266 | 189 |
| 347 | 3300048908 | Ga0496105_0604577 | Ga0496105_0604577_224_805 | 189 |
| 348 | 3300048909 | Ga0496106_0118332 | Ga0496106_0118332_1058_1639 | 189 |
| 349 | 3300048909 | Ga0496106_0172606 | Ga0496106_0172606_379_957 | 189 |
| 350 | 3300048910 | Ga0496107_0145409 | Ga0496107_0145409_1020_1598 | 189 |
| 351 | 3300048910 | Ga0496107_0166111 | Ga0496107_0166111_327_908 | 189 |
| 352 | 3300048911 | Ga0496108_0050581 | Ga0496108_0050581_583_1161 | 189 |
| 353 | 3300048911 | Ga0496108_0817138 | Ga0496108_0817138_203_784 | 189 |
| 354 | 3300048912 | Ga0496109_0011607 | Ga0496109_0011607_695_1273 | 189 |
| 355 | 3300048912 | Ga0496109_0051182 | Ga0496109_0051182_101_682 | 189 |
| 356 | 3300048913 | Ga0496110_0000040 | Ga0496110_0000040_33518_34090 | 189 |
| 357 | 3300048913 | Ga0496110_0120198 | Ga0496110_0120198_797_1375 | 189 |
| 358 | 3300048913 | Ga0496110_1098371 | Ga0496110_1098371_50_628 | 189 |
| 359 | 3300048914 | Ga0496111_0003974 | Ga0496111_0003974_5544_6116 | 189 |
| 360 | 3300048915 | Ga0496112_0260343 | Ga0496112_0260343_971_1549 | 189 |
| 361 | 3300048916 | Ga0496113_0128642 | Ga0496113_0128642_945_1523 | 189 |
| 362 | 3300048917 | Ga0496114_0042478 | Ga0496114_0042478_1897_2475 | 189 |
| 363 | 3300048917 | Ga0496114_0208835 | Ga0496114_0208835_80_652 | 189 |
| 364 | 3300048918 | Ga0496115_0263081 | Ga0496115_0263081_284_862 | 189 |
| 365 | 3300049570 | Ga0501033_0020361 | Ga0501033_0020361_1807_2382 | 189 |
| 366 | 3300049571 | Ga0501034_0003177 | Ga0501034_0003177_11451_12026 | 189 |
| 367 | 3300049572 | Ga0501036_0381575 | Ga0501036_0381575_543_1118 | 189 |
| 368 | 3300049573 | Ga0501037_0065475 | Ga0501037_0065475_1125_1700 | 189 |
| 369 | 3300049581 | Ga0501047_0013259 | Ga0501047_0013259_677_1252 | 189 |
| 370 | 3300049584 | Ga0501068_0648654 | Ga0501068_0648654_42_632 | 189 |
| 371 | 3300049586 | Ga0501070_0637074 | Ga0501070_0637074_73_648 | 189 |
| 372 | 3300049823 | Ga0501044_0003295 | Ga0501044_0003295_7896_8471 | 189 |
| 373 | 3300050492 | nmdc:mga0yw44_10723_c1 | nmdc:mga0yw44_10723_c1_3253_3825 | 189 |
| 374 | 3300050512 | nmdc:mga0n895_38273_c1 | nmdc:mga0n895_38273_c1_611_1189 | 189 |
| 375 | 3300050513 | nmdc:mga0rr50_426466_c1 | nmdc:mga0rr50_426466_c1_481_1110 | 189 |
| 376 | 3300050513 | nmdc:mga0rr50_776321_c1 | nmdc:mga0rr50_776321_c1_167_745 | 189 |
| 377 | 3300050515 | nmdc:mga0a205_47198_c1 | nmdc:mga0a205_47198_c1_1070_1648 | 189 |
| 378 | 3300053077 | Ga0495601_0010558 | Ga0495601_0010558_2374_2955 | 189 |
| 379 | 3300053078 | Ga0495612_0001401 | Ga0495612_0001401_2350_2931 | 189 |
| 380 | 3300053084 | Ga0495595_0004553 | Ga0495595_0004553_1561_2142 | 189 |
| 381 | 3300061719 | Ga0466962_0055348 | Ga0466962_0055348_1260_1835 | 189 |
| 382 | 3300005355 | Ga0070671_100159750 | Ga0070671_1001597503 | 190 |
| 383 | 3300025931 | Ga0207644_10336104 | Ga0207644_103361042 | 190 |
| 384 | 3300028794 | Ga0307515_10229489 | Ga0307515_102294892 | 190 |
| 385 | 3300028794 | Ga0307515_10302297 | Ga0307515_103022972 | 190 |
| 386 | 3300048929 | Ga0496126_0024905 | Ga0496126_0024905_3674_4264 | 190 |
| 387 | 3300048929 | Ga0496126_0136497 | Ga0496126_0136497_1160_1741 | 190 |
| 388 | 3300049586 | Ga0501070_0099142 | Ga0501070_0099142_1533_2123 | 190 |
| 389 | 3300049589 | Ga0501073_0000025 | Ga0501073_0000025_48525_49172 | 190 |
| 390 | 3300049590 | Ga0501074_0095426 | Ga0501074_0095426_861_1451 | 190 |
| 391 | 3300049742 | Ga0501080_0015153 | Ga0501080_0015153_2285_2875 | 190 |
| 392 | 3300060353 | Ga0501082_0854602 | Ga0501082_0854602_63_701 | 190 |
| 393 | 3300003792 | Ga0055540_1011397 | Ga0055540_10113973 | 191 |
| 394 | 3300003792 | Ga0055540_1013120 | Ga0055540_10131203 | 191 |
| 395 | 3300006051 | Ga0075364_10320044 | Ga0075364_103200442 | 191 |
| 396 | 3300025303 | Ga0209051_1001324 | Ga0209051_100132411 | 191 |
| 397 | 3300025303 | Ga0209051_1001675 | Ga0209051_10016754 | 191 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3gfq-assembly1.cif.gz_A | structure of yhda, k109l variant | 0.8381 | 5 | 181 |
| 2fzv-assembly1.cif.gz_D | crystal structure of an apo form of a flavin-binding protein from shigella flexneri | 0.8277 | 2 | 186 |
| 3gfq-assembly1.cif.gz_A | structure of yhda, k109l variant | 0.8244 | 5 | 181 |
| 6dgi-assembly1.cif.gz_B | the crystal structure of d-alanyl-alanine synthetase a from vibrio cholerae o1 biovar eltor str. n16961 | 0.8237 | 2 | 43 |
| 3gfr-assembly2.cif.gz_B | structure of yhda, d137l variant | 0.8227 | 5 | 180 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9USJ6_13_177_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9549 | 4 | 147 | 3.40.50.360 |
| af_Q9USJ6_13_177_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8307 | 4 | 147 | 3.40.50.360 |
| af_Q2G0L7_1_184_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8143 | 2 | 180 | 3.40.50.360 |
| 2fzvC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.812 | 2 | 187 | 3.40.50.360 |
| 2gswD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8058 | 6 | 181 | 3.40.50.360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Z1AUH0-F1-model_v4 | NADPH-dependent FMN reductase | 0.9921 | 1 | 188 |
GO:0005829
GO:0010181 GO:0016491 |
| AF-A0A260VZG8-F1-model_v4 | NADPH-dependent FMN reductase | 0.9907 | 1 | 185 |
GO:0005829
GO:0010181 GO:0016491 |
| AF-A0A5M3XMH6-F1-model_v4 | FMN reductase | 0.9889 | 1 | 186 |
GO:0005829
GO:0010181 GO:0016491 |
| AF-A0A7Z1AUH0-F1-model_v4 | NADPH-dependent FMN reductase | 0.9868 | 1 | 188 |
GO:0005829
GO:0010181 GO:0016491 |
| AF-A0A4R7W711-F1-model_v4 | Flavin-dependent monooxygenase (TetX monooxygenase) (TetX) (EC 1.14.13.-) | 0.9856 | 2 | 186 |
GO:0004497
GO:0005737 GO:0046677 GO:0071949 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar