F433884

General Info

Members Datasets Scaffolds Average Seq Length
397 297 382 192

Family's Representative Sequence

Representative Sequence 3300049589|Ga0501073_0000025|Ga0501073_0000025_48525_49172
Length 215
Sequence MSSNVGSSDDRRPLPKGTPVSEVRIAIVLGSTRPGRRGEAVARWVLEQATARGDAHYELVDLADFPLPHLDEPMPPSAGRYEYEHTKTWSDKIDDFDGFVFVTPEYNHAPSGVLKNALDYLYAEWNDKAAGIVSYGVAASGLRAAEALRPILGELQIADVRQSVGISLIHDFENFTTFVPGPQHAQQLGVQLDQVLAWSAALRGVRETKAALAAA

Samples

Sample ID Description Type Environment
1 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
2 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
3 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
4 2842682962 Bacillus sp. R-72492 Isolate Unclassified
5 2849139964 Bacillus sp. R-71875 Isolate Unclassified
6 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
7 2857581216 Bacillus sp. R-71922 Isolate Unclassified
8 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
9 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
10 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
11 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
107 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
111 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
112 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
171 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
174 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
175 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
176 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
177 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
178 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
179 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
180 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
181 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
182 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
183 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
184 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
187 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
188 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
189 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
193 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
194 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
198 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
199 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
204 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
205 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
206 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
207 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
208 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
209 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
210 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
211 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
212 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
215 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
216 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
217 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
220 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
223 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
224 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
225 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
226 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
227 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
228 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
231 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
232 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
233 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
234 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
235 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
236 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
237 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
238 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
239 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
240 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
241 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
242 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
243 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
244 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
245 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
246 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
247 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
248 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
249 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
250 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
251 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
252 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
253 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
254 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
255 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
256 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
257 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
265 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
269 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
270 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
271 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
280 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
281 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
282 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
286 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
287 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
291 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
292 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
293 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
294 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
295 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
296 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
297 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.46
Metatranscriptomes 1.76
Isolates 3.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.02
Nodule 0
Rhizoplane 7.56
Rhizosphere 85.64
Stem 0
Stem Tuber 0
Unclassified 4.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055540_1011397 3300003792 Bacteria 2870
2 Ga0055540_1013120 3300003792 Bacteria 2551
3 Ga0070690_100114210 3300005330 Bacteria 1805
4 Ga0068869_100191231 3300005334 Bacteria 1609
5 Ga0068869_100206505 3300005334 Bacteria 1551
6 Ga0070666_10051337 3300005335 Bacteria 2776
7 Ga0070680_100472018 3300005336 Bacteria 1072
8 Ga0070682_100067290 3300005337 Bacteria 2281
9 Ga0070682_100261149 3300005337 Bacteria 1253
10 Ga0068868_100125880 3300005338 Bacteria 2093
11 Ga0068868_100439631 3300005338 Bacteria 1132
12 Ga0070660_100088431 3300005339 Bacteria 2440
13 Ga0070689_100103663 3300005340 Bacteria 2255
14 Ga0070691_10024694 3300005341 Bacteria 2794
15 Ga0070687_100108870 3300005343 Bacteria 1565
16 Ga0070668_100014989 3300005347 Bacteria 5790
17 Ga0070669_100155547 3300005353 Bacteria 1773
18 Ga0070669_100388290 3300005353 Bacteria 1140
19 Ga0070671_100159750 3300005355 Bacteria 1905
20 Ga0070674_100228335 3300005356 Bacteria 1451
21 Ga0070673_100396287 3300005364 Bacteria 1234
22 Ga0070688_100077560 3300005365 Bacteria 2141
23 Ga0070667_100557469 3300005367 Bacteria 1054
24 Ga0070709_10021462 3300005434 Bacteria 3761
25 Ga0070709_10240983 3300005434 Bacteria 1298
26 Ga0070714_100104270 3300005435 Bacteria 2502
27 Ga0070714_100307187 3300005435 Bacteria 1480
28 Ga0070713_100124028 3300005436 Bacteria 2269
29 Ga0070711_100067228 3300005439 Bacteria 2513
30 Ga0070711_100084035 3300005439 Bacteria 2276
31 Ga0070711_100830001 3300005439 Bacteria 785
32 Ga0070705_100078371 3300005440 Bacteria 2021
33 Ga0070705_100143295 3300005440 Bacteria 1575
34 Ga0070700_100091882 3300005441 Bacteria 1983
35 Ga0070700_100370815 3300005441 Bacteria 1067
36 Ga0070694_100132076 3300005444 Bacteria 1805
37 Ga0070694_100235745 3300005444 Bacteria 1378
38 Ga0070708_100080459 3300005445 Bacteria 2948
39 Ga0070708_100183446 3300005445 Bacteria 1956
40 Ga0070708_100468482 3300005445 Bacteria 1188
41 Ga0070678_100050634 3300005456 Bacteria 3006
42 Ga0070706_100002761 3300005467 Bacteria 17559
43 Ga0070706_100054694 3300005467 Bacteria 3684
44 Ga0070706_100099188 3300005467 Bacteria 2706
45 Ga0070706_100947258 3300005467 Bacteria 794
46 Ga0070707_100051129 3300005468 Bacteria 3961
47 Ga0070707_100148457 3300005468 Bacteria 2282
48 Ga0070698_100033337 3300005471 Bacteria 5335
49 Ga0070698_100229798 3300005471 Bacteria 1788
50 Ga0070699_100003018 3300005518 Bacteria 14944
51 Ga0070699_100020184 3300005518 Bacteria 5743
52 Ga0070679_100490385 3300005530 Bacteria 1173
53 Ga0070684_100081345 3300005535 Bacteria 2866
54 Ga0068853_100020256 3300005539 Bacteria 5530
55 Ga0068853_100405521 3300005539 Bacteria 1277
56 Ga0070672_100176705 3300005543 Bacteria 1778
57 Ga0070686_100159182 3300005544 Bacteria 1589
58 Ga0070695_100230901 3300005545 Bacteria 1337
59 Ga0070695_100400328 3300005545 Bacteria 1041
60 Ga0070696_100039880 3300005546 Bacteria 3242
61 Ga0070665_100723349 3300005548 Bacteria 1008
62 Ga0070704_100021889 3300005549 Bacteria 4152
63 Ga0070704_100071067 3300005549 Bacteria 2527
64 Ga0068855_100966029 3300005563 Bacteria 897
65 Ga0070664_100180196 3300005564 Bacteria 1877
66 Ga0068854_100693948 3300005578 Bacteria 878
67 Ga0068856_100332749 3300005614 Bacteria 1536
68 Ga0068859_100176273 3300005617 Bacteria 2220
69 Ga0068859_101408106 3300005617 Bacteria 769
70 Ga0068864_100017718 3300005618 Bacteria 5941
71 Ga0068864_100233064 3300005618 Bacteria 1703
72 Ga0068866_10221520 3300005718 Bacteria 1142
73 Ga0068861_100486916 3300005719 Bacteria 1112
74 Ga0068870_10060397 3300005840 Bacteria 2035
75 Ga0068870_10082960 3300005840 Bacteria 1776
76 Ga0068863_100151286 3300005841 Bacteria 2220
77 Ga0068858_100188101 3300005842 Bacteria 1951
78 Ga0068860_100135601 3300005843 Bacteria 2364
79 Ga0068860_100860561 3300005843 Bacteria 921
80 Ga0068862_100590995 3300005844 Bacteria 1065
81 Ga0081539_10002869 3300005985 Bacteria 22908
82 Ga0070717_10170516 3300006028 Bacteria 1892
83 Ga0070717_10329539 3300006028 Bacteria 1362
84 Ga0075364_10320044 3300006051 Bacteria 1056
85 Ga0075432_10204530 3300006058 Bacteria 783
86 Ga0070715_10042508 3300006163 Bacteria 1911
87 Ga0070712_100555861 3300006175 Bacteria 967
88 Ga0075367_10006233 3300006178 Bacteria 6010
89 Ga0097621_100225153 3300006237 Bacteria 1635
90 Ga0068871_100169358 3300006358 Bacteria 1871
91 Ga0068871_100207928 3300006358 Bacteria 1692
92 Ga0075433_10129239 3300006852 Bacteria 2244
93 Ga0075434_100090488 3300006871 Bacteria 3061
94 Ga0075434_100103481 3300006871 Bacteria 2855
95 Ga0075434_100199446 3300006871 Bacteria 2021
96 Ga0075434_100811819 3300006871 Bacteria 951
97 Ga0068865_100378701 3300006881 Bacteria 1154
98 Ga0075436_100151733 3300006914 Bacteria 1631
99 Ga0097620_100176282 3300006931 Bacteria 2220
100 Ga0097620_101407943 3300006931 Bacteria 769
101 Ga0075435_100041731 3300007076 Bacteria 3668
102 Ga0105251_10027793 3300009011 Bacteria 2862
103 Ga0105244_10234446 3300009036 Bacteria 858
104 Ga0105240_10137468 3300009093 Bacteria 2925
105 Ga0105240_10902086 3300009093 Bacteria 951
106 Ga0105245_10206796 3300009098 Bacteria 1887
107 Ga0105247_10008906 3300009101 Bacteria 6115
108 Ga0105243_10360844 3300009148 Bacteria 1337
109 Ga0105243_10411304 3300009148 Bacteria 1259
110 Ga0105242_10337516 3300009176 Bacteria 1388
111 Ga0105237_10073882 3300009545 Bacteria 3401
112 Ga0105237_10155215 3300009545 Bacteria 2285
113 Ga0105237_10441591 3300009545 Bacteria 1307
114 Ga0105238_10243135 3300009551 Bacteria 1777
115 Ga0105249_10068027 3300009553 Bacteria 3284
116 Ga0105239_10605428 3300010375 Bacteria 1250
117 Ga0105246_10077066 3300011119 Bacteria 2364
118 Ga0157336_1004856 3300012477 Bacteria 866
119 Ga0157373_10004566 3300013100 Bacteria 10413
120 Ga0157373_10048298 3300013100 Bacteria 3034
121 Ga0157371_10139676 3300013102 Bacteria 1726
122 Ga0157370_10115682 3300013104 Bacteria 2505
123 Ga0157370_10230950 3300013104 Bacteria 1712
124 Ga0157369_10157941 3300013105 Bacteria 2394
125 Ga0157374_10202547 3300013296 Bacteria 1944
126 Ga0163162_10026942 3300013306 Bacteria 5683
127 Ga0157372_10505681 3300013307 Bacteria 1409
128 Ga0157375_10218709 3300013308 Bacteria 2063
129 Ga0157375_10447721 3300013308 Bacteria 1457
130 Ga0163163_10076498 3300014325 Unclassified 3342
131 Ga0163163_10609726 3300014325 Bacteria 1155
132 Ga0157380_10090163 3300014326 Bacteria 2528
133 Ga0157377_10060740 3300014745 Bacteria 2159
134 Ga0157376_10036691 3300014969 Bacteria 3973
135 Ga0163161_10010895 3300017792 Bacteria 6305
136 Ga0206355_1575719 3300020076 Bacteria 1280
137 Ga0206352_10599261 3300020078 Bacteria 890
138 Ga0206354_11181771 3300020081 Bacteria 1490
139 Ga0206353_10695539 3300020082 Bacteria 1188
140 Ga0213874_10127833 3300021377 Bacteria 870
141 Ga0213875_10000715 3300021388 Bacteria 25429
142 Ga0209025_1023365 3300025294 Bacteria 3234
143 Ga0209051_1001324 3300025303 Bacteria 21635
144 Ga0209051_1001675 3300025303 Bacteria 17855
145 Ga0207656_10020351 3300025321 Bacteria 2637
146 Ga0207656_10574599 3300025321 Bacteria 575
147 Ga0207653_10012625 3300025885 Bacteria 2637
148 Ga0207692_10219468 3300025898 Bacteria 1126
149 Ga0207642_10147238 3300025899 Bacteria 1249
150 Ga0207688_10027612 3300025901 Bacteria 3122
151 Ga0207688_10320359 3300025901 Bacteria 951
152 Ga0207680_10287600 3300025903 Bacteria 1143
153 Ga0207680_10366142 3300025903 Bacteria 1014
154 Ga0207647_10037093 3300025904 Bacteria 3093
155 Ga0207685_10023454 3300025905 Bacteria 2101
156 Ga0207699_10033489 3300025906 Bacteria 2904
157 Ga0207699_10076384 3300025906 Bacteria 2063
158 Ga0207643_10024607 3300025908 Bacteria 3322
159 Ga0207684_10004190 3300025910 Bacteria 13693
160 Ga0207684_10006648 3300025910 Bacteria 10509
161 Ga0207684_10269418 3300025910 Bacteria 1469
162 Ga0207684_10655353 3300025910 Bacteria 894
163 Ga0207654_10209783 3300025911 Bacteria 1287
164 Ga0207695_10316068 3300025913 Bacteria 1451
165 Ga0207693_10006578 3300025915 Bacteria 9620
166 Ga0207693_10052776 3300025915 Bacteria 3189
167 Ga0207660_10391228 3300025917 Bacteria 1118
168 Ga0207662_10041543 3300025918 Bacteria 2708
169 Ga0207662_10088089 3300025918 Bacteria 1906
170 Ga0207657_10189019 3300025919 Bacteria 1662
171 Ga0207646_10008232 3300025922 Bacteria 10472
172 Ga0207646_10519426 3300025922 Bacteria 1072
173 Ga0207681_10082819 3300025923 Bacteria 2269
174 Ga0207681_10471505 3300025923 Bacteria 1024
175 Ga0207694_10174943 3300025924 Bacteria 1739
176 Ga0207659_10226515 3300025926 Bacteria 1506
177 Ga0207687_10108686 3300025927 Bacteria 2054
178 Ga0207700_10277344 3300025928 Bacteria 1441
179 Ga0207700_10465924 3300025928 Bacteria 1115
180 Ga0207664_10119539 3300025929 Bacteria 2203
181 Ga0207664_10154494 3300025929 Bacteria 1952
182 Ga0207644_10336104 3300025931 Bacteria 1224
183 Ga0207690_10124776 3300025932 Bacteria 1876
184 Ga0207690_10479440 3300025932 Bacteria 1004
185 Ga0207706_10099129 3300025933 Bacteria 2563
186 Ga0207709_10147934 3300025935 Bacteria 1623
187 Ga0207670_10053420 3300025936 Bacteria 2722
188 Ga0207670_10341054 3300025936 Bacteria 1184
189 Ga0207665_10082356 3300025939 Bacteria 2217
190 Ga0207665_10100065 3300025939 Bacteria 2022
191 Ga0207691_10071527 3300025940 Bacteria 3130
192 Ga0207711_10342929 3300025941 Bacteria 1383
193 Ga0207689_10052504 3300025942 Bacteria 3359
194 Ga0207689_10211196 3300025942 Bacteria 1603
195 Ga0207661_10267765 3300025944 Bacteria 1524
196 Ga0207667_10244838 3300025949 Bacteria 1834
197 Ga0207667_10296367 3300025949 Bacteria 1652
198 Ga0207651_10388049 3300025960 Bacteria 1185
199 Ga0207712_10559389 3300025961 Bacteria 985
200 Ga0207668_10431594 3300025972 Bacteria 1120
201 Ga0207658_10069039 3300025986 Bacteria 2669
202 Ga0207677_10024026 3300026023 Bacteria 3778
203 Ga0207677_10076824 3300026023 Bacteria 2379
204 Ga0207639_10116277 3300026041 Bacteria 2189
205 Ga0207678_10052312 3300026067 Bacteria 3524
206 Ga0207678_10062667 3300026067 Bacteria 3196
207 Ga0207708_10034183 3300026075 Bacteria 3866
208 Ga0207708_10277419 3300026075 Bacteria 1357
209 Ga0207702_10531198 3300026078 Bacteria 1149
210 Ga0207641_10499733 3300026088 Bacteria 1181
211 Ga0207648_10165129 3300026089 Bacteria 1956
212 Ga0207676_10713894 3300026095 Bacteria 972
213 Ga0207674_10018405 3300026116 Bacteria 7594
214 Ga0207675_100049578 3300026118 Bacteria 3918
215 Ga0207675_100606303 3300026118 Bacteria 1098
216 Ga0207683_10016970 3300026121 Bacteria 6197
217 Ga0207683_10023622 3300026121 Bacteria 5289
218 Ga0207698_10170331 3300026142 Bacteria 1916
219 Ga0207698_10638647 3300026142 Bacteria 1053
220 Ga0207428_10672335 3300027907 Bacteria 742
221 Ga0268266_10161985 3300028379 Bacteria 2025
222 Ga0268266_10864195 3300028379 Bacteria 874
223 Ga0268265_10090899 3300028380 Bacteria 2440
224 Ga0268264_10379436 3300028381 Bacteria 1353
225 Ga0307515_10229489 3300028794 Bacteria 1653
226 Ga0307515_10302297 3300028794 Bacteria 1284
227 Ga0307512_10074208 3300030522 Bacteria 2500
228 Ga0307509_10248144 3300031507 Bacteria 1566
229 Ga0307405_10685301 3300031731 Bacteria 847
230 Ga0307518_10379877 3300031838 Bacteria 802
231 Ga0307507_10086550 3300033179 Bacteria 2716
232 Ga0307507_10261694 3300033179 Bacteria 1103
233 Ga0373930_0059339 3300034816 Bacteria 851
234 Ga0373948_0050041 3300034817 Bacteria 896
235 Ga0373958_0035179 3300034819 Bacteria 1002
236 Ga0373926_0000481 3300035083 Bacteria 10558
237 Ga0373928_0084440 3300035084 Bacteria 806
238 Ga0373929_0007875 3300035085 Bacteria 1956
239 Ga0373934_0005465 3300035086 Bacteria 4703
240 Ga0373944_0001985 3300035089 Bacteria 5181
241 Ga0373951_0028555 3300035091 Bacteria 1308
242 Ga0373923_0011900 3300035111 Bacteria 3203
243 Ga0373936_0001923 3300035113 Bacteria 7675
244 Ga0373939_0014909 3300035114 Bacteria 2024
245 Ga0373939_0061737 3300035114 Bacteria 1195
246 Ga0373945_0003715 3300035116 Bacteria 4810
247 Ga0373953_0004159 3300035117 Bacteria 4589
248 Ga0373954_0004938 3300035118 Bacteria 5760
249 Ga0373943_0005979 3300035170 Bacteria 5462
250 Ga0373955_0008996 3300035172 Bacteria 4661
251 Ga0373942_0009141 3300035207 Bacteria 2315
252 Ga0373961_0093510 3300035241 Bacteria 964
253 Ga0373962_0058434 3300035242 Bacteria 1128
254 Ga0373962_0071679 3300035242 Bacteria 1037
255 Ga0373931_0099228 3300035691 Bacteria 1635
256 Ga0373931_0207882 3300035691 Bacteria 1172
257 Ga0373935_0000226 3300035692 Bacteria 27564
258 Ga0373927_0001109 3300035695 Bacteria 20443
259 Ga0373933_0015466 3300035724 Bacteria 4253
260 Ga0373947_0030651 3300035725 Bacteria 3161
261 Ga0373925_0005454 3300037068 Bacteria 9473
262 Ga0395900_0356808 3300037418 Unclassified 1434
263 Ga0436364_1059010 3300037853 Bacteria 60327
264 Ga0436360_0677530 3300039438 Bacteria 1277
265 Ga0466972_0003144 3300044658 Bacteria 8197
266 Ga0466965_0023216 3300044683 Bacteria 2994
267 Ga0466966_0009818 3300044684 Bacteria 6344
268 Ga0466966_0022445 3300044684 Bacteria 4141
269 Ga0466961_0049816 3300044693 Bacteria 2676
270 Ga0466963_0113965 3300044694 Bacteria 1857
271 Ga0466963_0154842 3300044694 Bacteria 1593
272 Ga0466964_0040098 3300044706 Bacteria 1890
273 Ga0466968_0071778 3300044735 Bacteria 1508
274 Ga0466968_0118844 3300044735 Bacteria 1194
275 Ga0466970_0019133 3300044765 Bacteria 3549
276 Ga0466957_0163878 3300044842 Bacteria 1445
277 Ga0466959_0062922 3300045049 Bacteria 2696
278 Ga0466958_0027487 3300045836 Bacteria 3368
279 Ga0466958_0048938 3300045836 Bacteria 2556
280 Ga0466958_0185169 3300045836 Bacteria 1322
281 Ga0495627_063795 3300046453 Bacteria 1085
282 Ga0495592_0004625 3300046454 Bacteria 10082
283 Ga0495603_0006041 3300046455 Bacteria 7240
284 Ga0495629_0007247 3300046459 Bacteria 8169
285 Ga0495629_0454720 3300046459 Bacteria 867
286 Ga0495641_0004177 3300046461 Bacteria 10377
287 Ga0495651_0026018 3300046462 Bacteria 4555
288 Ga0495580_0010059 3300046472 Bacteria 7393
289 Ga0495582_0002725 3300046473 Bacteria 9868
290 Ga0495639_0003351 3300046475 Bacteria 6947
291 Ga0495662_0000330 3300046476 Bacteria 20617
292 Ga0495664_0055289 3300046477 Bacteria 2362
293 Ga0495594_0004876 3300046499 Bacteria 6908
294 Ga0495608_0013593 3300046511 Bacteria 5646
295 Ga0495618_0000107 3300046514 Bacteria 60640
296 Ga0495618_0025463 3300046514 Bacteria 3671
297 Ga0495630_0006764 3300046517 Bacteria 8168
298 Ga0495666_0024750 3300046526 Bacteria 2965
299 Ga0495665_0006498 3300046531 Bacteria 6313
300 Ga0495640_0012364 3300046533 Bacteria 6523
301 Ga0495640_0042948 3300046533 Bacteria 3151
302 Ga0495586_0029450 3300046535 Bacteria 2937
303 Ga0495587_0003495 3300046536 Bacteria 10460
304 Ga0495609_0038845 3300046538 Unclassified 2145
305 Ga0495645_0010626 3300046543 Bacteria 6462
306 Ga0495667_0027919 3300046559 Bacteria 3799
307 Ga0495588_0046159 3300046674 Bacteria 2234
308 Ga0495599_0005475 3300046678 Bacteria 7595
309 Ga0495623_0009059 3300046679 Bacteria 6455
310 Ga0495646_0024844 3300046680 Bacteria 3770
311 Ga0495647_0010800 3300046681 Bacteria 3118
312 Ga0495658_0008596 3300046683 Bacteria 5065
313 Ga0495613_0003215 3300046689 Bacteria 12228
314 Ga0495624_0007424 3300046690 Bacteria 7690
315 Ga0495624_0066960 3300046690 Bacteria 2242
316 Ga0495600_0041437 3300046809 Bacteria 3001
317 Ga0495581_0007583 3300047315 Bacteria 6272
318 Ga0495581_0314691 3300047315 Bacteria 915
319 Ga0495604_0023139 3300047317 Bacteria 4958
320 Ga0495674_0018498 3300047319 Bacteria 6484
321 Ga0495676_0022504 3300047321 Bacteria 5481
322 Ga0495675_0000440 3300047444 Bacteria 27746
323 Ga0495593_0002885 3300047673 Bacteria 10364
324 Ga0495602_0162434 3300048088 Bacteria 1742
325 Ga0495602_0367629 3300048088 Bacteria 1034
326 Ga0495614_0008142 3300048089 Bacteria 4660
327 Ga0496100_0344392 3300048903 Bacteria 1124
328 Ga0496101_0102112 3300048904 Bacteria 2148
329 Ga0496101_0580398 3300048904 Bacteria 886
330 Ga0496102_0354075 3300048905 Bacteria 1382
331 Ga0496102_0608389 3300048905 Bacteria 1016
332 Ga0496104_0000174 3300048907 Bacteria 57056
333 Ga0496104_0261761 3300048907 Bacteria 1642
334 Ga0496104_0346877 3300048907 Bacteria 1397
335 Ga0496104_0420983 3300048907 Bacteria 1248
336 Ga0496105_0098346 3300048908 Bacteria 2416
337 Ga0496105_0604577 3300048908 Bacteria 850
338 Ga0496106_0118332 3300048909 Bacteria 2068
339 Ga0496106_0172606 3300048909 Bacteria 1714
340 Ga0496107_0145409 3300048910 Bacteria 1753
341 Ga0496107_0166111 3300048910 Bacteria 1636
342 Ga0496108_0050581 3300048911 Bacteria 3478
343 Ga0496108_0817138 3300048911 Bacteria 803
344 Ga0496109_0011607 3300048912 Bacteria 7576
345 Ga0496109_0051182 3300048912 Bacteria 3761
346 Ga0496110_0000040 3300048913 Bacteria 62867
347 Ga0496110_0120198 3300048913 Bacteria 2366
348 Ga0496110_1098371 3300048913 Bacteria 703
349 Ga0496111_0003974 3300048914 Bacteria 9283
350 Ga0496112_0260343 3300048915 Bacteria 1684
351 Ga0496113_0071636 3300048916 Bacteria 2636
352 Ga0496113_0128642 3300048916 Bacteria 1985
353 Ga0496114_0042478 3300048917 Bacteria 3769
354 Ga0496114_0208835 3300048917 Bacteria 1712
355 Ga0496115_0263081 3300048918 Bacteria 1418
356 Ga0496126_0024905 3300048929 Bacteria 5770
357 Ga0496126_0136497 3300048929 Bacteria 2115
358 Ga0501305_001274 3300049161 Bacteria 2424
359 Ga0501312_041699 3300049528 Bacteria 752
360 Ga0501316_051477 3300049532 Bacteria 594
361 Ga0501033_0020361 3300049570 Bacteria 5010
362 Ga0501034_0003177 3300049571 Bacteria 18899
363 Ga0501036_0381575 3300049572 Bacteria 1176
364 Ga0501037_0065475 3300049573 Bacteria 2648
365 Ga0501047_0013259 3300049581 Bacteria 7807
366 Ga0501068_0648654 3300049584 Bacteria 689
367 Ga0501070_0099142 3300049586 Bacteria 2410
368 Ga0501070_0637074 3300049586 Bacteria 847
369 Ga0501073_0000025 3300049589 Bacteria 127490
370 Ga0501074_0095426 3300049590 Bacteria 2130
371 Ga0501080_0015153 3300049742 Bacteria 7102
372 Ga0501044_0003295 3300049823 Bacteria 18189
373 nmdc:mga0yw44_10723_c1 3300050492 Bacteria 4694
374 nmdc:mga0n895_38273_c1 3300050512 Bacteria 4646
375 nmdc:mga0rr50_426466_c1 3300050513 Bacteria 1122
376 nmdc:mga0rr50_776321_c1 3300050513 Bacteria 818
377 nmdc:mga0a205_47198_c1 3300050515 Bacteria 4155
378 Ga0495601_0010558 3300053077 Bacteria 5499
379 Ga0495612_0001401 3300053078 Bacteria 9918
380 Ga0495595_0004553 3300053084 Bacteria 5575
381 Ga0501082_0854602 3300060353 Bacteria 796
382 Ga0466962_0055348 3300061719 Bacteria 1896

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048904 Ga0496101_0580398 Ga0496101_0580398_335_868 168
2 3300025321 Ga0207656_10574599 Ga0207656_105745991 170
3 iso_pu_bacteria 2643221676 2644421188 174
4 iso_pu_bacteria 2816332186 2816864752 176
5 iso_pu_bacteria 2842682962 2842683595 176
6 iso_pu_bacteria 2849139964 2849142137 176
7 iso_pu_bacteria 2857581216 2857581520 176
8 iso_pu_bacteria 3006978542 3006983783 176
9 3300025294 Ga0209025_1023365 Ga0209025_10233652 178
10 3300049161 Ga0501305_001274 Ga0501305_001274_130_738 178
11 3300049528 Ga0501312_041699 Ga0501312_041699_138_734 178
12 iso_pu_bacteria 2980182181 2980187114 178
13 3300044658 Ga0466972_0003144 Ga0466972_0003144_1949_2521 181
14 3300044683 Ga0466965_0023216 Ga0466965_0023216_98_670 181
15 3300044735 Ga0466968_0118844 Ga0466968_0118844_581_1153 181
16 iso_pu_bacteria 2945941187 2945944323 181
17 iso_pu_bacteria 3001267043 3001270190 181
18 iso_pu_bacteria 2791355406 2793980840 183
19 iso_pu_bacteria 8047893842 8047900599 183
20 iso_pu_bacteria 8048356638 8048358301 183
21 iso_pu_bacteria 8048369669 8048377542 183
22 iso_pu_bacteria 8048379754 8048386639 183
23 3300049532 Ga0501316_051477 Ga0501316_051477_13_573 184
24 3300014325 Ga0163163_10076498 Ga0163163_100764982 185
25 3300037418 Ga0395900_0356808 Ga0395900_0356808_100_657 185
26 3300044694 Ga0466963_0113965 Ga0466963_0113965_578_1141 185
27 3300044706 Ga0466964_0040098 Ga0466964_0040098_1253_1816 185
28 3300044735 Ga0466968_0071778 Ga0466968_0071778_502_1065 185
29 3300044842 Ga0466957_0163878 Ga0466957_0163878_709_1266 185
30 3300045836 Ga0466958_0185169 Ga0466958_0185169_605_1168 185
31 3300048905 Ga0496102_0608389 Ga0496102_0608389_13_570 185
32 3300048916 Ga0496113_0071636 Ga0496113_0071636_289_858 185
33 3300005530 Ga0070679_100490385 Ga0070679_1004903852 186
34 3300013100 Ga0157373_10004566 Ga0157373_100045662 187
35 3300046538 Ga0495609_0038845 Ga0495609_0038845_274_837 187
36 3300047315 Ga0495581_0314691 Ga0495581_0314691_45_611 187
37 3300025942 Ga0207689_10211196 Ga0207689_102111963 188
38 3300031731 Ga0307405_10685301 Ga0307405_106853012 188
39 iso_pu_bacteria 2852643534 2852643740 188
40 3300005330 Ga0070690_100114210 Ga0070690_1001142102 189
41 3300005334 Ga0068869_100191231 Ga0068869_1001912312 189
42 3300005334 Ga0068869_100206505 Ga0068869_1002065051 189
43 3300005335 Ga0070666_10051337 Ga0070666_100513372 189
44 3300005336 Ga0070680_100472018 Ga0070680_1004720182 189
45 3300005337 Ga0070682_100067290 Ga0070682_1000672903 189
46 3300005337 Ga0070682_100261149 Ga0070682_1002611492 189
47 3300005338 Ga0068868_100125880 Ga0068868_1001258802 189
48 3300005338 Ga0068868_100439631 Ga0068868_1004396311 189
49 3300005339 Ga0070660_100088431 Ga0070660_1000884313 189
50 3300005340 Ga0070689_100103663 Ga0070689_1001036631 189
51 3300005341 Ga0070691_10024694 Ga0070691_100246943 189
52 3300005343 Ga0070687_100108870 Ga0070687_1001088702 189
53 3300005347 Ga0070668_100014989 Ga0070668_1000149897 189
54 3300005353 Ga0070669_100155547 Ga0070669_1001555471 189
55 3300005353 Ga0070669_100388290 Ga0070669_1003882902 189
56 3300005356 Ga0070674_100228335 Ga0070674_1002283352 189
57 3300005364 Ga0070673_100396287 Ga0070673_1003962872 189
58 3300005365 Ga0070688_100077560 Ga0070688_1000775603 189
59 3300005367 Ga0070667_100557469 Ga0070667_1005574691 189
60 3300005434 Ga0070709_10021462 Ga0070709_100214622 189
61 3300005434 Ga0070709_10240983 Ga0070709_102409832 189
62 3300005435 Ga0070714_100104270 Ga0070714_1001042703 189
63 3300005435 Ga0070714_100307187 Ga0070714_1003071872 189
64 3300005436 Ga0070713_100124028 Ga0070713_1001240283 189
65 3300005439 Ga0070711_100067228 Ga0070711_1000672282 189
66 3300005439 Ga0070711_100084035 Ga0070711_1000840353 189
67 3300005439 Ga0070711_100830001 Ga0070711_1008300012 189
68 3300005440 Ga0070705_100078371 Ga0070705_1000783712 189
69 3300005440 Ga0070705_100143295 Ga0070705_1001432952 189
70 3300005441 Ga0070700_100091882 Ga0070700_1000918822 189
71 3300005441 Ga0070700_100370815 Ga0070700_1003708152 189
72 3300005444 Ga0070694_100132076 Ga0070694_1001320762 189
73 3300005444 Ga0070694_100235745 Ga0070694_1002357452 189
74 3300005445 Ga0070708_100080459 Ga0070708_1000804593 189
75 3300005445 Ga0070708_100183446 Ga0070708_1001834462 189
76 3300005445 Ga0070708_100468482 Ga0070708_1004684821 189
77 3300005456 Ga0070678_100050634 Ga0070678_1000506343 189
78 3300005467 Ga0070706_100002761 Ga0070706_10000276111 189
79 3300005467 Ga0070706_100054694 Ga0070706_1000546945 189
80 3300005467 Ga0070706_100099188 Ga0070706_1000991882 189
81 3300005467 Ga0070706_100947258 Ga0070706_1009472581 189
82 3300005468 Ga0070707_100051129 Ga0070707_1000511294 189
83 3300005468 Ga0070707_100148457 Ga0070707_1001484572 189
84 3300005471 Ga0070698_100033337 Ga0070698_1000333372 189
85 3300005471 Ga0070698_100229798 Ga0070698_1002297982 189
86 3300005518 Ga0070699_100003018 Ga0070699_1000030182 189
87 3300005518 Ga0070699_100020184 Ga0070699_1000201846 189
88 3300005535 Ga0070684_100081345 Ga0070684_1000813454 189
89 3300005539 Ga0068853_100020256 Ga0068853_1000202567 189
90 3300005539 Ga0068853_100405521 Ga0068853_1004055212 189
91 3300005543 Ga0070672_100176705 Ga0070672_1001767052 189
92 3300005544 Ga0070686_100159182 Ga0070686_1001591822 189
93 3300005545 Ga0070695_100230901 Ga0070695_1002309012 189
94 3300005545 Ga0070695_100400328 Ga0070695_1004003281 189
95 3300005546 Ga0070696_100039880 Ga0070696_1000398802 189
96 3300005548 Ga0070665_100723349 Ga0070665_1007233492 189
97 3300005549 Ga0070704_100021889 Ga0070704_1000218894 189
98 3300005549 Ga0070704_100071067 Ga0070704_1000710673 189
99 3300005563 Ga0068855_100966029 Ga0068855_1009660291 189
100 3300005564 Ga0070664_100180196 Ga0070664_1001801962 189
101 3300005578 Ga0068854_100693948 Ga0068854_1006939481 189
102 3300005614 Ga0068856_100332749 Ga0068856_1003327492 189
103 3300005617 Ga0068859_100176273 Ga0068859_1001762732 189
104 3300005617 Ga0068859_101408106 Ga0068859_1014081061 189
105 3300005618 Ga0068864_100017718 Ga0068864_1000177182 189
106 3300005618 Ga0068864_100233064 Ga0068864_1002330642 189
107 3300005718 Ga0068866_10221520 Ga0068866_102215201 189
108 3300005719 Ga0068861_100486916 Ga0068861_1004869162 189
109 3300005840 Ga0068870_10060397 Ga0068870_100603971 189
110 3300005840 Ga0068870_10082960 Ga0068870_100829602 189
111 3300005841 Ga0068863_100151286 Ga0068863_1001512863 189
112 3300005842 Ga0068858_100188101 Ga0068858_1001881013 189
113 3300005843 Ga0068860_100135601 Ga0068860_1001356012 189
114 3300005843 Ga0068860_100860561 Ga0068860_1008605611 189
115 3300005844 Ga0068862_100590995 Ga0068862_1005909952 189
116 3300005985 Ga0081539_10002869 Ga0081539_1000286923 189
117 3300006028 Ga0070717_10170516 Ga0070717_101705162 189
118 3300006028 Ga0070717_10329539 Ga0070717_103295393 189
119 3300006058 Ga0075432_10204530 Ga0075432_102045301 189
120 3300006163 Ga0070715_10042508 Ga0070715_100425083 189
121 3300006175 Ga0070712_100555861 Ga0070712_1005558612 189
122 3300006178 Ga0075367_10006233 Ga0075367_100062331 189
123 3300006237 Ga0097621_100225153 Ga0097621_1002251531 189
124 3300006358 Ga0068871_100169358 Ga0068871_1001693581 189
125 3300006358 Ga0068871_100207928 Ga0068871_1002079282 189
126 3300006852 Ga0075433_10129239 Ga0075433_101292393 189
127 3300006871 Ga0075434_100090488 Ga0075434_1000904884 189
128 3300006871 Ga0075434_100103481 Ga0075434_1001034812 189
129 3300006871 Ga0075434_100199446 Ga0075434_1001994462 189
130 3300006871 Ga0075434_100811819 Ga0075434_1008118192 189
131 3300006881 Ga0068865_100378701 Ga0068865_1003787012 189
132 3300006914 Ga0075436_100151733 Ga0075436_1001517331 189
133 3300006931 Ga0097620_100176282 Ga0097620_1001762822 189
134 3300006931 Ga0097620_101407943 Ga0097620_1014079431 189
135 3300007076 Ga0075435_100041731 Ga0075435_1000417311 189
136 3300009011 Ga0105251_10027793 Ga0105251_100277932 189
137 3300009036 Ga0105244_10234446 Ga0105244_102344461 189
138 3300009093 Ga0105240_10137468 Ga0105240_101374681 189
139 3300009093 Ga0105240_10902086 Ga0105240_109020862 189
140 3300009098 Ga0105245_10206796 Ga0105245_102067963 189
141 3300009101 Ga0105247_10008906 Ga0105247_100089066 189
142 3300009148 Ga0105243_10360844 Ga0105243_103608442 189
143 3300009148 Ga0105243_10411304 Ga0105243_104113042 189
144 3300009176 Ga0105242_10337516 Ga0105242_103375162 189
145 3300009545 Ga0105237_10073882 Ga0105237_100738824 189
146 3300009545 Ga0105237_10155215 Ga0105237_101552154 189
147 3300009545 Ga0105237_10441591 Ga0105237_104415912 189
148 3300009551 Ga0105238_10243135 Ga0105238_102431351 189
149 3300009553 Ga0105249_10068027 Ga0105249_100680274 189
150 3300010375 Ga0105239_10605428 Ga0105239_106054282 189
151 3300011119 Ga0105246_10077066 Ga0105246_100770662 189
152 3300012477 Ga0157336_1004856 Ga0157336_10048561 189
153 3300013100 Ga0157373_10048298 Ga0157373_100482981 189
154 3300013102 Ga0157371_10139676 Ga0157371_101396762 189
155 3300013104 Ga0157370_10115682 Ga0157370_101156821 189
156 3300013104 Ga0157370_10230950 Ga0157370_102309502 189
157 3300013105 Ga0157369_10157941 Ga0157369_101579412 189
158 3300013296 Ga0157374_10202547 Ga0157374_102025472 189
159 3300013306 Ga0163162_10026942 Ga0163162_100269422 189
160 3300013307 Ga0157372_10505681 Ga0157372_105056811 189
161 3300013308 Ga0157375_10218709 Ga0157375_102187092 189
162 3300013308 Ga0157375_10447721 Ga0157375_104477211 189
163 3300014325 Ga0163163_10609726 Ga0163163_106097262 189
164 3300014326 Ga0157380_10090163 Ga0157380_100901633 189
165 3300014745 Ga0157377_10060740 Ga0157377_100607402 189
166 3300014969 Ga0157376_10036691 Ga0157376_100366917 189
167 3300017792 Ga0163161_10010895 Ga0163161_100108955 189
168 3300020076 Ga0206355_1575719 Ga0206355_15757192 189
169 3300020078 Ga0206352_10599261 Ga0206352_105992611 189
170 3300020081 Ga0206354_11181771 Ga0206354_111817711 189
171 3300020082 Ga0206353_10695539 Ga0206353_106955391 189
172 3300021377 Ga0213874_10127833 Ga0213874_101278332 189
173 3300021388 Ga0213875_10000715 Ga0213875_1000071514 189
174 3300025321 Ga0207656_10020351 Ga0207656_100203512 189
175 3300025885 Ga0207653_10012625 Ga0207653_100126251 189
176 3300025898 Ga0207692_10219468 Ga0207692_102194681 189
177 3300025899 Ga0207642_10147238 Ga0207642_101472381 189
178 3300025901 Ga0207688_10027612 Ga0207688_100276123 189
179 3300025901 Ga0207688_10320359 Ga0207688_103203591 189
180 3300025903 Ga0207680_10287600 Ga0207680_102876001 189
181 3300025903 Ga0207680_10366142 Ga0207680_103661421 189
182 3300025904 Ga0207647_10037093 Ga0207647_100370932 189
183 3300025905 Ga0207685_10023454 Ga0207685_100234542 189
184 3300025906 Ga0207699_10033489 Ga0207699_100334895 189
185 3300025906 Ga0207699_10076384 Ga0207699_100763842 189
186 3300025908 Ga0207643_10024607 Ga0207643_100246073 189
187 3300025910 Ga0207684_10004190 Ga0207684_1000419011 189
188 3300025910 Ga0207684_10006648 Ga0207684_100066483 189
189 3300025910 Ga0207684_10269418 Ga0207684_102694181 189
190 3300025910 Ga0207684_10655353 Ga0207684_106553532 189
191 3300025911 Ga0207654_10209783 Ga0207654_102097832 189
192 3300025913 Ga0207695_10316068 Ga0207695_103160681 189
193 3300025915 Ga0207693_10006578 Ga0207693_100065787 189
194 3300025915 Ga0207693_10052776 Ga0207693_100527763 189
195 3300025917 Ga0207660_10391228 Ga0207660_103912282 189
196 3300025918 Ga0207662_10041543 Ga0207662_100415434 189
197 3300025918 Ga0207662_10088089 Ga0207662_100880893 189
198 3300025919 Ga0207657_10189019 Ga0207657_101890192 189
199 3300025922 Ga0207646_10008232 Ga0207646_100082328 189
200 3300025922 Ga0207646_10519426 Ga0207646_105194262 189
201 3300025923 Ga0207681_10082819 Ga0207681_100828192 189
202 3300025923 Ga0207681_10471505 Ga0207681_104715051 189
203 3300025924 Ga0207694_10174943 Ga0207694_101749432 189
204 3300025926 Ga0207659_10226515 Ga0207659_102265152 189
205 3300025927 Ga0207687_10108686 Ga0207687_101086862 189
206 3300025928 Ga0207700_10277344 Ga0207700_102773441 189
207 3300025928 Ga0207700_10465924 Ga0207700_104659242 189
208 3300025929 Ga0207664_10119539 Ga0207664_101195393 189
209 3300025929 Ga0207664_10154494 Ga0207664_101544942 189
210 3300025932 Ga0207690_10124776 Ga0207690_101247761 189
211 3300025932 Ga0207690_10479440 Ga0207690_104794402 189
212 3300025933 Ga0207706_10099129 Ga0207706_100991293 189
213 3300025935 Ga0207709_10147934 Ga0207709_101479342 189
214 3300025936 Ga0207670_10053420 Ga0207670_100534202 189
215 3300025936 Ga0207670_10341054 Ga0207670_103410541 189
216 3300025939 Ga0207665_10082356 Ga0207665_100823562 189
217 3300025939 Ga0207665_10100065 Ga0207665_101000652 189
218 3300025940 Ga0207691_10071527 Ga0207691_100715271 189
219 3300025941 Ga0207711_10342929 Ga0207711_103429292 189
220 3300025942 Ga0207689_10052504 Ga0207689_100525042 189
221 3300025944 Ga0207661_10267765 Ga0207661_102677652 189
222 3300025949 Ga0207667_10244838 Ga0207667_102448382 189
223 3300025949 Ga0207667_10296367 Ga0207667_102963672 189
224 3300025960 Ga0207651_10388049 Ga0207651_103880491 189
225 3300025961 Ga0207712_10559389 Ga0207712_105593891 189
226 3300025972 Ga0207668_10431594 Ga0207668_104315941 189
227 3300025986 Ga0207658_10069039 Ga0207658_100690395 189
228 3300026023 Ga0207677_10024026 Ga0207677_100240264 189
229 3300026023 Ga0207677_10076824 Ga0207677_100768242 189
230 3300026041 Ga0207639_10116277 Ga0207639_101162772 189
231 3300026067 Ga0207678_10052312 Ga0207678_100523123 189
232 3300026067 Ga0207678_10062667 Ga0207678_100626673 189
233 3300026075 Ga0207708_10034183 Ga0207708_100341832 189
234 3300026075 Ga0207708_10277419 Ga0207708_102774192 189
235 3300026078 Ga0207702_10531198 Ga0207702_105311982 189
236 3300026088 Ga0207641_10499733 Ga0207641_104997331 189
237 3300026089 Ga0207648_10165129 Ga0207648_101651292 189
238 3300026095 Ga0207676_10713894 Ga0207676_107138941 189
239 3300026116 Ga0207674_10018405 Ga0207674_100184055 189
240 3300026118 Ga0207675_100049578 Ga0207675_1000495784 189
241 3300026118 Ga0207675_100606303 Ga0207675_1006063031 189
242 3300026121 Ga0207683_10016970 Ga0207683_100169702 189
243 3300026121 Ga0207683_10023622 Ga0207683_100236221 189
244 3300026142 Ga0207698_10170331 Ga0207698_101703312 189
245 3300026142 Ga0207698_10638647 Ga0207698_106386472 189
246 3300027907 Ga0207428_10672335 Ga0207428_106723351 189
247 3300028379 Ga0268266_10161985 Ga0268266_101619853 189
248 3300028379 Ga0268266_10864195 Ga0268266_108641952 189
249 3300028380 Ga0268265_10090899 Ga0268265_100908992 189
250 3300028381 Ga0268264_10379436 Ga0268264_103794362 189
251 3300030522 Ga0307512_10074208 Ga0307512_100742083 189
252 3300031507 Ga0307509_10248144 Ga0307509_102481441 189
253 3300031838 Ga0307518_10379877 Ga0307518_103798771 189
254 3300033179 Ga0307507_10086550 Ga0307507_100865505 189
255 3300033179 Ga0307507_10261694 Ga0307507_102616942 189
256 3300034816 Ga0373930_0059339 Ga0373930_0059339_245_826 189
257 3300034817 Ga0373948_0050041 Ga0373948_0050041_285_863 189
258 3300034819 Ga0373958_0035179 Ga0373958_0035179_140_721 189
259 3300035083 Ga0373926_0000481 Ga0373926_0000481_3244_3825 189
260 3300035084 Ga0373928_0084440 Ga0373928_0084440_159_740 189
261 3300035085 Ga0373929_0007875 Ga0373929_0007875_946_1524 189
262 3300035086 Ga0373934_0005465 Ga0373934_0005465_3427_4008 189
263 3300035089 Ga0373944_0001985 Ga0373944_0001985_1446_2027 189
264 3300035091 Ga0373951_0028555 Ga0373951_0028555_446_1027 189
265 3300035111 Ga0373923_0011900 Ga0373923_0011900_2378_2959 189
266 3300035113 Ga0373936_0001923 Ga0373936_0001923_1078_1659 189
267 3300035114 Ga0373939_0014909 Ga0373939_0014909_556_1134 189
268 3300035114 Ga0373939_0061737 Ga0373939_0061737_285_866 189
269 3300035116 Ga0373945_0003715 Ga0373945_0003715_2331_2912 189
270 3300035117 Ga0373953_0004159 Ga0373953_0004159_804_1385 189
271 3300035118 Ga0373954_0004938 Ga0373954_0004938_1957_2538 189
272 3300035170 Ga0373943_0005979 Ga0373943_0005979_2359_2940 189
273 3300035172 Ga0373955_0008996 Ga0373955_0008996_840_1421 189
274 3300035207 Ga0373942_0009141 Ga0373942_0009141_159_737 189
275 3300035241 Ga0373961_0093510 Ga0373961_0093510_26_607 189
276 3300035242 Ga0373962_0058434 Ga0373962_0058434_222_803 189
277 3300035242 Ga0373962_0071679 Ga0373962_0071679_77_655 189
278 3300035691 Ga0373931_0099228 Ga0373931_0099228_643_1221 189
279 3300035691 Ga0373931_0207882 Ga0373931_0207882_361_942 189
280 3300035692 Ga0373935_0000226 Ga0373935_0000226_24780_25361 189
281 3300035695 Ga0373927_0001109 Ga0373927_0001109_2377_2958 189
282 3300035724 Ga0373933_0015466 Ga0373933_0015466_1295_1876 189
283 3300035725 Ga0373947_0030651 Ga0373947_0030651_235_816 189
284 3300037068 Ga0373925_0005454 Ga0373925_0005454_6541_7122 189
285 3300037853 Ga0436364_1059010 Ga0436364_1059010_5501_6088 189
286 3300039438 Ga0436360_0677530 Ga0436360_0677530_52_627 189
287 3300044684 Ga0466966_0009818 Ga0466966_0009818_5439_6014 189
288 3300044684 Ga0466966_0022445 Ga0466966_0022445_2418_2993 189
289 3300044693 Ga0466961_0049816 Ga0466961_0049816_746_1321 189
290 3300044694 Ga0466963_0154842 Ga0466963_0154842_832_1407 189
291 3300044765 Ga0466970_0019133 Ga0466970_0019133_2040_2615 189
292 3300045049 Ga0466959_0062922 Ga0466959_0062922_831_1406 189
293 3300045836 Ga0466958_0027487 Ga0466958_0027487_2145_2720 189
294 3300045836 Ga0466958_0048938 Ga0466958_0048938_268_843 189
295 3300046453 Ga0495627_063795 Ga0495627_063795_308_889 189
296 3300046454 Ga0495592_0004625 Ga0495592_0004625_2346_2927 189
297 3300046455 Ga0495603_0006041 Ga0495603_0006041_4297_4878 189
298 3300046459 Ga0495629_0007247 Ga0495629_0007247_5291_5872 189
299 3300046459 Ga0495629_0454720 Ga0495629_0454720_134_709 189
300 3300046461 Ga0495641_0004177 Ga0495641_0004177_2337_2918 189
301 3300046462 Ga0495651_0026018 Ga0495651_0026018_2204_2785 189
302 3300046472 Ga0495580_0010059 Ga0495580_0010059_2357_2938 189
303 3300046473 Ga0495582_0002725 Ga0495582_0002725_2357_2938 189
304 3300046475 Ga0495639_0003351 Ga0495639_0003351_2356_2937 189
305 3300046476 Ga0495662_0000330 Ga0495662_0000330_2370_2951 189
306 3300046477 Ga0495664_0055289 Ga0495664_0055289_1689_2264 189
307 3300046499 Ga0495594_0004876 Ga0495594_0004876_3950_4531 189
308 3300046511 Ga0495608_0013593 Ga0495608_0013593_2357_2938 189
309 3300046514 Ga0495618_0000107 Ga0495618_0000107_11842_12414 189
310 3300046514 Ga0495618_0025463 Ga0495618_0025463_2141_2722 189
311 3300046517 Ga0495630_0006764 Ga0495630_0006764_2378_2959 189
312 3300046526 Ga0495666_0024750 Ga0495666_0024750_351_932 189
313 3300046531 Ga0495665_0006498 Ga0495665_0006498_2378_2959 189
314 3300046533 Ga0495640_0012364 Ga0495640_0012364_3569_4150 189
315 3300046533 Ga0495640_0042948 Ga0495640_0042948_426_1001 189
316 3300046535 Ga0495586_0029450 Ga0495586_0029450_74_655 189
317 3300046536 Ga0495587_0003495 Ga0495587_0003495_7676_8257 189
318 3300046543 Ga0495645_0010626 Ga0495645_0010626_2356_2937 189
319 3300046559 Ga0495667_0027919 Ga0495667_0027919_845_1426 189
320 3300046674 Ga0495588_0046159 Ga0495588_0046159_1376_1957 189
321 3300046678 Ga0495599_0005475 Ga0495599_0005475_2331_2912 189
322 3300046679 Ga0495623_0009059 Ga0495623_0009059_2350_2931 189
323 3300046680 Ga0495646_0024844 Ga0495646_0024844_845_1426 189
324 3300046681 Ga0495647_0010800 Ga0495647_0010800_2126_2707 189
325 3300046683 Ga0495658_0008596 Ga0495658_0008596_1078_1659 189
326 3300046689 Ga0495613_0003215 Ga0495613_0003215_9238_9819 189
327 3300046690 Ga0495624_0007424 Ga0495624_0007424_6782_7363 189
328 3300046690 Ga0495624_0066960 Ga0495624_0066960_1567_2145 189
329 3300046809 Ga0495600_0041437 Ga0495600_0041437_75_656 189
330 3300047315 Ga0495581_0007583 Ga0495581_0007583_2371_2952 189
331 3300047317 Ga0495604_0023139 Ga0495604_0023139_2378_2959 189
332 3300047319 Ga0495674_0018498 Ga0495674_0018498_2378_2959 189
333 3300047321 Ga0495676_0022504 Ga0495676_0022504_2378_2959 189
334 3300047444 Ga0495675_0000440 Ga0495675_0000440_2181_2762 189
335 3300047673 Ga0495593_0002885 Ga0495593_0002885_2040_2621 189
336 3300048088 Ga0495602_0162434 Ga0495602_0162434_845_1426 189
337 3300048088 Ga0495602_0367629 Ga0495602_0367629_234_809 189
338 3300048089 Ga0495614_0008142 Ga0495614_0008142_555_1136 189
339 3300048903 Ga0496100_0344392 Ga0496100_0344392_416_997 189
340 3300048904 Ga0496101_0102112 Ga0496101_0102112_719_1336 189
341 3300048905 Ga0496102_0354075 Ga0496102_0354075_285_863 189
342 3300048907 Ga0496104_0000174 Ga0496104_0000174_28808_29380 189
343 3300048907 Ga0496104_0261761 Ga0496104_0261761_824_1402 189
344 3300048907 Ga0496104_0346877 Ga0496104_0346877_145_726 189
345 3300048907 Ga0496104_0420983 Ga0496104_0420983_609_1190 189
346 3300048908 Ga0496105_0098346 Ga0496105_0098346_688_1266 189
347 3300048908 Ga0496105_0604577 Ga0496105_0604577_224_805 189
348 3300048909 Ga0496106_0118332 Ga0496106_0118332_1058_1639 189
349 3300048909 Ga0496106_0172606 Ga0496106_0172606_379_957 189
350 3300048910 Ga0496107_0145409 Ga0496107_0145409_1020_1598 189
351 3300048910 Ga0496107_0166111 Ga0496107_0166111_327_908 189
352 3300048911 Ga0496108_0050581 Ga0496108_0050581_583_1161 189
353 3300048911 Ga0496108_0817138 Ga0496108_0817138_203_784 189
354 3300048912 Ga0496109_0011607 Ga0496109_0011607_695_1273 189
355 3300048912 Ga0496109_0051182 Ga0496109_0051182_101_682 189
356 3300048913 Ga0496110_0000040 Ga0496110_0000040_33518_34090 189
357 3300048913 Ga0496110_0120198 Ga0496110_0120198_797_1375 189
358 3300048913 Ga0496110_1098371 Ga0496110_1098371_50_628 189
359 3300048914 Ga0496111_0003974 Ga0496111_0003974_5544_6116 189
360 3300048915 Ga0496112_0260343 Ga0496112_0260343_971_1549 189
361 3300048916 Ga0496113_0128642 Ga0496113_0128642_945_1523 189
362 3300048917 Ga0496114_0042478 Ga0496114_0042478_1897_2475 189
363 3300048917 Ga0496114_0208835 Ga0496114_0208835_80_652 189
364 3300048918 Ga0496115_0263081 Ga0496115_0263081_284_862 189
365 3300049570 Ga0501033_0020361 Ga0501033_0020361_1807_2382 189
366 3300049571 Ga0501034_0003177 Ga0501034_0003177_11451_12026 189
367 3300049572 Ga0501036_0381575 Ga0501036_0381575_543_1118 189
368 3300049573 Ga0501037_0065475 Ga0501037_0065475_1125_1700 189
369 3300049581 Ga0501047_0013259 Ga0501047_0013259_677_1252 189
370 3300049584 Ga0501068_0648654 Ga0501068_0648654_42_632 189
371 3300049586 Ga0501070_0637074 Ga0501070_0637074_73_648 189
372 3300049823 Ga0501044_0003295 Ga0501044_0003295_7896_8471 189
373 3300050492 nmdc:mga0yw44_10723_c1 nmdc:mga0yw44_10723_c1_3253_3825 189
374 3300050512 nmdc:mga0n895_38273_c1 nmdc:mga0n895_38273_c1_611_1189 189
375 3300050513 nmdc:mga0rr50_426466_c1 nmdc:mga0rr50_426466_c1_481_1110 189
376 3300050513 nmdc:mga0rr50_776321_c1 nmdc:mga0rr50_776321_c1_167_745 189
377 3300050515 nmdc:mga0a205_47198_c1 nmdc:mga0a205_47198_c1_1070_1648 189
378 3300053077 Ga0495601_0010558 Ga0495601_0010558_2374_2955 189
379 3300053078 Ga0495612_0001401 Ga0495612_0001401_2350_2931 189
380 3300053084 Ga0495595_0004553 Ga0495595_0004553_1561_2142 189
381 3300061719 Ga0466962_0055348 Ga0466962_0055348_1260_1835 189
382 3300005355 Ga0070671_100159750 Ga0070671_1001597503 190
383 3300025931 Ga0207644_10336104 Ga0207644_103361042 190
384 3300028794 Ga0307515_10229489 Ga0307515_102294892 190
385 3300028794 Ga0307515_10302297 Ga0307515_103022972 190
386 3300048929 Ga0496126_0024905 Ga0496126_0024905_3674_4264 190
387 3300048929 Ga0496126_0136497 Ga0496126_0136497_1160_1741 190
388 3300049586 Ga0501070_0099142 Ga0501070_0099142_1533_2123 190
389 3300049589 Ga0501073_0000025 Ga0501073_0000025_48525_49172 190
390 3300049590 Ga0501074_0095426 Ga0501074_0095426_861_1451 190
391 3300049742 Ga0501080_0015153 Ga0501080_0015153_2285_2875 190
392 3300060353 Ga0501082_0854602 Ga0501082_0854602_63_701 190
393 3300003792 Ga0055540_1011397 Ga0055540_10113973 191
394 3300003792 Ga0055540_1013120 Ga0055540_10131203 191
395 3300006051 Ga0075364_10320044 Ga0075364_103200442 191
396 3300025303 Ga0209051_1001324 Ga0209051_100132411 191
397 3300025303 Ga0209051_1001675 Ga0209051_10016754 191

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

23

171

0.94

PF02525

Flavodoxin_2

Flavodoxin-like fold

23

161

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gfq-assembly1.cif.gz_A structure of yhda, k109l variant 0.8381 5 181
2fzv-assembly1.cif.gz_D crystal structure of an apo form of a flavin-binding protein from shigella flexneri 0.8277 2 186
3gfq-assembly1.cif.gz_A structure of yhda, k109l variant 0.8244 5 181
6dgi-assembly1.cif.gz_B the crystal structure of d-alanyl-alanine synthetase a from vibrio cholerae o1 biovar eltor str. n16961 0.8237 2 43
3gfr-assembly2.cif.gz_B structure of yhda, d137l variant 0.8227 5 180
ID Description Score Start End Superfamily
af_Q9USJ6_13_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9549 4 147 3.40.50.360
af_Q9USJ6_13_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8307 4 147 3.40.50.360
af_Q2G0L7_1_184_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8143 2 180 3.40.50.360
2fzvC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.812 2 187 3.40.50.360
2gswD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8058 6 181 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A7Z1AUH0-F1-model_v4 NADPH-dependent FMN reductase 0.9921 1 188 GO:0005829
GO:0010181
GO:0016491
AF-A0A260VZG8-F1-model_v4 NADPH-dependent FMN reductase 0.9907 1 185 GO:0005829
GO:0010181
GO:0016491
AF-A0A5M3XMH6-F1-model_v4 FMN reductase 0.9889 1 186 GO:0005829
GO:0010181
GO:0016491
AF-A0A7Z1AUH0-F1-model_v4 NADPH-dependent FMN reductase 0.9868 1 188 GO:0005829
GO:0010181
GO:0016491
AF-A0A4R7W711-F1-model_v4 Flavin-dependent monooxygenase (TetX monooxygenase) (TetX) (EC 1.14.13.-) 0.9856 2 186 GO:0004497
GO:0005737
GO:0046677
GO:0071949

Feature Viewer

pLDDT pTM Quality
93.16 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map