F433792

General Info

Members Datasets Scaffolds Average Seq Length
397 183 794 110

Family's Representative Sequence

Representative Sequence 3300025944|Ga0207661_10005126|Ga0207661_1000512612
Length 110
Sequence MSTDTDRIRFLNDQLRQNLPGGRAVITPGIAALGPEAVARLIRTIAVFDDFSHANDPYQEHDAGSFKFDDEIEVIFKIDYFDRSLNFHSRDPADPSVTTRVITVMRADEY

Samples

Sample ID Description Type Environment
1 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
63 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
64 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
97 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
98 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
99 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
100 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
101 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
102 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
103 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
124 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
136 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
166 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
172 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
174 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
175 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
176 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
177 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
178 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
179 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
180 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
181 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
182 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
183 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.73
Metatranscriptomes 0
Isolates 2.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.53
Nodule 1.51
Rhizoplane 15.11
Rhizosphere 77.33
Stem 0
Stem Tuber 0
Unclassified 31.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207661_10005126 3300025944 Bacteria 9200
2 JGI25153J46596_10000419 3300003215 Bacteria 27875
3 JGI25160J50197_1050064 3300003354 Bacteria 892
4 Ga0055539_1004504 3300003752 Bacteria 1854
5 Ga0065165_1006820 3300005262 Bacteria 5826
6 Ga0070683_100010771 3300005329 Bacteria 7869
7 Ga0070690_100845497 3300005330 Bacteria 712
8 Ga0070670_100065961 3300005331 Bacteria 3106
9 Ga0070670_100253866 3300005331 Bacteria 1532
10 Ga0070689_100432774 3300005340 Unclassified 1117
11 Ga0070689_100546171 3300005340 Bacteria 998
12 Ga0070691_10599420 3300005341 Bacteria 650
13 Ga0070675_101503856 3300005354 Bacteria 621
14 Ga0070671_100129617 3300005355 Bacteria 2124
15 Ga0070671_100405585 3300005355 Unclassified 1166
16 Ga0070671_100717052 3300005355 Unclassified 868
17 Ga0070673_100257216 3300005364 Bacteria 1524
18 Ga0070673_101494891 3300005364 Bacteria 637
19 Ga0070688_100740193 3300005365 Unclassified 764
20 Ga0070688_101081703 3300005365 Unclassified 640
21 Ga0070667_101563693 3300005367 Bacteria 620
22 Ga0070709_11229111 3300005434 Unclassified 603
23 Ga0070714_100443768 3300005435 Bacteria 1232
24 Ga0070714_101358640 3300005435 Unclassified 694
25 Ga0070711_100606360 3300005439 Bacteria 914
26 Ga0070708_100975573 3300005445 Unclassified 795
27 Ga0070663_100570678 3300005455 Unclassified 948
28 Ga0070678_101296916 3300005456 Bacteria 677
29 Ga0070681_10255812 3300005458 Bacteria 1663
30 Ga0070706_100358092 3300005467 Unclassified 1360
31 Ga0070698_100144183 3300005471 Bacteria 2332
32 Ga0070698_100324531 3300005471 Bacteria 1470
33 Ga0070698_100479670 3300005471 Unclassified 1180
34 Ga0070699_100392153 3300005518 Unclassified 1255
35 Ga0070679_100079657 3300005530 Bacteria 3265
36 Ga0070679_100788368 3300005530 Unclassified 893
37 Ga0070684_100346250 3300005535 Bacteria 1366
38 Ga0070684_100700909 3300005535 Bacteria 944
39 Ga0070684_101374543 3300005535 Unclassified 665
40 Ga0070684_102124085 3300005535 Bacteria 530
41 Ga0068853_102172580 3300005539 Unclassified 538
42 Ga0070672_100808935 3300005543 Bacteria 825
43 Ga0070672_101757149 3300005543 Bacteria 557
44 Ga0070665_100543900 3300005548 Unclassified 1173
45 Ga0070665_100614780 3300005548 Bacteria 1100
46 Ga0070704_102049005 3300005549 Unclassified 531
47 Ga0068855_101269861 3300005563 Unclassified 763
48 Ga0070664_100261000 3300005564 Bacteria 1559
49 Ga0070702_100669174 3300005615 Bacteria 787
50 Ga0068851_10951526 3300005834 Bacteria 540
51 Ga0068870_10941993 3300005840 Bacteria 612
52 Ga0068863_101624713 3300005841 Bacteria 656
53 Ga0081455_10029391 3300005937 Bacteria 5011
54 Ga0070717_10319792 3300006028 Bacteria 1382
55 Ga0070717_10333961 3300006028 Bacteria 1352
56 Ga0070717_10618584 3300006028 Bacteria 983
57 Ga0075368_10341948 3300006042 Bacteria 650
58 Ga0070712_100762435 3300006175 Unclassified 828
59 Ga0070712_100949998 3300006175 Unclassified 742
60 Ga0070712_101197650 3300006175 Bacteria 661
61 Ga0070712_101977082 3300006175 Bacteria 511
62 Ga0070712_102022764 3300006175 Unclassified 504
63 Ga0070712_102045660 3300006175 Bacteria 502
64 Ga0075370_11009779 3300006353 Bacteria 510
65 Ga0075431_101002105 3300006847 Unclassified 802
66 Ga0075429_101101045 3300006880 Unclassified 694
67 Ga0099795_10009735 3300007788 Bacteria 2800
68 Ga0105240_10000484 3300009093 Bacteria 73546
69 Ga0111539_11840628 3300009094 Bacteria 702
70 Ga0105247_10177290 3300009101 Bacteria 1420
71 Ga0105247_10397257 3300009101 Bacteria 981
72 Ga0114129_10444794 3300009147 Bacteria 1701
73 Ga0105243_10462335 3300009148 Bacteria 1193
74 Ga0105242_11980811 3300009176 Bacteria 624
75 Ga0105237_10010727 3300009545 Bacteria 9722
76 Ga0105237_10726673 3300009545 Unclassified 999
77 Ga0105237_11599877 3300009545 Unclassified 658
78 Ga0105249_12443679 3300009553 Bacteria 595
79 Ga0099796_10241979 3300010159 Unclassified 746
80 Ga0105239_10074777 3300010375 Bacteria 3725
81 Ga0105239_10405984 3300010375 Bacteria 1542
82 Ga0105239_11221412 3300010375 Unclassified 866
83 Ga0105239_12540234 3300010375 Bacteria 597
84 Ga0105246_10443167 3300011119 Bacteria 1089
85 Ga0105246_10503375 3300011119 Bacteria 1029
86 Ga0157374_10807104 3300013296 Unclassified 954
87 Ga0163162_12391117 3300013306 Bacteria 607
88 Ga0157372_13329251 3300013307 Bacteria 512
89 Ga0157375_12945198 3300013308 Bacteria 569
90 Ga0163163_10024059 3300014325 Bacteria 5794
91 Ga0163163_10157837 3300014325 Unclassified 2313
92 Ga0163163_10666769 3300014325 Bacteria 1104
93 Ga0163163_10741817 3300014325 Unclassified 1045
94 Ga0163163_11394854 3300014325 Bacteria 762
95 Ga0163163_11502964 3300014325 Unclassified 735
96 Ga0163163_11643973 3300014325 Unclassified 703
97 Ga0224572_1042634 3300024225 Bacteria 853
98 Ga0228598_1007873 3300024227 Unclassified 2161
99 Ga0228598_1025099 3300024227 Unclassified 1172
100 Ga0228598_1026455 3300024227 Unclassified 1141
101 Ga0228598_1038700 3300024227 Unclassified 941
102 Ga0228598_1097477 3300024227 Unclassified 593
103 Ga0209677_100102 3300025253 Bacteria 91491
104 Ga0209758_1000165 3300025297 Bacteria 151122
105 Ga0209758_1001237 3300025297 Bacteria 31904
106 Ga0207426_1018379 3300025302 Bacteria 2463
107 Ga0207692_10691363 3300025898 Unclassified 661
108 Ga0207710_10342987 3300025900 Bacteria 760
109 Ga0207699_10166047 3300025906 Bacteria 1473
110 Ga0207684_11058698 3300025910 Bacteria 677
111 Ga0207654_11096269 3300025911 Bacteria 580
112 Ga0207671_10007181 3300025914 Bacteria 9707
113 Ga0207693_10125200 3300025915 Bacteria 2019
114 Ga0207693_10824003 3300025915 Unclassified 714
115 Ga0207663_11156202 3300025916 Unclassified 623
116 Ga0207649_10489521 3300025920 Bacteria 934
117 Ga0207652_10060062 3300025921 Bacteria 3279
118 Ga0207650_10003653 3300025925 Bacteria 10526
119 Ga0207650_10034874 3300025925 Bacteria 3651
120 Ga0207650_10097372 3300025925 Bacteria 2258
121 Ga0207664_10408049 3300025929 Bacteria 1209
122 Ga0207664_10782162 3300025929 Bacteria 859
123 Ga0207644_10362502 3300025931 Unclassified 1179
124 Ga0207644_10441852 3300025931 Unclassified 1068
125 Ga0207644_10914925 3300025931 Unclassified 735
126 Ga0207644_11826529 3300025931 Unclassified 508
127 Ga0207706_10832454 3300025933 Unclassified 782
128 Ga0207709_11055239 3300025935 Bacteria 666
129 Ga0207670_10352575 3300025936 Bacteria 1166
130 Ga0207670_10447430 3300025936 Unclassified 1041
131 Ga0207669_10923737 3300025937 Bacteria 730
132 Ga0207665_11114225 3300025939 Unclassified 629
133 Ga0207691_10818117 3300025940 Bacteria 782
134 Ga0207661_10689652 3300025944 Bacteria 939
135 Ga0207661_11543168 3300025944 Unclassified 608
136 Ga0207679_10263492 3300025945 Bacteria 1471
137 Ga0207679_10854744 3300025945 Unclassified 831
138 Ga0207679_11318909 3300025945 Bacteria 662
139 Ga0207679_11827522 3300025945 Bacteria 555
140 Ga0207651_10282272 3300025960 Unclassified 1373
141 Ga0207651_10892811 3300025960 Bacteria 791
142 Ga0207678_10258449 3300026067 Bacteria 1492
143 Ga0207678_11328184 3300026067 Bacteria 636
144 Ga0207678_11747344 3300026067 Unclassified 545
145 Ga0207641_10407442 3300026088 Bacteria 1307
146 Ga0207641_11321144 3300026088 Bacteria 722
147 Ga0207674_10859747 3300026116 Bacteria 875
148 Ga0207683_11248427 3300026121 Bacteria 688
149 Ga0207683_11431957 3300026121 Bacteria 639
150 Ga0209813_10442283 3300027866 Bacteria 530
151 Ga0268266_10489630 3300028379 Unclassified 1173
152 Ga0268266_10584812 3300028379 Bacteria 1072
153 Ga0265334_10011368 3300028573 Bacteria 3749
154 Ga0265338_11156118 3300028800 Unclassified 520
155 Ga0265339_10013430 3300031249 Bacteria 4961
156 Ga0265339_10053348 3300031249 Bacteria 2199
157 Ga0265314_10205076 3300031711 Bacteria 1162
158 Ga0373934_0074578 3300035086 Bacteria 1359
159 Ga0373956_0053117 3300035119 Bacteria 1824
160 Ga0373943_0100050 3300035170 Archaea 1515
161 Ga0373946_0042708 3300035171 Archaea 1865
162 Ga0373955_0091648 3300035172 Bacteria 1733
163 Ga0373955_0262541 3300035172 Unclassified 1037
164 Ga0373955_0913327 3300035172 Unclassified 540
165 Ga0373955_1023658 3300035172 Bacteria 509
166 Ga0373924_0218073 3300035410 Unclassified 843
167 Ga0373935_0115032 3300035692 Archaea 1790
168 Ga0373935_1167514 3300035692 Unclassified 574
169 Ga0373935_1269571 3300035692 Unclassified 550
170 Ga0373927_0460859 3300035695 Unclassified 840
171 Ga0373933_0073955 3300035724 Bacteria 2077
172 Ga0373933_0504257 3300035724 Bacteria 793
173 Ga0373947_0002184 3300035725 Bacteria 11875
174 Ga0373947_0134198 3300035725 Bacteria 1583
175 Ga0373937_0013487 3300036401 Bacteria 7197
176 Ga0373937_0444724 3300036401 Unclassified 1231
177 Ga0373937_0501934 3300036401 Bacteria 1153
178 Ga0373937_0571860 3300036401 Bacteria 1073
179 Ga0373937_0797035 3300036401 Bacteria 892
180 Ga0373937_0878654 3300036401 Unclassified 845
181 Ga0373937_1307849 3300036401 Bacteria 673
182 Ga0373937_1719100 3300036401 Unclassified 574
183 Ga0373925_0023827 3300037068 Bacteria 4465
184 Ga0373925_0672742 3300037068 Unclassified 853
185 Ga0373925_0760800 3300037068 Unclassified 799
186 Ga0373925_1206098 3300037068 Unclassified 622
187 Ga0436364_0450790 3300037853 Unclassified 936
188 Ga0436365_1106415 3300039437 Bacteria 1671
189 Ga0451853_0634151 3300041512 Unclassified 605
190 Ga0466972_0004253 3300044658 Bacteria 7157
191 Ga0495592_0020199 3300046454 Bacteria 5067
192 Ga0495592_0105330 3300046454 Bacteria 2004
193 Ga0495603_0006649 3300046455 Bacteria 6937
194 Ga0495603_0596817 3300046455 Bacteria 632
195 Ga0495629_0070546 3300046459 Bacteria 2438
196 Ga0495629_0149913 3300046459 Unclassified 1621
197 Ga0495629_0173176 3300046459 Bacteria 1497
198 Ga0495629_0277146 3300046459 Unclassified 1151
199 Ga0495641_0267809 3300046461 Bacteria 769
200 Ga0495651_0156627 3300046462 Bacteria 1636
201 Ga0495651_0999695 3300046462 Unclassified 508
202 Ga0495653_0015909 3300046463 Bacteria 6132
203 Ga0495653_0263336 3300046463 Bacteria 1139
204 Ga0495653_0489424 3300046463 Unclassified 768
205 Ga0495653_0635315 3300046463 Unclassified 653
206 Ga0495653_0908149 3300046463 Unclassified 524
207 Ga0495582_0030825 3300046473 Plasmid 2946
208 Ga0495582_0069249 3300046473 Bacteria 1951
209 Ga0495639_0119156 3300046475 Unclassified 1258
210 Ga0495662_0054832 3300046476 Bacteria 1926
211 Ga0495662_0434066 3300046476 Unclassified 645
212 Ga0495594_0285753 3300046499 Bacteria 940
213 Ga0495608_0160534 3300046511 Bacteria 1429
214 Ga0495608_0854374 3300046511 Unclassified 535
215 Ga0495618_0067785 3300046514 Bacteria 2269
216 Ga0495618_0091493 3300046514 Unclassified 1945
217 Ga0495618_0164080 3300046514 Bacteria 1415
218 Ga0495618_0324318 3300046514 Archaea 953
219 Ga0495628_0218471 3300046516 Bacteria 1432
220 Ga0495628_0281123 3300046516 Bacteria 1236
221 Ga0495628_0679124 3300046516 Unclassified 729
222 Ga0495628_0864276 3300046516 Unclassified 630
223 Ga0495628_0885548 3300046516 Bacteria 620
224 Ga0495652_0156372 3300046529 Bacteria 1775
225 Ga0495652_0275831 3300046529 Bacteria 1234
226 Ga0495652_0642133 3300046529 Bacteria 720
227 Ga0495652_0749592 3300046529 Unclassified 653
228 Ga0495652_0821082 3300046529 Unclassified 618
229 Ga0495640_0009393 3300046533 Bacteria 7616
230 Ga0495640_0202841 3300046533 Bacteria 1256
231 Ga0495640_0381360 3300046533 Unclassified 867
232 Ga0495587_0022227 3300046536 Unclassified 3906
233 Ga0495667_0304632 3300046559 Bacteria 1009
234 Ga0495667_0367541 3300046559 Unclassified 908
235 Ga0495667_0508455 3300046559 Bacteria 754
236 Ga0495634_0005556 3300046642 Bacteria 9676
237 Ga0495634_0033606 3300046642 Bacteria 3524
238 Ga0495634_0080191 3300046642 Bacteria 2136
239 Ga0495634_0514005 3300046642 Unclassified 701
240 Ga0495635_0763047 3300046663 Bacteria 625
241 Ga0495657_0282680 3300046675 Bacteria 993
242 Ga0495657_0744138 3300046675 Unclassified 562
243 Ga0495599_0012717 3300046678 Bacteria 5191
244 Ga0495599_0116729 3300046678 Bacteria 1660
245 Ga0495599_0372260 3300046678 Unclassified 854
246 Ga0495599_0518695 3300046678 Unclassified 700
247 Ga0495599_0686188 3300046678 Bacteria 591
248 Ga0495623_0100853 3300046679 Bacteria 1759
249 Ga0495623_0656625 3300046679 Bacteria 540
250 Ga0495646_0027784 3300046680 Unclassified 3547
251 Ga0495646_0135411 3300046680 Bacteria 1383
252 Ga0495646_0659227 3300046680 Unclassified 528
253 Ga0495613_0071764 3300046689 Unclassified 2524
254 Ga0495613_0856915 3300046689 Unclassified 590
255 Ga0495624_0098359 3300046690 Archaea 1802
256 Ga0495624_0148345 3300046690 Bacteria 1435
257 Ga0495624_0151398 3300046690 Bacteria 1419
258 Ga0495581_0105779 3300047315 Bacteria 1635
259 Ga0495581_0179645 3300047315 Bacteria 1237
260 Ga0495604_0245693 3300047317 Bacteria 1222
261 Ga0495604_0290057 3300047317 Bacteria 1102
262 Ga0495674_0016222 3300047319 Bacteria 6949
263 Ga0495674_0026593 3300047319 Bacteria 5294
264 Ga0495674_0053687 3300047319 Bacteria 3541
265 Ga0495674_0318131 3300047319 Bacteria 1268
266 Ga0495674_0565669 3300047319 Bacteria 904
267 Ga0495674_0707314 3300047319 Unclassified 790
268 Ga0495674_1268341 3300047319 Unclassified 554
269 Ga0495676_0011110 3300047321 Bacteria 8136
270 Ga0495676_0412968 3300047321 Bacteria 894
271 Ga0495676_0615943 3300047321 Unclassified 706
272 Ga0495680_0027576 3300047322 Bacteria 4664
273 Ga0495680_0124776 3300047322 Bacteria 1898
274 Ga0495680_0257235 3300047322 Unclassified 1236
275 Ga0495680_0285685 3300047322 Bacteria 1161
276 Ga0495680_0513734 3300047322 Bacteria 812
277 Ga0495680_0745307 3300047322 Bacteria 644
278 Ga0495680_0945831 3300047322 Unclassified 554
279 Ga0495684_1008781 3300047471 Bacteria 528
280 Ga0495593_0129703 3300047673 Unclassified 1280
281 Ga0495602_0057951 3300048088 Unclassified 3394
282 Ga0495602_0190324 3300048088 Bacteria 1574
283 Ga0495602_0203777 3300048088 Bacteria 1507
284 Ga0495602_0351762 3300048088 Bacteria 1063
285 Ga0495602_0600806 3300048088 Bacteria 757
286 Ga0495602_0739515 3300048088 Bacteria 665
287 Ga0496100_0881248 3300048903 Unclassified 703
288 Ga0496100_1078632 3300048903 Bacteria 633
289 Ga0496101_0360050 3300048904 Bacteria 1144
290 Ga0496102_0030189 3300048905 Bacteria 4851
291 Ga0496102_0228842 3300048905 Bacteria 1753
292 Ga0496102_0468139 3300048905 Unclassified 1181
293 Ga0496102_1355727 3300048905 Bacteria 630
294 Ga0496103_0284293 3300048906 Bacteria 1064
295 Ga0496103_0510689 3300048906 Unclassified 769
296 Ga0496104_0006986 3300048907 Bacteria 9954
297 Ga0496104_0089749 3300048907 Bacteria 2936
298 Ga0496104_0160928 3300048907 Bacteria 2153
299 Ga0496104_1468316 3300048907 Bacteria 585
300 Ga0496105_0017264 3300048908 Bacteria 5782
301 Ga0496105_0024057 3300048908 Bacteria 4947
302 Ga0496105_0101888 3300048908 Bacteria 2371
303 Ga0496106_0184563 3300048909 Bacteria 1657
304 Ga0496107_0212137 3300048910 Bacteria 1440
305 Ga0496108_0007476 3300048911 Bacteria 8855
306 Ga0496108_0025522 3300048911 Bacteria 4870
307 Ga0496108_0096869 3300048911 Bacteria 2513
308 Ga0496108_0226910 3300048911 Bacteria 1623
309 Ga0496108_0261052 3300048911 Unclassified 1507
310 Ga0496108_0739104 3300048911 Unclassified 852
311 Ga0496109_0002631 3300048912 Bacteria 15054
312 Ga0496109_0033492 3300048912 Bacteria 4622
313 Ga0496109_0251187 3300048912 Bacteria 1665
314 Ga0496109_1301054 3300048912 Bacteria 663
315 Ga0496109_1532912 3300048912 Unclassified 601
316 Ga0496110_0018544 3300048913 Bacteria 5835
317 Ga0496110_0024605 3300048913 Bacteria 5134
318 Ga0496110_0056123 3300048913 Bacteria 3466
319 Ga0496110_0128255 3300048913 Bacteria 2289
320 Ga0496110_0647510 3300048913 Bacteria 956
321 Ga0496110_1050798 3300048913 Unclassified 722
322 Ga0496110_1233150 3300048913 Unclassified 657
323 Ga0496110_1303760 3300048913 Bacteria 635
324 Ga0496110_1499536 3300048913 Unclassified 584
325 Ga0496111_0037846 3300048914 Bacteria 3454
326 Ga0496111_0123360 3300048914 Bacteria 1914
327 Ga0496111_0655766 3300048914 Bacteria 765
328 Ga0496112_0003073 3300048915 Bacteria 13667
329 Ga0496112_0003162 3300048915 Bacteria 13528
330 Ga0496112_0009441 3300048915 Bacteria 8792
331 Ga0496112_0051833 3300048915 Bacteria 4025
332 Ga0496112_0234149 3300048915 Unclassified 1791
333 Ga0496112_0385183 3300048915 Unclassified 1343
334 Ga0496112_0426840 3300048915 Unclassified 1264
335 Ga0496112_0779543 3300048915 Bacteria 881
336 Ga0496112_0791030 3300048915 Bacteria 874
337 Ga0496112_1881254 3300048915 Bacteria 510
338 Ga0496113_0008151 3300048916 Bacteria 6804
339 Ga0496113_0034022 3300048916 Bacteria 3715
340 Ga0496113_0039711 3300048916 Bacteria 3465
341 Ga0496113_0075146 3300048916 Bacteria 2578
342 Ga0496113_0357020 3300048916 Bacteria 1172
343 Ga0496114_1088316 3300048917 Unclassified 684
344 Ga0496115_0177218 3300048918 Bacteria 1763
345 Ga0496115_0282768 3300048918 Bacteria 1362
346 Ga0496115_0966263 3300048918 Bacteria 653
347 Ga0496126_0012511 3300048929 Bacteria 8688
348 Ga0496126_0219195 3300048929 Unclassified 1599
349 Ga0496126_0463341 3300048929 Bacteria 1018
350 Ga0496126_0634060 3300048929 Unclassified 838
351 Ga0501076_1217038 3300049592 Unclassified 620
352 nmdc:mga0yw44_665567_c1 3300050492 Bacteria 707
353 nmdc:mga04h51_284767_c1 3300050495 Bacteria 670
354 nmdc:mga05p37_24256_c2 3300050507 Bacteria 2756
355 nmdc:mga06r32_967523_c1 3300050510 Unclassified 805
356 nmdc:mga0n895_936701_c1 3300050512 Unclassified 850
357 Ga0495601_0002592 3300053077 Bacteria 10247
358 Ga0495601_0013199 3300053077 Bacteria 4967
359 Ga0495601_0027743 3300053077 Bacteria 3502
360 Ga0495601_0052859 3300053077 Plasmid 2566
361 Ga0495601_0083930 3300053077 Bacteria 2046
362 Ga0495601_0099181 3300053077 Bacteria 1880
363 Ga0495601_0108105 3300053077 Unclassified 1799
364 Ga0495601_0344329 3300053077 Bacteria 970
365 Ga0495601_0579981 3300053077 Unclassified 720
366 Ga0495601_0616033 3300053077 Unclassified 696
367 Ga0495601_0861525 3300053077 Bacteria 573
368 Ga0495612_0023039 3300053078 Unclassified 2497
369 Ga0495612_0322891 3300053078 Bacteria 694
370 Ga0495612_0382670 3300053078 Unclassified 638
371 Ga0495595_0000623 3300053084 Bacteria 13503
372 Ga0495595_0026486 3300053084 Bacteria 2577
373 Ga0495595_0291202 3300053084 Unclassified 820
374 Ga0495595_0295006 3300053084 Bacteria 815
375 Ga0495619_0000204 3300053085 Bacteria 43118
376 Ga0495619_0004288 3300053085 Bacteria 9090
377 Ga0495619_0006210 3300053085 Bacteria 7574
378 Ga0495619_0022472 3300053085 Plasmid 4037
379 Ga0495619_0038898 3300053085 Archaea 3104
380 Ga0495619_0098153 3300053085 Bacteria 1991
381 Ga0495619_0127119 3300053085 Unclassified 1750
382 Ga0495619_0186958 3300053085 Bacteria 1434
383 Ga0495619_0318535 3300053085 Bacteria 1076
384 Ga0495619_0556543 3300053085 Bacteria 786
385 Ga0495619_0825973 3300053085 Unclassified 626
386 Ga0495619_1102905 3300053085 Unclassified 528
387 Ga0500645_040097 3300053730 Bacteria 1386
388 Ga0530510_0109095 3300061734 Bacteria 2026
389 2513637653 2513237094 Bacteria 8789602
390 2514016925 2513237161 Bacteria 8871253
391 2617350592 2617270735 Bacteria 9163226
392 2841980994 2841974524 Bacteria 8931498
393 2847937900 2847930680 Bacteria 9342022
394 2881667277 2881665667 Bacteria 8175609
395 2881670209 2881665667 Bacteria 8175609
396 2922393925 2922393267 Bacteria 8285685
397 8016638599 8016630954 Bacteria 9217207
398 Ga0207661_10005126
399 JGI25153J46596_10000419
400 JGI25160J50197_1050064
401 Ga0055539_1004504
402 Ga0065165_1006820
403 Ga0070683_100010771
404 Ga0070690_100845497
405 Ga0070670_100065961
406 Ga0070670_100253866
407 Ga0070689_100432774
408 Ga0070689_100546171
409 Ga0070691_10599420
410 Ga0070675_101503856
411 Ga0070671_100129617
412 Ga0070671_100405585
413 Ga0070671_100717052
414 Ga0070673_100257216
415 Ga0070673_101494891
416 Ga0070688_100740193
417 Ga0070688_101081703
418 Ga0070667_101563693
419 Ga0070709_11229111
420 Ga0070714_100443768
421 Ga0070714_101358640
422 Ga0070711_100606360
423 Ga0070708_100975573
424 Ga0070663_100570678
425 Ga0070678_101296916
426 Ga0070681_10255812
427 Ga0070706_100358092
428 Ga0070698_100144183
429 Ga0070698_100324531
430 Ga0070698_100479670
431 Ga0070699_100392153
432 Ga0070679_100079657
433 Ga0070679_100788368
434 Ga0070684_100346250
435 Ga0070684_100700909
436 Ga0070684_101374543
437 Ga0070684_102124085
438 Ga0068853_102172580
439 Ga0070672_100808935
440 Ga0070672_101757149
441 Ga0070665_100543900
442 Ga0070665_100614780
443 Ga0070704_102049005
444 Ga0068855_101269861
445 Ga0070664_100261000
446 Ga0070702_100669174
447 Ga0068851_10951526
448 Ga0068870_10941993
449 Ga0068863_101624713
450 Ga0081455_10029391
451 Ga0070717_10319792
452 Ga0070717_10333961
453 Ga0070717_10618584
454 Ga0075368_10341948
455 Ga0070712_100762435
456 Ga0070712_100949998
457 Ga0070712_101197650
458 Ga0070712_101977082
459 Ga0070712_102022764
460 Ga0070712_102045660
461 Ga0075370_11009779
462 Ga0075431_101002105
463 Ga0075429_101101045
464 Ga0099795_10009735
465 Ga0105240_10000484
466 Ga0111539_11840628
467 Ga0105247_10177290
468 Ga0105247_10397257
469 Ga0114129_10444794
470 Ga0105243_10462335
471 Ga0105242_11980811
472 Ga0105237_10010727
473 Ga0105237_10726673
474 Ga0105237_11599877
475 Ga0105249_12443679
476 Ga0099796_10241979
477 Ga0105239_10074777
478 Ga0105239_10405984
479 Ga0105239_11221412
480 Ga0105239_12540234
481 Ga0105246_10443167
482 Ga0105246_10503375
483 Ga0157374_10807104
484 Ga0163162_12391117
485 Ga0157372_13329251
486 Ga0157375_12945198
487 Ga0163163_10024059
488 Ga0163163_10157837
489 Ga0163163_10666769
490 Ga0163163_10741817
491 Ga0163163_11394854
492 Ga0163163_11502964
493 Ga0163163_11643973
494 Ga0224572_1042634
495 Ga0228598_1007873
496 Ga0228598_1025099
497 Ga0228598_1026455
498 Ga0228598_1038700
499 Ga0228598_1097477
500 Ga0209677_100102
501 Ga0209758_1000165
502 Ga0209758_1001237
503 Ga0207426_1018379
504 Ga0207692_10691363
505 Ga0207710_10342987
506 Ga0207699_10166047
507 Ga0207684_11058698
508 Ga0207654_11096269
509 Ga0207671_10007181
510 Ga0207693_10125200
511 Ga0207693_10824003
512 Ga0207663_11156202
513 Ga0207649_10489521
514 Ga0207652_10060062
515 Ga0207650_10003653
516 Ga0207650_10034874
517 Ga0207650_10097372
518 Ga0207664_10408049
519 Ga0207664_10782162
520 Ga0207644_10362502
521 Ga0207644_10441852
522 Ga0207644_10914925
523 Ga0207644_11826529
524 Ga0207706_10832454
525 Ga0207709_11055239
526 Ga0207670_10352575
527 Ga0207670_10447430
528 Ga0207669_10923737
529 Ga0207665_11114225
530 Ga0207691_10818117
531 Ga0207661_10689652
532 Ga0207661_11543168
533 Ga0207679_10263492
534 Ga0207679_10854744
535 Ga0207679_11318909
536 Ga0207679_11827522
537 Ga0207651_10282272
538 Ga0207651_10892811
539 Ga0207678_10258449
540 Ga0207678_11328184
541 Ga0207678_11747344
542 Ga0207641_10407442
543 Ga0207641_11321144
544 Ga0207674_10859747
545 Ga0207683_11248427
546 Ga0207683_11431957
547 Ga0209813_10442283
548 Ga0268266_10489630
549 Ga0268266_10584812
550 Ga0265334_10011368
551 Ga0265338_11156118
552 Ga0265339_10013430
553 Ga0265339_10053348
554 Ga0265314_10205076
555 Ga0373934_0074578
556 Ga0373956_0053117
557 Ga0373943_0100050
558 Ga0373946_0042708
559 Ga0373955_0091648
560 Ga0373955_0262541
561 Ga0373955_0913327
562 Ga0373955_1023658
563 Ga0373924_0218073
564 Ga0373935_0115032
565 Ga0373935_1167514
566 Ga0373935_1269571
567 Ga0373927_0460859
568 Ga0373933_0073955
569 Ga0373933_0504257
570 Ga0373947_0002184
571 Ga0373947_0134198
572 Ga0373937_0013487
573 Ga0373937_0444724
574 Ga0373937_0501934
575 Ga0373937_0571860
576 Ga0373937_0797035
577 Ga0373937_0878654
578 Ga0373937_1307849
579 Ga0373937_1719100
580 Ga0373925_0023827
581 Ga0373925_0672742
582 Ga0373925_0760800
583 Ga0373925_1206098
584 Ga0436364_0450790
585 Ga0436365_1106415
586 Ga0451853_0634151
587 Ga0466972_0004253
588 Ga0495592_0020199
589 Ga0495592_0105330
590 Ga0495603_0006649
591 Ga0495603_0596817
592 Ga0495629_0070546
593 Ga0495629_0149913
594 Ga0495629_0173176
595 Ga0495629_0277146
596 Ga0495641_0267809
597 Ga0495651_0156627
598 Ga0495651_0999695
599 Ga0495653_0015909
600 Ga0495653_0263336
601 Ga0495653_0489424
602 Ga0495653_0635315
603 Ga0495653_0908149
604 Ga0495582_0030825
605 Ga0495582_0069249
606 Ga0495639_0119156
607 Ga0495662_0054832
608 Ga0495662_0434066
609 Ga0495594_0285753
610 Ga0495608_0160534
611 Ga0495608_0854374
612 Ga0495618_0067785
613 Ga0495618_0091493
614 Ga0495618_0164080
615 Ga0495618_0324318
616 Ga0495628_0218471
617 Ga0495628_0281123
618 Ga0495628_0679124
619 Ga0495628_0864276
620 Ga0495628_0885548
621 Ga0495652_0156372
622 Ga0495652_0275831
623 Ga0495652_0642133
624 Ga0495652_0749592
625 Ga0495652_0821082
626 Ga0495640_0009393
627 Ga0495640_0202841
628 Ga0495640_0381360
629 Ga0495587_0022227
630 Ga0495667_0304632
631 Ga0495667_0367541
632 Ga0495667_0508455
633 Ga0495634_0005556
634 Ga0495634_0033606
635 Ga0495634_0080191
636 Ga0495634_0514005
637 Ga0495635_0763047
638 Ga0495657_0282680
639 Ga0495657_0744138
640 Ga0495599_0012717
641 Ga0495599_0116729
642 Ga0495599_0372260
643 Ga0495599_0518695
644 Ga0495599_0686188
645 Ga0495623_0100853
646 Ga0495623_0656625
647 Ga0495646_0027784
648 Ga0495646_0135411
649 Ga0495646_0659227
650 Ga0495613_0071764
651 Ga0495613_0856915
652 Ga0495624_0098359
653 Ga0495624_0148345
654 Ga0495624_0151398
655 Ga0495581_0105779
656 Ga0495581_0179645
657 Ga0495604_0245693
658 Ga0495604_0290057
659 Ga0495674_0016222
660 Ga0495674_0026593
661 Ga0495674_0053687
662 Ga0495674_0318131
663 Ga0495674_0565669
664 Ga0495674_0707314
665 Ga0495674_1268341
666 Ga0495676_0011110
667 Ga0495676_0412968
668 Ga0495676_0615943
669 Ga0495680_0027576
670 Ga0495680_0124776
671 Ga0495680_0257235
672 Ga0495680_0285685
673 Ga0495680_0513734
674 Ga0495680_0745307
675 Ga0495680_0945831
676 Ga0495684_1008781
677 Ga0495593_0129703
678 Ga0495602_0057951
679 Ga0495602_0190324
680 Ga0495602_0203777
681 Ga0495602_0351762
682 Ga0495602_0600806
683 Ga0495602_0739515
684 Ga0496100_0881248
685 Ga0496100_1078632
686 Ga0496101_0360050
687 Ga0496102_0030189
688 Ga0496102_0228842
689 Ga0496102_0468139
690 Ga0496102_1355727
691 Ga0496103_0284293
692 Ga0496103_0510689
693 Ga0496104_0006986
694 Ga0496104_0089749
695 Ga0496104_0160928
696 Ga0496104_1468316
697 Ga0496105_0017264
698 Ga0496105_0024057
699 Ga0496105_0101888
700 Ga0496106_0184563
701 Ga0496107_0212137
702 Ga0496108_0007476
703 Ga0496108_0025522
704 Ga0496108_0096869
705 Ga0496108_0226910
706 Ga0496108_0261052
707 Ga0496108_0739104
708 Ga0496109_0002631
709 Ga0496109_0033492
710 Ga0496109_0251187
711 Ga0496109_1301054
712 Ga0496109_1532912
713 Ga0496110_0018544
714 Ga0496110_0024605
715 Ga0496110_0056123
716 Ga0496110_0128255
717 Ga0496110_0647510
718 Ga0496110_1050798
719 Ga0496110_1233150
720 Ga0496110_1303760
721 Ga0496110_1499536
722 Ga0496111_0037846
723 Ga0496111_0123360
724 Ga0496111_0655766
725 Ga0496112_0003073
726 Ga0496112_0003162
727 Ga0496112_0009441
728 Ga0496112_0051833
729 Ga0496112_0234149
730 Ga0496112_0385183
731 Ga0496112_0426840
732 Ga0496112_0779543
733 Ga0496112_0791030
734 Ga0496112_1881254
735 Ga0496113_0008151
736 Ga0496113_0034022
737 Ga0496113_0039711
738 Ga0496113_0075146
739 Ga0496113_0357020
740 Ga0496114_1088316
741 Ga0496115_0177218
742 Ga0496115_0282768
743 Ga0496115_0966263
744 Ga0496126_0012511
745 Ga0496126_0219195
746 Ga0496126_0463341
747 Ga0496126_0634060
748 Ga0501076_1217038
749 nmdc:mga0yw44_665567_c1
750 nmdc:mga04h51_284767_c1
751 nmdc:mga05p37_24256_c2
752 nmdc:mga06r32_967523_c1
753 nmdc:mga0n895_936701_c1
754 Ga0495601_0002592
755 Ga0495601_0013199
756 Ga0495601_0027743
757 Ga0495601_0052859
758 Ga0495601_0083930
759 Ga0495601_0099181
760 Ga0495601_0108105
761 Ga0495601_0344329
762 Ga0495601_0579981
763 Ga0495601_0616033
764 Ga0495601_0861525
765 Ga0495612_0023039
766 Ga0495612_0322891
767 Ga0495612_0382670
768 Ga0495595_0000623
769 Ga0495595_0026486
770 Ga0495595_0291202
771 Ga0495595_0295006
772 Ga0495619_0000204
773 Ga0495619_0004288
774 Ga0495619_0006210
775 Ga0495619_0022472
776 Ga0495619_0038898
777 Ga0495619_0098153
778 Ga0495619_0127119
779 Ga0495619_0186958
780 Ga0495619_0318535
781 Ga0495619_0556543
782 Ga0495619_0825973
783 Ga0495619_1102905
784 Ga0500645_040097
785 Ga0530510_0109095
786 2513637653
787 2514016925
788 2617350592
789 2841980994
790 2847937900
791 2881667277
792 2881670209
793 2922393925
794 8016638599

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12599

DUF3768

Protein of unknown function (DUF3768)

26

109

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ior-assembly1.cif.gz_A the ligand binding domain of mlp24 with asparagine 0.86 63 77
3gce-assembly1.cif.gz_A ferredoxin of carbazole 1,9a-dioxygenase from nocardioides aromaticivorans ic177 0.7397 62 76
4eod-assembly1.cif.gz_A crystal structure of h74e synechocystis sp. pcya sp. pcya 0.6626 57 105
8c7g-assembly1.cif.gz_A drosophila melanogaster rab7 gef complex mon1-ccz1-bulli 0.6617 60 83
7q3e-assembly1.cif.gz_B structure of the mouse cplane-rsg1 complex 0.6547 35 109
ID Description Score Start End Superfamily
af_Q58559_279_385_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7707 63 104 2.40.50.140
af_Q9W168_22_122_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.7446 38 76 3.30.450.30
3gceA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.7397 62 76 2.102.10.10
af_Q54DY3_12_87_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.7085 36 76 3.30.450.30
af_Q54DY3_5_86_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.7085 36 76 3.30.450.30
ID Description Score Start End GO Terms
AF-X5TSJ9-F1-model_v4 DUF3768 domain-containing protein 0.8969 65 109
AF-A0A520B4G5-F1-model_v4 DUF3768 domain-containing protein 0.8967 60 109
AF-A0A1Y2JKC5-F1-model_v4 DUF3768 domain-containing protein 0.8877 69 109
AF-A0A6L3Y9Y5-F1-model_v4 DUF3768 domain-containing protein 0.8812 63 109
AF-X5TSJ9-F1-model_v4 DUF3768 domain-containing protein 0.8798 65 109

Map