F433506

General Info

Members Datasets Scaffolds Average Seq Length
396 136 784 64

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_12775111|Ga0105249_127751112
Length 78
Sequence LRWPKKVAVKREEKQMKNLLVRLKIWKDQNGQDLIEYALMAGFVAVAAGAIMPGVASSVSTIFSKVGSVLKVASTQGS

Samples

Sample ID Description Type Environment
1 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
112 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
113 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
114 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
123 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
124 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
130 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
136 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.24
Metatranscriptomes 0.76
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 0.76
Rhizosphere 96.72
Stem 0
Stem Tuber 0
Unclassified 37.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105249_12775111 3300009553 Unclassified 561
2 Ga0070658_10008479 3300005327 Bacteria 8265
3 Ga0070683_100112467 3300005329 Unclassified 2570
4 Ga0070670_101119420 3300005331 Bacteria 718
5 Ga0070666_10049551 3300005335 Bacteria 2823
6 Ga0070680_100125924 3300005336 Bacteria 2140
7 Ga0070680_100420918 3300005336 Bacteria 1139
8 Ga0070682_100867244 3300005337 Unclassified 739
9 Ga0068868_100026368 3300005338 Bacteria 4428
10 Ga0068868_100151921 3300005338 Bacteria 1907
11 Ga0070660_100013728 3300005339 Bacteria 5823
12 Ga0070660_100213260 3300005339 Bacteria 1568
13 Ga0070660_101565591 3300005339 Unclassified 561
14 Ga0070691_10145455 3300005341 Bacteria 1211
15 Ga0070661_100197524 3300005344 Bacteria 1536
16 Ga0070669_100412327 3300005353 Unclassified 1107
17 Ga0070671_100295740 3300005355 Unclassified 1378
18 Ga0070671_100297523 3300005355 Bacteria 1374
19 Ga0070671_100955318 3300005355 Bacteria 750
20 Ga0070667_100205917 3300005367 Unclassified 1747
21 Ga0070667_100284871 3300005367 Bacteria 1485
22 Ga0070667_100436272 3300005367 Bacteria 1196
23 Ga0070667_100533830 3300005367 Unclassified 1077
24 Ga0070667_101469923 3300005367 Bacteria 640
25 Ga0070667_101778357 3300005367 Bacteria 580
26 Ga0070709_10042716 3300005434 Bacteria 2801
27 Ga0070709_10262192 3300005434 Bacteria 1249
28 Ga0070709_10878031 3300005434 Unclassified 708
29 Ga0070714_100008099 3300005435 Bacteria 8190
30 Ga0070714_100276761 3300005435 Unclassified 1558
31 Ga0070714_100589072 3300005435 Bacteria 1067
32 Ga0070714_101132564 3300005435 Unclassified 763
33 Ga0070714_101387865 3300005435 Unclassified 686
34 Ga0070713_100012295 3300005436 Bacteria 6271
35 Ga0070713_100641604 3300005436 Unclassified 1011
36 Ga0070713_101026192 3300005436 Unclassified 796
37 Ga0070713_101583145 3300005436 Bacteria 636
38 Ga0070710_10744599 3300005437 Unclassified 695
39 Ga0070711_100065182 3300005439 Bacteria 2547
40 Ga0070711_100659958 3300005439 Bacteria 878
41 Ga0070694_101325831 3300005444 Unclassified 606
42 Ga0070678_102068820 3300005456 Unclassified 539
43 Ga0070662_100389017 3300005457 Bacteria 1149
44 Ga0070681_10107046 3300005458 Bacteria 2737
45 Ga0070681_10127977 3300005458 Bacteria 2472
46 Ga0070681_10274992 3300005458 Bacteria 1595
47 Ga0070681_10552142 3300005458 Bacteria 1066
48 Ga0070681_11266545 3300005458 Bacteria 660
49 Ga0070681_11401426 3300005458 Unclassified 623
50 Ga0068867_100185319 3300005459 Bacteria 1657
51 Ga0068867_101022145 3300005459 Bacteria 750
52 Ga0070706_100758469 3300005467 Bacteria 899
53 Ga0070679_100049733 3300005530 Bacteria 4176
54 Ga0070679_100158038 3300005530 Bacteria 2241
55 Ga0070679_100520367 3300005530 Unclassified 1133
56 Ga0070679_101353244 3300005530 Unclassified 658
57 Ga0070684_100017208 3300005535 Bacteria 5926
58 Ga0070684_100292091 3300005535 Bacteria 1495
59 Ga0068853_100277670 3300005539 Bacteria 1544
60 Ga0068853_100531197 3300005539 Unclassified 1113
61 Ga0068853_100682445 3300005539 Bacteria 979
62 Ga0068853_100918900 3300005539 Unclassified 841
63 Ga0068853_102057525 3300005539 Unclassified 554
64 Ga0070686_100521617 3300005544 Unclassified 925
65 Ga0070693_100919756 3300005547 Unclassified 657
66 Ga0070665_100028998 3300005548 Bacteria 5571
67 Ga0070665_100063004 3300005548 Bacteria 3718
68 Ga0070665_100348250 3300005548 Bacteria 1487
69 Ga0070704_100573378 3300005549 Bacteria 989
70 Ga0068855_100002803 3300005563 Bacteria 21449
71 Ga0068855_100064172 3300005563 Bacteria 4283
72 Ga0068855_100099372 3300005563 Bacteria 3352
73 Ga0068855_100216111 3300005563 Bacteria 2152
74 Ga0070664_100034438 3300005564 Bacteria 4249
75 Ga0070664_100086996 3300005564 Bacteria 2701
76 Ga0070664_101415061 3300005564 Unclassified 657
77 Ga0070664_101669445 3300005564 Bacteria 604
78 Ga0068857_100007263 3300005577 Bacteria 9542
79 Ga0068857_100025078 3300005577 Bacteria 5252
80 Ga0068857_100038439 3300005577 Bacteria 4238
81 Ga0068857_100040887 3300005577 Bacteria 4110
82 Ga0068856_100014834 3300005614 Bacteria 7521
83 Ga0068856_100020769 3300005614 Bacteria 6382
84 Ga0068856_100183695 3300005614 Unclassified 2105
85 Ga0068856_100739917 3300005614 Bacteria 1003
86 Ga0068856_100889670 3300005614 Unclassified 909
87 Ga0068852_100008244 3300005616 Bacteria 7661
88 Ga0068852_100198590 3300005616 Bacteria 1897
89 Ga0068852_100973279 3300005616 Unclassified 867
90 Ga0068852_101283420 3300005616 Bacteria 754
91 Ga0068852_102098322 3300005616 Bacteria 587
92 Ga0068852_102514551 3300005616 Bacteria 535
93 Ga0068859_100157444 3300005617 Bacteria 2349
94 Ga0068859_100365497 3300005617 Bacteria 1538
95 Ga0068859_100482721 3300005617 Bacteria 1335
96 Ga0068864_100004251 3300005618 Bacteria 11784
97 Ga0068864_100174854 3300005618 Bacteria 1960
98 Ga0068864_100747806 3300005618 Bacteria 958
99 Ga0068864_100933047 3300005618 Unclassified 858
100 Ga0068864_101536146 3300005618 Unclassified 669
101 Ga0068864_102235995 3300005618 Unclassified 553
102 Ga0068866_10220789 3300005718 Bacteria 1143
103 Ga0068866_10252310 3300005718 Unclassified 1080
104 Ga0068861_101587051 3300005719 Unclassified 644
105 Ga0068863_100035176 3300005841 Bacteria 4772
106 Ga0068863_100055613 3300005841 Bacteria 3747
107 Ga0068863_100056698 3300005841 Bacteria 3709
108 Ga0068863_100116175 3300005841 Bacteria 2550
109 Ga0068863_100161076 3300005841 Bacteria 2150
110 Ga0068863_100179046 3300005841 Bacteria 2035
111 Ga0068863_100436541 3300005841 Bacteria 1284
112 Ga0068863_100745305 3300005841 Unclassified 975
113 Ga0068863_102426550 3300005841 Unclassified 534
114 Ga0068858_100004396 3300005842 Bacteria 13831
115 Ga0068858_100008880 3300005842 Bacteria 9635
116 Ga0068858_100013584 3300005842 Bacteria 7685
117 Ga0068858_100083921 3300005842 Unclassified 2963
118 Ga0068858_100334850 3300005842 Bacteria 1448
119 Ga0068858_100960097 3300005842 Bacteria 837
120 Ga0068858_101851828 3300005842 Unclassified 596
121 Ga0068860_100389311 3300005843 Bacteria 1377
122 Ga0068860_101660329 3300005843 Unclassified 661
123 Ga0070717_10028345 3300006028 Bacteria 4482
124 Ga0070717_10029534 3300006028 Bacteria 4399
125 Ga0070717_10039058 3300006028 Bacteria 3861
126 Ga0070717_10064040 3300006028 Bacteria 3053
127 Ga0070717_10398864 3300006028 Bacteria 1235
128 Ga0070717_10417258 3300006028 Unclassified 1207
129 Ga0070717_11645492 3300006028 Unclassified 581
130 Ga0070716_100822095 3300006173 Bacteria 721
131 Ga0070716_101703901 3300006173 Unclassified 520
132 Ga0070712_100138537 3300006175 Bacteria 1854
133 Ga0070712_101846526 3300006175 Unclassified 529
134 Ga0097621_100024624 3300006237 Bacteria 4702
135 Ga0097621_100042010 3300006237 Bacteria 3682
136 Ga0097621_100046417 3300006237 Bacteria 3515
137 Ga0097621_100154707 3300006237 Bacteria 1967
138 Ga0097621_100282411 3300006237 Bacteria 1461
139 Ga0097621_100437643 3300006237 Bacteria 1176
140 Ga0097621_100455151 3300006237 Bacteria 1153
141 Ga0097621_100485675 3300006237 Unclassified 1117
142 Ga0097621_101447158 3300006237 Bacteria 651
143 Ga0097621_101457252 3300006237 Bacteria 649
144 Ga0097621_101906973 3300006237 Unclassified 567
145 Ga0097621_102040697 3300006237 Unclassified 548
146 Ga0068871_100011986 3300006358 Bacteria 6380
147 Ga0068871_100032256 3300006358 Bacteria 4136
148 Ga0068871_100079643 3300006358 Bacteria 2711
149 Ga0068871_100137205 3300006358 Bacteria 2078
150 Ga0068871_100314849 3300006358 Bacteria 1377
151 Ga0068871_100567482 3300006358 Bacteria 1029
152 Ga0068871_100714085 3300006358 Unclassified 919
153 Ga0068871_101259361 3300006358 Unclassified 695
154 Ga0068871_102282774 3300006358 Bacteria 516
155 Ga0075431_100026432 3300006847 Bacteria 5955
156 Ga0075433_11624765 3300006852 Unclassified 557
157 Ga0075434_102024566 3300006871 Unclassified 581
158 Ga0068865_100018274 3300006881 Bacteria 4523
159 Ga0075436_100581997 3300006914 Unclassified 824
160 Ga0097620_100157447 3300006931 Bacteria 2349
161 Ga0097620_100365522 3300006931 Bacteria 1538
162 Ga0097620_100482689 3300006931 Bacteria 1335
163 Ga0097620_101500160 3300006931 Unclassified 744
164 Ga0075435_101242130 3300007076 Unclassified 652
165 Ga0105240_10000682 3300009093 Bacteria 62492
166 Ga0105240_10160354 3300009093 Bacteria 2672
167 Ga0105240_10285641 3300009093 Bacteria 1894
168 Ga0105240_10523576 3300009093 Bacteria 1315
169 Ga0105240_11433612 3300009093 Unclassified 725
170 Ga0105240_12419950 3300009093 Unclassified 543
171 Ga0105245_10002003 3300009098 Bacteria 18489
172 Ga0105245_10029145 3300009098 Bacteria 4874
173 Ga0105245_10075744 3300009098 Bacteria 3064
174 Ga0105245_10223108 3300009098 Bacteria 1820
175 Ga0105245_10237009 3300009098 Unclassified 1767
176 Ga0105245_10387685 3300009098 Bacteria 1393
177 Ga0105245_10851279 3300009098 Bacteria 952
178 Ga0105245_11171927 3300009098 Bacteria 816
179 Ga0105245_11419195 3300009098 Unclassified 744
180 Ga0105245_12393864 3300009098 Unclassified 582
181 Ga0105245_12593261 3300009098 Unclassified 560
182 Ga0105245_12857151 3300009098 Unclassified 535
183 Ga0105247_10014782 3300009101 Unclassified 4679
184 Ga0105247_10182251 3300009101 Unclassified 1402
185 Ga0105247_10370994 3300009101 Bacteria 1012
186 Ga0105247_10596931 3300009101 Bacteria 818
187 Ga0105247_10599624 3300009101 Bacteria 816
188 Ga0105247_11529841 3300009101 Unclassified 545
189 Ga0105247_11852342 3300009101 Unclassified 503
190 Ga0114129_10553088 3300009147 Bacteria 1496
191 Ga0105243_10232148 3300009148 Unclassified 1637
192 Ga0105243_10428193 3300009148 Bacteria 1236
193 Ga0105243_12081246 3300009148 Unclassified 603
194 Ga0105243_12218594 3300009148 Bacteria 586
195 Ga0105241_10026818 3300009174 Unclassified 4288
196 Ga0105241_10041457 3300009174 Bacteria 3478
197 Ga0105241_10048107 3300009174 Bacteria 3244
198 Ga0105241_10067430 3300009174 Bacteria 2770
199 Ga0105241_10097700 3300009174 Bacteria 2329
200 Ga0105241_10248279 3300009174 Bacteria 1508
201 Ga0105241_10376281 3300009174 Unclassified 1240
202 Ga0105241_10417414 3300009174 Unclassified 1180
203 Ga0105241_11097014 3300009174 Bacteria 749
204 Ga0105241_11560053 3300009174 Unclassified 637
205 Ga0105241_11948698 3300009174 Unclassified 577
206 Ga0105242_10039454 3300009176 Bacteria 3801
207 Ga0105242_10052640 3300009176 Bacteria 3322
208 Ga0105242_10113714 3300009176 Unclassified 2312
209 Ga0105242_10525692 3300009176 Bacteria 1130
210 Ga0105242_10556117 3300009176 Unclassified 1101
211 Ga0105242_10699043 3300009176 Unclassified 992
212 Ga0105242_10768965 3300009176 Bacteria 950
213 Ga0105242_12049233 3300009176 Unclassified 615
214 Ga0105248_10002181 3300009177 Bacteria 21660
215 Ga0105248_10053143 3300009177 Bacteria 4546
216 Ga0105248_10067630 3300009177 Bacteria 4011
217 Ga0105248_10157871 3300009177 Bacteria 2559
218 Ga0105248_10161492 3300009177 Unclassified 2527
219 Ga0105248_10261042 3300009177 Bacteria 1950
220 Ga0105248_10511028 3300009177 Bacteria 1355
221 Ga0105248_10562685 3300009177 Bacteria 1286
222 Ga0105248_10773874 3300009177 Bacteria 1083
223 Ga0105248_10890796 3300009177 Unclassified 1005
224 Ga0105248_10961183 3300009177 Unclassified 965
225 Ga0105248_12170854 3300009177 Unclassified 632
226 Ga0105248_12557465 3300009177 Unclassified 582
227 Ga0105248_12844153 3300009177 Bacteria 552
228 Ga0105248_13381157 3300009177 Bacteria 507
229 Ga0105237_10212019 3300009545 Bacteria 1937
230 Ga0105237_10361680 3300009545 Unclassified 1455
231 Ga0105237_10413579 3300009545 Bacteria 1354
232 Ga0105237_10597514 3300009545 Unclassified 1111
233 Ga0105237_10690109 3300009545 Bacteria 1028
234 Ga0105237_10786658 3300009545 Bacteria 958
235 Ga0105238_10009394 3300009551 Bacteria 9788
236 Ga0105238_10059554 3300009551 Bacteria 3825
237 Ga0105238_10062191 3300009551 Bacteria 3734
238 Ga0105238_10092541 3300009551 Bacteria 3011
239 Ga0105238_10618033 3300009551 Unclassified 1092
240 Ga0105238_11278515 3300009551 Unclassified 759
241 Ga0105238_12799550 3300009551 Unclassified 524
242 Ga0105249_10045122 3300009553 Bacteria 4008
243 Ga0105249_10082476 3300009553 Bacteria 2992
244 Ga0105249_11634126 3300009553 Unclassified 717
245 Ga0105249_11679295 3300009553 Bacteria 708
246 Ga0099796_10344551 3300010159 Bacteria 641
247 Ga0105239_10044662 3300010375 Unclassified 4857
248 Ga0105239_10086842 3300010375 Bacteria 3448
249 Ga0105239_10092099 3300010375 Bacteria 3345
250 Ga0105239_10183721 3300010375 Bacteria 2340
251 Ga0105239_10293343 3300010375 Unclassified 1831
252 Ga0105239_10646932 3300010375 Unclassified 1207
253 Ga0105239_12752484 3300010375 Unclassified 574
254 Ga0105246_10019287 3300011119 Bacteria 4356
255 Ga0105246_10128512 3300011119 Bacteria 1889
256 Ga0105246_10708752 3300011119 Unclassified 883
257 Ga0105246_11006307 3300011119 Unclassified 755
258 Ga0157373_10353848 3300013100 Unclassified 1048
259 Ga0157370_10046482 3300013104 Bacteria 4162
260 Ga0157370_10049076 3300013104 Bacteria 4042
261 Ga0157369_10026593 3300013105 Bacteria 6418
262 Ga0157369_10698984 3300013105 Bacteria 1044
263 Ga0157369_10739214 3300013105 Unclassified 1012
264 Ga0157369_11304503 3300013105 Unclassified 740
265 Ga0157374_10090927 3300013296 Bacteria 2910
266 Ga0157374_10195666 3300013296 Bacteria 1979
267 Ga0157374_10293082 3300013296 Bacteria 1609
268 Ga0157378_10080162 3300013297 Bacteria 2949
269 Ga0157378_10089592 3300013297 Bacteria 2794
270 Ga0157378_10134719 3300013297 Bacteria 2289
271 Ga0157378_10533071 3300013297 Unclassified 1177
272 Ga0157378_10658452 3300013297 Bacteria 1063
273 Ga0157378_10757493 3300013297 Unclassified 994
274 Ga0157378_10797366 3300013297 Bacteria 970
275 Ga0157378_11164997 3300013297 Bacteria 809
276 Ga0157378_12384420 3300013297 Unclassified 581
277 Ga0163162_10047976 3300013306 Bacteria 4279
278 Ga0163162_10185573 3300013306 Bacteria 2207
279 Ga0163162_10244412 3300013306 Unclassified 1926
280 Ga0163162_10356441 3300013306 Unclassified 1596
281 Ga0163162_10445845 3300013306 Unclassified 1426
282 Ga0163162_10637329 3300013306 Bacteria 1190
283 Ga0163162_11322051 3300013306 Unclassified 819
284 Ga0163162_12023268 3300013306 Unclassified 660
285 Ga0157372_10686687 3300013307 Bacteria 1192
286 Ga0157372_11292711 3300013307 Unclassified 842
287 Ga0157375_10005650 3300013308 Bacteria 10883
288 Ga0157375_10006895 3300013308 Bacteria 9911
289 Ga0157375_10020377 3300013308 Bacteria 6057
290 Ga0157375_10306000 3300013308 Bacteria 1753
291 Ga0157375_11072859 3300013308 Bacteria 942
292 Ga0157375_13531756 3300013308 Unclassified 520
293 Ga0163163_10013592 3300014325 Bacteria 7456
294 Ga0163163_10026318 3300014325 Bacteria 5559
295 Ga0163163_10054438 3300014325 Bacteria 3953
296 Ga0163163_10112979 3300014325 Bacteria 2746
297 Ga0163163_10258872 3300014325 Bacteria 1791
298 Ga0163163_11214900 3300014325 Unclassified 816
299 Ga0163163_11698400 3300014325 Unclassified 692
300 Ga0157379_10087985 3300014968 Bacteria 2785
301 Ga0157379_10089370 3300014968 Bacteria 2763
302 Ga0157379_10285788 3300014968 Unclassified 1501
303 Ga0157379_10516191 3300014968 Unclassified 1109
304 Ga0157379_10754293 3300014968 Bacteria 916
305 Ga0157379_11822474 3300014968 Bacteria 598
306 Ga0157376_10012918 3300014969 Bacteria 6214
307 Ga0157376_10237487 3300014969 Bacteria 1696
308 Ga0157376_11353379 3300014969 Unclassified 743
309 Ga0157376_12171917 3300014969 Unclassified 594
310 Ga0213876_10086586 3300021384 Bacteria 1658
311 Ga0213875_10002141 3300021388 Bacteria 12054
312 Ga0213875_10033761 3300021388 Bacteria 2417
313 Ga0213875_10404164 3300021388 Unclassified 651
314 Ga0207656_10548388 3300025321 Unclassified 589
315 Ga0207692_10927392 3300025898 Unclassified 573
316 Ga0207710_10765806 3300025900 Bacteria 507
317 Ga0207699_10114448 3300025906 Bacteria 1734
318 Ga0207699_10467609 3300025906 Unclassified 907
319 Ga0207699_10722157 3300025906 Unclassified 730
320 Ga0207699_11284733 3300025906 Unclassified 542
321 Ga0207705_10616196 3300025909 Unclassified 844
322 Ga0207654_10051431 3300025911 Unclassified 2371
323 Ga0207654_10633034 3300025911 Bacteria 765
324 Ga0207707_10013885 3300025912 Bacteria 7022
325 Ga0207695_11266664 3300025913 Bacteria 618
326 Ga0207693_10043264 3300025915 Bacteria 3544
327 Ga0207646_11415127 3300025922 Unclassified 604
328 Ga0207700_10008910 3300025928 Bacteria 6243
329 Ga0207700_10709061 3300025928 Bacteria 898
330 Ga0207700_11116607 3300025928 Unclassified 705
331 Ga0207700_11302767 3300025928 Unclassified 647
332 Ga0207700_11594715 3300025928 Unclassified 578
333 Ga0207664_10029236 3300025929 Unclassified 4196
334 Ga0207664_11028868 3300025929 Unclassified 738
335 Ga0207664_11172439 3300025929 Unclassified 686
336 Ga0207686_10011210 3300025934 Bacteria 4902
337 Ga0207665_10383693 3300025939 Bacteria 1067
338 Ga0207665_10428245 3300025939 Bacteria 1012
339 Ga0207665_10477535 3300025939 Bacteria 960
340 Ga0207711_10075093 3300025941 Bacteria 2941
341 Ga0207661_10542312 3300025944 Bacteria 1065
342 Ga0207679_10271200 3300025945 Bacteria 1451
343 Ga0207679_11523973 3300025945 Unclassified 613
344 Ga0207702_10044618 3300026078 Bacteria 3726
345 Ga0207702_11439144 3300026078 Unclassified 683
346 Ga0207674_10019824 3300026116 Bacteria 7277
347 Ga0207674_10045779 3300026116 Bacteria 4497
348 Ga0207698_12285378 3300026142 Unclassified 553
349 Ga0268266_11104693 3300028379 Bacteria 767
350 Ga0265338_10899643 3300028800 Bacteria 603
351 Ga0265769_118356 3300030888 Unclassified 541
352 Ga0265760_10231642 3300031090 Bacteria 633
353 Ga0265325_10038705 3300031241 Bacteria 2516
354 Ga0265325_10223623 3300031241 Unclassified 860
355 Ga0265316_10536256 3300031344 Unclassified 834
356 Ga0265316_11152528 3300031344 Unclassified 537
357 Ga0307509_10699738 3300031507 Unclassified 680
358 Ga0265313_10048199 3300031595 Bacteria 2058
359 Ga0373930_0162829 3300034816 Unclassified 565
360 Ga0373926_0142632 3300035083 Unclassified 910
361 Ga0373926_0211440 3300035083 Bacteria 748
362 Ga0373954_0280025 3300035118 Bacteria 822
363 Ga0373946_0714053 3300035171 Bacteria 525
364 Ga0373927_0159638 3300035695 Bacteria 1477
365 Ga0373933_0728363 3300035724 Unclassified 652
366 Ga0373947_0220861 3300035725 Bacteria 1246
367 Ga0373937_0423011 3300036401 Bacteria 1264
368 Ga0373925_0087089 3300037068 Bacteria 2384
369 Ga0373925_0419113 3300037068 Bacteria 1094
370 Ga0436364_0440948 3300037853 Bacteria 761
371 Ga0436364_0451408 3300037853 Bacteria 7593
372 Ga0436364_0485890 3300037853 Bacteria 565
373 Ga0436365_1011219 3300039437 Bacteria 4368
374 Ga0451801_38072 3300041455 Bacteria 554
375 Ga0451577_0859175 3300042876 Bacteria 818
376 Ga0453684_1019759 3300044712 Bacteria 879
377 Ga0451576_0308635 3300045051 Unclassified 1655
378 Ga0451576_2262367 3300045051 Unclassified 557
379 Ga0451576_2381341 3300045051 Bacteria 542
380 Ga0466967_1231163 3300045976 Bacteria 746
381 Ga0495580_0211250 3300046472 Bacteria 1335
382 Ga0495580_0449516 3300046472 Unclassified 865
383 Ga0495635_0688121 3300046663 Unclassified 664
384 Ga0495674_1370844 3300047319 Unclassified 528
385 Ga0495684_0442413 3300047471 Unclassified 905
386 Ga0496112_0757456 3300048915 Bacteria 897
387 Ga0496113_1249188 3300048916 Unclassified 579
388 nmdc:mga05p37_1882408_c1 3300050507 Unclassified 572
389 nmdc:mga05p37_647075_c1 3300050507 Bacteria 1184
390 nmdc:mga06r32_34674_c1 3300050510 Bacteria 4760
391 nmdc:mga08x19_579015_c1 3300050514 Unclassified 795
392 Ga0500568_0000649 3300053139 Bacteria 25129
393 Ga0105249_12775111
394 Ga0070658_10008479
395 Ga0070683_100112467
396 Ga0070670_101119420
397 Ga0070666_10049551
398 Ga0070680_100125924
399 Ga0070680_100420918
400 Ga0070682_100867244
401 Ga0068868_100026368
402 Ga0068868_100151921
403 Ga0070660_100013728
404 Ga0070660_100213260
405 Ga0070660_101565591
406 Ga0070691_10145455
407 Ga0070661_100197524
408 Ga0070669_100412327
409 Ga0070671_100295740
410 Ga0070671_100297523
411 Ga0070671_100955318
412 Ga0070667_100205917
413 Ga0070667_100284871
414 Ga0070667_100436272
415 Ga0070667_100533830
416 Ga0070667_101469923
417 Ga0070667_101778357
418 Ga0070709_10042716
419 Ga0070709_10262192
420 Ga0070709_10878031
421 Ga0070714_100008099
422 Ga0070714_100276761
423 Ga0070714_100589072
424 Ga0070714_101132564
425 Ga0070714_101387865
426 Ga0070713_100012295
427 Ga0070713_100641604
428 Ga0070713_101026192
429 Ga0070713_101583145
430 Ga0070710_10744599
431 Ga0070711_100065182
432 Ga0070711_100659958
433 Ga0070694_101325831
434 Ga0070678_102068820
435 Ga0070662_100389017
436 Ga0070681_10107046
437 Ga0070681_10127977
438 Ga0070681_10274992
439 Ga0070681_10552142
440 Ga0070681_11266545
441 Ga0070681_11401426
442 Ga0068867_100185319
443 Ga0068867_101022145
444 Ga0070706_100758469
445 Ga0070679_100049733
446 Ga0070679_100158038
447 Ga0070679_100520367
448 Ga0070679_101353244
449 Ga0070684_100017208
450 Ga0070684_100292091
451 Ga0068853_100277670
452 Ga0068853_100531197
453 Ga0068853_100682445
454 Ga0068853_100918900
455 Ga0068853_102057525
456 Ga0070686_100521617
457 Ga0070693_100919756
458 Ga0070665_100028998
459 Ga0070665_100063004
460 Ga0070665_100348250
461 Ga0070704_100573378
462 Ga0068855_100002803
463 Ga0068855_100064172
464 Ga0068855_100099372
465 Ga0068855_100216111
466 Ga0070664_100034438
467 Ga0070664_100086996
468 Ga0070664_101415061
469 Ga0070664_101669445
470 Ga0068857_100007263
471 Ga0068857_100025078
472 Ga0068857_100038439
473 Ga0068857_100040887
474 Ga0068856_100014834
475 Ga0068856_100020769
476 Ga0068856_100183695
477 Ga0068856_100739917
478 Ga0068856_100889670
479 Ga0068852_100008244
480 Ga0068852_100198590
481 Ga0068852_100973279
482 Ga0068852_101283420
483 Ga0068852_102098322
484 Ga0068852_102514551
485 Ga0068859_100157444
486 Ga0068859_100365497
487 Ga0068859_100482721
488 Ga0068864_100004251
489 Ga0068864_100174854
490 Ga0068864_100747806
491 Ga0068864_100933047
492 Ga0068864_101536146
493 Ga0068864_102235995
494 Ga0068866_10220789
495 Ga0068866_10252310
496 Ga0068861_101587051
497 Ga0068863_100035176
498 Ga0068863_100055613
499 Ga0068863_100056698
500 Ga0068863_100116175
501 Ga0068863_100161076
502 Ga0068863_100179046
503 Ga0068863_100436541
504 Ga0068863_100745305
505 Ga0068863_102426550
506 Ga0068858_100004396
507 Ga0068858_100008880
508 Ga0068858_100013584
509 Ga0068858_100083921
510 Ga0068858_100334850
511 Ga0068858_100960097
512 Ga0068858_101851828
513 Ga0068860_100389311
514 Ga0068860_101660329
515 Ga0070717_10028345
516 Ga0070717_10029534
517 Ga0070717_10039058
518 Ga0070717_10064040
519 Ga0070717_10398864
520 Ga0070717_10417258
521 Ga0070717_11645492
522 Ga0070716_100822095
523 Ga0070716_101703901
524 Ga0070712_100138537
525 Ga0070712_101846526
526 Ga0097621_100024624
527 Ga0097621_100042010
528 Ga0097621_100046417
529 Ga0097621_100154707
530 Ga0097621_100282411
531 Ga0097621_100437643
532 Ga0097621_100455151
533 Ga0097621_100485675
534 Ga0097621_101447158
535 Ga0097621_101457252
536 Ga0097621_101906973
537 Ga0097621_102040697
538 Ga0068871_100011986
539 Ga0068871_100032256
540 Ga0068871_100079643
541 Ga0068871_100137205
542 Ga0068871_100314849
543 Ga0068871_100567482
544 Ga0068871_100714085
545 Ga0068871_101259361
546 Ga0068871_102282774
547 Ga0075431_100026432
548 Ga0075433_11624765
549 Ga0075434_102024566
550 Ga0068865_100018274
551 Ga0075436_100581997
552 Ga0097620_100157447
553 Ga0097620_100365522
554 Ga0097620_100482689
555 Ga0097620_101500160
556 Ga0075435_101242130
557 Ga0105240_10000682
558 Ga0105240_10160354
559 Ga0105240_10285641
560 Ga0105240_10523576
561 Ga0105240_11433612
562 Ga0105240_12419950
563 Ga0105245_10002003
564 Ga0105245_10029145
565 Ga0105245_10075744
566 Ga0105245_10223108
567 Ga0105245_10237009
568 Ga0105245_10387685
569 Ga0105245_10851279
570 Ga0105245_11171927
571 Ga0105245_11419195
572 Ga0105245_12393864
573 Ga0105245_12593261
574 Ga0105245_12857151
575 Ga0105247_10014782
576 Ga0105247_10182251
577 Ga0105247_10370994
578 Ga0105247_10596931
579 Ga0105247_10599624
580 Ga0105247_11529841
581 Ga0105247_11852342
582 Ga0114129_10553088
583 Ga0105243_10232148
584 Ga0105243_10428193
585 Ga0105243_12081246
586 Ga0105243_12218594
587 Ga0105241_10026818
588 Ga0105241_10041457
589 Ga0105241_10048107
590 Ga0105241_10067430
591 Ga0105241_10097700
592 Ga0105241_10248279
593 Ga0105241_10376281
594 Ga0105241_10417414
595 Ga0105241_11097014
596 Ga0105241_11560053
597 Ga0105241_11948698
598 Ga0105242_10039454
599 Ga0105242_10052640
600 Ga0105242_10113714
601 Ga0105242_10525692
602 Ga0105242_10556117
603 Ga0105242_10699043
604 Ga0105242_10768965
605 Ga0105242_12049233
606 Ga0105248_10002181
607 Ga0105248_10053143
608 Ga0105248_10067630
609 Ga0105248_10157871
610 Ga0105248_10161492
611 Ga0105248_10261042
612 Ga0105248_10511028
613 Ga0105248_10562685
614 Ga0105248_10773874
615 Ga0105248_10890796
616 Ga0105248_10961183
617 Ga0105248_12170854
618 Ga0105248_12557465
619 Ga0105248_12844153
620 Ga0105248_13381157
621 Ga0105237_10212019
622 Ga0105237_10361680
623 Ga0105237_10413579
624 Ga0105237_10597514
625 Ga0105237_10690109
626 Ga0105237_10786658
627 Ga0105238_10009394
628 Ga0105238_10059554
629 Ga0105238_10062191
630 Ga0105238_10092541
631 Ga0105238_10618033
632 Ga0105238_11278515
633 Ga0105238_12799550
634 Ga0105249_10045122
635 Ga0105249_10082476
636 Ga0105249_11634126
637 Ga0105249_11679295
638 Ga0099796_10344551
639 Ga0105239_10044662
640 Ga0105239_10086842
641 Ga0105239_10092099
642 Ga0105239_10183721
643 Ga0105239_10293343
644 Ga0105239_10646932
645 Ga0105239_12752484
646 Ga0105246_10019287
647 Ga0105246_10128512
648 Ga0105246_10708752
649 Ga0105246_11006307
650 Ga0157373_10353848
651 Ga0157370_10046482
652 Ga0157370_10049076
653 Ga0157369_10026593
654 Ga0157369_10698984
655 Ga0157369_10739214
656 Ga0157369_11304503
657 Ga0157374_10090927
658 Ga0157374_10195666
659 Ga0157374_10293082
660 Ga0157378_10080162
661 Ga0157378_10089592
662 Ga0157378_10134719
663 Ga0157378_10533071
664 Ga0157378_10658452
665 Ga0157378_10757493
666 Ga0157378_10797366
667 Ga0157378_11164997
668 Ga0157378_12384420
669 Ga0163162_10047976
670 Ga0163162_10185573
671 Ga0163162_10244412
672 Ga0163162_10356441
673 Ga0163162_10445845
674 Ga0163162_10637329
675 Ga0163162_11322051
676 Ga0163162_12023268
677 Ga0157372_10686687
678 Ga0157372_11292711
679 Ga0157375_10005650
680 Ga0157375_10006895
681 Ga0157375_10020377
682 Ga0157375_10306000
683 Ga0157375_11072859
684 Ga0157375_13531756
685 Ga0163163_10013592
686 Ga0163163_10026318
687 Ga0163163_10054438
688 Ga0163163_10112979
689 Ga0163163_10258872
690 Ga0163163_11214900
691 Ga0163163_11698400
692 Ga0157379_10087985
693 Ga0157379_10089370
694 Ga0157379_10285788
695 Ga0157379_10516191
696 Ga0157379_10754293
697 Ga0157379_11822474
698 Ga0157376_10012918
699 Ga0157376_10237487
700 Ga0157376_11353379
701 Ga0157376_12171917
702 Ga0213876_10086586
703 Ga0213875_10002141
704 Ga0213875_10033761
705 Ga0213875_10404164
706 Ga0207656_10548388
707 Ga0207692_10927392
708 Ga0207710_10765806
709 Ga0207699_10114448
710 Ga0207699_10467609
711 Ga0207699_10722157
712 Ga0207699_11284733
713 Ga0207705_10616196
714 Ga0207654_10051431
715 Ga0207654_10633034
716 Ga0207707_10013885
717 Ga0207695_11266664
718 Ga0207693_10043264
719 Ga0207646_11415127
720 Ga0207700_10008910
721 Ga0207700_10709061
722 Ga0207700_11116607
723 Ga0207700_11302767
724 Ga0207700_11594715
725 Ga0207664_10029236
726 Ga0207664_11028868
727 Ga0207664_11172439
728 Ga0207686_10011210
729 Ga0207665_10383693
730 Ga0207665_10428245
731 Ga0207665_10477535
732 Ga0207711_10075093
733 Ga0207661_10542312
734 Ga0207679_10271200
735 Ga0207679_11523973
736 Ga0207702_10044618
737 Ga0207702_11439144
738 Ga0207674_10019824
739 Ga0207674_10045779
740 Ga0207698_12285378
741 Ga0268266_11104693
742 Ga0265338_10899643
743 Ga0265769_118356
744 Ga0265760_10231642
745 Ga0265325_10038705
746 Ga0265325_10223623
747 Ga0265316_10536256
748 Ga0265316_11152528
749 Ga0307509_10699738
750 Ga0265313_10048199
751 Ga0373930_0162829
752 Ga0373926_0142632
753 Ga0373926_0211440
754 Ga0373954_0280025
755 Ga0373946_0714053
756 Ga0373927_0159638
757 Ga0373933_0728363
758 Ga0373947_0220861
759 Ga0373937_0423011
760 Ga0373925_0087089
761 Ga0373925_0419113
762 Ga0436364_0440948
763 Ga0436364_0451408
764 Ga0436364_0485890
765 Ga0436365_1011219
766 Ga0451801_38072
767 Ga0451577_0859175
768 Ga0453684_1019759
769 Ga0451576_0308635
770 Ga0451576_2262367
771 Ga0451576_2381341
772 Ga0466967_1231163
773 Ga0495580_0211250
774 Ga0495580_0449516
775 Ga0495635_0688121
776 Ga0495674_1370844
777 Ga0495684_0442413
778 Ga0496112_0757456
779 Ga0496113_1249188
780 nmdc:mga05p37_1882408_c1
781 nmdc:mga05p37_647075_c1
782 nmdc:mga06r32_34674_c1
783 nmdc:mga08x19_579015_c1
784 Ga0500568_0000649

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map