F433471

General Info

Members Datasets Scaffolds Average Seq Length
396 203 792 182

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100182188|Ga0097621_1001821882
Length 189
Sequence MRAFILGIIVTIFIAFAIGLGVAEFGLMPTNADATPPDFETKIAGNALDAAMERHAPRVNNPVPPTDENLIAGMKIYTMNCSVCHGTLDYKPSSLEHSLYPPPPQVIIEPLDDPEWHLYYAIRTGVRYTGMPAWSKALSEQDMWKVTAFLSRLEKLPPAVQDSWKKAYGTSPEEHKGEDHGEHGGHHHD

Samples

Sample ID Description Type Environment
1 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
92 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
94 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
157 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
158 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
159 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
160 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.48
Metatranscriptomes 1.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.3
Rhizosphere 94.19
Stem 0
Stem Tuber 0
Unclassified 27.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0097621_100182188 3300006237 Bacteria 1815
2 MRS1b_contig_5539674 2162886011 Bacteria 1021
3 Ga0065715_10177872 3300005293 Bacteria 1498
4 Ga0070658_10390108 3300005327 Bacteria 1195
5 Ga0070683_100056869 3300005329 Bacteria 3633
6 Ga0070683_100387444 3300005329 Bacteria 1332
7 Ga0070683_100703884 3300005329 Bacteria 967
8 Ga0070690_100029649 3300005330 Bacteria 3395
9 Ga0070670_100003141 3300005331 Bacteria 13665
10 Ga0070670_100413358 3300005331 Bacteria 1192
11 Ga0070677_10011486 3300005333 Bacteria 3056
12 Ga0068869_100102128 3300005334 Bacteria 2170
13 Ga0068869_100247778 3300005334 Bacteria 1422
14 Ga0070666_10119548 3300005335 Bacteria 1826
15 Ga0070680_100083803 3300005336 Bacteria 2633
16 Ga0070682_100027390 3300005337 Bacteria 3420
17 Ga0068868_100002767 3300005338 Bacteria 12151
18 Ga0068868_100023693 3300005338 Bacteria 4649
19 Ga0070689_100152379 3300005340 Bacteria 1865
20 Ga0070691_10101457 3300005341 Bacteria 1430
21 Ga0070691_10114120 3300005341 Bacteria 1354
22 Ga0070661_100026229 3300005344 Unclassified 4189
23 Ga0070661_100035231 3300005344 Bacteria 3633
24 Ga0070692_10092292 3300005345 Bacteria 1648
25 Ga0070668_100069015 3300005347 Bacteria 2749
26 Ga0070675_100672341 3300005354 Unclassified 942
27 Ga0070673_100202088 3300005364 Bacteria 1712
28 Ga0070673_100490193 3300005364 Bacteria 1110
29 Ga0070659_100023555 3300005366 Bacteria 4712
30 Ga0070667_100043881 3300005367 Bacteria 3753
31 Ga0070714_100750858 3300005435 Unclassified 943
32 Ga0070713_100031216 3300005436 Bacteria 4242
33 Ga0070713_100267730 3300005436 Bacteria 1564
34 Ga0070710_10059901 3300005437 Unclassified 2164
35 Ga0070710_10075443 3300005437 Bacteria 1954
36 Ga0070711_100516153 3300005439 Unclassified 987
37 Ga0070711_100770399 3300005439 Unclassified 814
38 Ga0070708_100153866 3300005445 Unclassified 2140
39 Ga0070708_100187282 3300005445 Bacteria 1936
40 Ga0070708_100971280 3300005445 Bacteria 797
41 Ga0070662_100006022 3300005457 Bacteria 7780
42 Ga0070681_10000516 3300005458 Bacteria 31602
43 Ga0070681_10012090 3300005458 Bacteria 8558
44 Ga0070681_10253161 3300005458 Bacteria 1673
45 Ga0070681_10455758 3300005458 Unclassified 1191
46 Ga0068867_100010239 3300005459 Bacteria 6615
47 Ga0068867_100035485 3300005459 Bacteria 3617
48 Ga0070685_10022368 3300005466 Bacteria 3445
49 Ga0070706_100488368 3300005467 Bacteria 1146
50 Ga0070707_100080828 3300005468 Bacteria 3138
51 Ga0070707_100137302 3300005468 Unclassified 2379
52 Ga0070698_100351327 3300005471 Unclassified 1406
53 Ga0070679_100080649 3300005530 Unclassified 3243
54 Ga0070679_100355525 3300005530 Bacteria 1412
55 Ga0070684_100088462 3300005535 Unclassified 2752
56 Ga0070684_100267531 3300005535 Bacteria 1564
57 Ga0070697_100000208 3300005536 Bacteria 48156
58 Ga0070697_100364452 3300005536 Bacteria 1249
59 Ga0068853_100028983 3300005539 Bacteria 4661
60 Ga0068853_100181390 3300005539 Bacteria 1909
61 Ga0070695_100117074 3300005545 Bacteria 1818
62 Ga0070696_100556674 3300005546 Bacteria 919
63 Ga0070665_100146303 3300005548 Bacteria 2366
64 Ga0070704_100509486 3300005549 Bacteria 1046
65 Ga0068855_100001369 3300005563 Bacteria 30177
66 Ga0068855_100046547 3300005563 Bacteria 5127
67 Ga0068855_100224745 3300005563 Unclassified 2104
68 Ga0068855_100240445 3300005563 Bacteria 2023
69 Ga0070664_100000897 3300005564 Bacteria 23165
70 Ga0070664_100170543 3300005564 Bacteria 1930
71 Ga0068857_100000335 3300005577 Bacteria 32411
72 Ga0068857_100067871 3300005577 Bacteria 3174
73 Ga0068854_100029503 3300005578 Bacteria 3798
74 Ga0068854_100060205 3300005578 Bacteria 2746
75 Ga0068854_100234720 3300005578 Unclassified 1458
76 Ga0068854_100289543 3300005578 Unclassified 1321
77 Ga0068856_100001225 3300005614 Bacteria 26895
78 Ga0068856_100002789 3300005614 Bacteria 17882
79 Ga0068856_100015411 3300005614 Bacteria 7386
80 Ga0068856_100054926 3300005614 Bacteria 3930
81 Ga0068856_100363792 3300005614 Bacteria 1465
82 Ga0068856_100509537 3300005614 Unclassified 1224
83 Ga0068852_100265873 3300005616 Unclassified 1649
84 Ga0068852_100395297 3300005616 Bacteria 1359
85 Ga0068852_100632745 3300005616 Unclassified 1076
86 Ga0068859_100002226 3300005617 Bacteria 19660
87 Ga0068859_100139647 3300005617 Bacteria 2496
88 Ga0068864_100015408 3300005618 Bacteria 6357
89 Ga0068864_100185553 3300005618 Bacteria 1904
90 Ga0068864_100456099 3300005618 Bacteria 1223
91 Ga0068866_10001444 3300005718 Bacteria 10163
92 Ga0068866_10257188 3300005718 Unclassified 1071
93 Ga0068851_10059694 3300005834 Bacteria 1951
94 Ga0068851_10153275 3300005834 Bacteria 1261
95 Ga0068851_10302147 3300005834 Bacteria 920
96 Ga0068870_10070048 3300005840 Unclassified 1910
97 Ga0068863_100043025 3300005841 Unclassified 4289
98 Ga0068863_100509163 3300005841 Bacteria 1186
99 Ga0068858_100000404 3300005842 Bacteria 44997
100 Ga0068858_100038311 3300005842 Unclassified 4447
101 Ga0068860_100061698 3300005843 Unclassified 3562
102 Ga0068860_100218006 3300005843 Bacteria 1852
103 Ga0068860_100279266 3300005843 Bacteria 1632
104 Ga0070717_10022837 3300006028 Bacteria 4950
105 Ga0070717_10030119 3300006028 Bacteria 4359
106 Ga0070717_10091754 3300006028 Bacteria 2565
107 Ga0070717_11065573 3300006028 Bacteria 736
108 Ga0070717_11136243 3300006028 Unclassified 711
109 Ga0070716_100102891 3300006173 Bacteria 1755
110 Ga0070716_100500312 3300006173 Unclassified 896
111 Ga0070712_100142507 3300006175 Bacteria 1831
112 Ga0097621_100002200 3300006237 Bacteria 13355
113 Ga0097621_100004945 3300006237 Bacteria 9345
114 Ga0097621_100114229 3300006237 Bacteria 2284
115 Ga0097621_100124425 3300006237 Bacteria 2189
116 Ga0068871_100000941 3300006358 Bacteria 19435
117 Ga0068871_100135313 3300006358 Unclassified 2093
118 Ga0068871_100207122 3300006358 Unclassified 1695
119 Ga0068871_100250517 3300006358 Bacteria 1542
120 Ga0075434_100086217 3300006871 Bacteria 3140
121 Ga0068865_100075923 3300006881 Bacteria 2397
122 Ga0075436_100126752 3300006914 Bacteria 1789
123 Ga0075436_100130061 3300006914 Unclassified 1765
124 Ga0097620_100002226 3300006931 Bacteria 19660
125 Ga0097620_100139645 3300006931 Bacteria 2496
126 Ga0099794_10053856 3300007265 Bacteria 1941
127 Ga0099795_10064690 3300007788 Unclassified 1366
128 Ga0105240_10038596 3300009093 Bacteria 6124
129 Ga0105240_10052198 3300009093 Bacteria 5141
130 Ga0105240_10109707 3300009093 Bacteria 3341
131 Ga0105240_10133133 3300009093 Unclassified 2979
132 Ga0105240_10277856 3300009093 Bacteria 1925
133 Ga0105245_10415190 3300009098 Bacteria 1348
134 Ga0105243_10063482 3300009148 Bacteria 2960
135 Ga0105241_10014810 3300009174 Bacteria 5709
136 Ga0105241_10016902 3300009174 Bacteria 5354
137 Ga0105241_10039489 3300009174 Unclassified 3560
138 Ga0105241_10071595 3300009174 Bacteria 2691
139 Ga0105241_10596686 3300009174 Unclassified 997
140 Ga0105241_10686425 3300009174 Unclassified 933
141 Ga0105242_10131214 3300009176 Bacteria 2163
142 Ga0105242_10237724 3300009176 Unclassified 1636
143 Ga0105242_10382735 3300009176 Unclassified 1308
144 Ga0105248_10077437 3300009177 Bacteria 3738
145 Ga0105248_10112601 3300009177 Unclassified 3069
146 Ga0105248_10195751 3300009177 Unclassified 2277
147 Ga0105237_10083580 3300009545 Unclassified 3184
148 Ga0105237_10142623 3300009545 Bacteria 2390
149 Ga0105237_10280199 3300009545 Bacteria 1670
150 Ga0105237_10670995 3300009545 Unclassified 1043
151 Ga0105237_10838664 3300009545 Unclassified 926
152 Ga0105238_10000214 3300009551 Bacteria 64373
153 Ga0105238_10157455 3300009551 Bacteria 2247
154 Ga0105238_10230435 3300009551 Bacteria 1829
155 Ga0105238_10245541 3300009551 Bacteria 1768
156 Ga0105249_10001809 3300009553 Bacteria 18603
157 Ga0099796_10004673 3300010159 Bacteria 3341
158 Ga0099796_10117730 3300010159 Bacteria 1018
159 Ga0105239_10182873 3300010375 Bacteria 2345
160 Ga0105239_10431895 3300010375 Bacteria 1493
161 Ga0105246_10064219 3300011119 Bacteria 2564
162 Ga0157373_10025123 3300013100 Unclassified 4312
163 Ga0157373_10083629 3300013100 Bacteria 2250
164 Ga0157373_10461574 3300013100 Bacteria 915
165 Ga0157371_10024054 3300013102 Bacteria 4450
166 Ga0157371_10027153 3300013102 Unclassified 4154
167 Ga0157371_10038944 3300013102 Bacteria 3400
168 Ga0157370_10140535 3300013104 Bacteria 2250
169 Ga0157370_10269034 3300013104 Unclassified 1575
170 Ga0157370_10814265 3300013104 Bacteria 849
171 Ga0157369_10001356 3300013105 Bacteria 30251
172 Ga0157369_10064714 3300013105 Unclassified 3937
173 Ga0157369_10170892 3300013105 Bacteria 2290
174 Ga0157374_10002242 3300013296 Bacteria 16283
175 Ga0157374_10003412 3300013296 Bacteria 13346
176 Ga0157374_10008786 3300013296 Bacteria 8645
177 Ga0157374_10014876 3300013296 Bacteria 6818
178 Ga0157374_10147642 3300013296 Bacteria 2285
179 Ga0157374_10232256 3300013296 Unclassified 1812
180 Ga0157374_10367963 3300013296 Unclassified 1430
181 Ga0157378_10000202 3300013297 Bacteria 58070
182 Ga0157378_10012479 3300013297 Bacteria 7439
183 Ga0157378_10176162 3300013297 Bacteria 2009
184 Ga0157378_10441505 3300013297 Bacteria 1290
185 Ga0163162_10015319 3300013306 Bacteria 7490
186 Ga0163162_10018385 3300013306 Bacteria 6848
187 Ga0163162_10778678 3300013306 Unclassified 1075
188 Ga0163162_11777868 3300013306 Unclassified 704
189 Ga0157372_10001157 3300013307 Bacteria 28525
190 Ga0157372_10001445 3300013307 Bacteria 25697
191 Ga0157372_10016566 3300013307 Bacteria 7909
192 Ga0157372_10074232 3300013307 Unclassified 3835
193 Ga0157372_10360301 3300013307 Unclassified 1694
194 Ga0157372_10477475 3300013307 Bacteria 1453
195 Ga0157372_10546541 3300013307 Unclassified 1350
196 Ga0157375_10201432 3300013308 Bacteria 2147
197 Ga0157375_10478331 3300013308 Bacteria 1410
198 Ga0163163_10073978 3300014325 Unclassified 3398
199 Ga0163163_10124836 3300014325 Bacteria 2611
200 Ga0163163_10424138 3300014325 Bacteria 1389
201 Ga0157379_10053986 3300014968 Bacteria 3590
202 Ga0157376_10004196 3300014969 Bacteria 9997
203 Ga0157376_10053505 3300014969 Unclassified 3361
204 Ga0157376_10191129 3300014969 Bacteria 1877
205 Ga0157376_10322023 3300014969 Bacteria 1470
206 Ga0213874_10246250 3300021377 Bacteria 657
207 Ga0224712_10179067 3300022467 Bacteria 954
208 Ga0224572_1003252 3300024225 Unclassified 2726
209 Ga0228598_1003182 3300024227 Bacteria 3543
210 Ga0228598_1006277 3300024227 Bacteria 2463
211 Ga0228598_1009952 3300024227 Unclassified 1898
212 Ga0228598_1059983 3300024227 Bacteria 757
213 Ga0207656_10107448 3300025321 Bacteria 1286
214 Ga0207692_10015303 3300025898 Unclassified 3372
215 Ga0207692_10057077 3300025898 Bacteria 2006
216 Ga0207692_10205087 3300025898 Unclassified 1161
217 Ga0207642_10008415 3300025899 Unclassified 3537
218 Ga0207642_10036503 3300025899 Bacteria 2109
219 Ga0207710_10153006 3300025900 Unclassified 1120
220 Ga0207647_10124909 3300025904 Unclassified 1515
221 Ga0207699_10187849 3300025906 Bacteria 1393
222 Ga0207654_10021347 3300025911 Unclassified 3443
223 Ga0207654_10023868 3300025911 Unclassified 3281
224 Ga0207654_10075894 3300025911 Bacteria 2010
225 Ga0207654_10136336 3300025911 Bacteria 1560
226 Ga0207707_10026329 3300025912 Bacteria 5083
227 Ga0207707_10040331 3300025912 Bacteria 4077
228 Ga0207707_10364314 3300025912 Bacteria 1244
229 Ga0207695_10031007 3300025913 Bacteria 5876
230 Ga0207695_10040403 3300025913 Bacteria 5003
231 Ga0207695_10067734 3300025913 Unclassified 3660
232 Ga0207695_10319641 3300025913 Bacteria 1442
233 Ga0207671_10046215 3300025914 Unclassified 3220
234 Ga0207671_10095873 3300025914 Bacteria 2241
235 Ga0207671_10236249 3300025914 Bacteria 1435
236 Ga0207671_10428111 3300025914 Bacteria 1053
237 Ga0207693_10003867 3300025915 Bacteria 12759
238 Ga0207663_10022671 3300025916 Unclassified 3594
239 Ga0207663_10281840 3300025916 Bacteria 1235
240 Ga0207660_10162716 3300025917 Bacteria 1723
241 Ga0207662_10305462 3300025918 Bacteria 1059
242 Ga0207657_10001258 3300025919 Bacteria 27107
243 Ga0207649_10024680 3300025920 Unclassified 3498
244 Ga0207649_10105588 3300025920 Bacteria 1872
245 Ga0207652_10022027 3300025921 Bacteria 5266
246 Ga0207652_10074822 3300025921 Unclassified 2949
247 Ga0207646_10052457 3300025922 Bacteria 3649
248 Ga0207646_10531959 3300025922 Unclassified 1058
249 Ga0207646_10577331 3300025922 Viruses 1010
250 Ga0207681_10234045 3300025923 Bacteria 1427
251 Ga0207694_10125181 3300025924 Bacteria 2055
252 Ga0207694_10180115 3300025924 Bacteria 1713
253 Ga0207650_10177852 3300025925 Bacteria 1694
254 Ga0207659_10468583 3300025926 Bacteria 1063
255 Ga0207687_10018335 3300025927 Bacteria 4618
256 Ga0207687_10451617 3300025927 Unclassified 1066
257 Ga0207700_10023366 3300025928 Bacteria 4261
258 Ga0207700_10033000 3300025928 Bacteria 3700
259 Ga0207664_10657360 3300025929 Unclassified 942
260 Ga0207706_10000698 3300025933 Bacteria 35074
261 Ga0207686_10339979 3300025934 Bacteria 1127
262 Ga0207686_10409295 3300025934 Unclassified 1035
263 Ga0207709_10832335 3300025935 Bacteria 747
264 Ga0207670_10164517 3300025936 Archaea 1659
265 Ga0207670_10322610 3300025936 Bacteria 1216
266 Ga0207711_10031547 3300025941 Bacteria 4474
267 Ga0207711_10308456 3300025941 Bacteria 1461
268 Ga0207689_10035890 3300025942 Bacteria 4115
269 Ga0207689_10090679 3300025942 Bacteria 2511
270 Ga0207661_10039518 3300025944 Bacteria 3703
271 Ga0207661_10063337 3300025944 Unclassified 2995
272 Ga0207679_10001734 3300025945 Bacteria 13580
273 Ga0207679_10154841 3300025945 Bacteria 1870
274 Ga0207667_10002495 3300025949 Bacteria 22930
275 Ga0207667_10077333 3300025949 Unclassified 3452
276 Ga0207667_10125965 3300025949 Bacteria 2638
277 Ga0207667_10186436 3300025949 Bacteria 2130
278 Ga0207667_10421977 3300025949 Unclassified 1357
279 Ga0207651_10247170 3300025960 Bacteria 1457
280 Ga0207712_10404733 3300025961 Unclassified 1148
281 Ga0207668_10070687 3300025972 Unclassified 2490
282 Ga0207640_10125347 3300025981 Bacteria 1848
283 Ga0207640_10143967 3300025981 Bacteria 1741
284 Ga0207640_10222145 3300025981 Unclassified 1447
285 Ga0207640_10254351 3300025981 Bacteria 1365
286 Ga0207640_10555047 3300025981 Unclassified 966
287 Ga0207658_10076931 3300025986 Bacteria 2544
288 Ga0207677_10010671 3300026023 Bacteria 5206
289 Ga0207677_10013824 3300026023 Bacteria 4690
290 Ga0207703_10001237 3300026035 Bacteria 23917
291 Ga0207639_10017672 3300026041 Bacteria 5057
292 Ga0207639_10310686 3300026041 Bacteria 1396
293 Ga0207678_10000646 3300026067 Bacteria 32067
294 Ga0207702_10000866 3300026078 Bacteria 31529
295 Ga0207702_10007585 3300026078 Bacteria 9237
296 Ga0207702_10056513 3300026078 Unclassified 3332
297 Ga0207702_10196133 3300026078 Bacteria 1869
298 Ga0207702_10616645 3300026078 Unclassified 1065
299 Ga0207641_10067937 3300026088 Unclassified 3055
300 Ga0207648_10007372 3300026089 Bacteria 10830
301 Ga0207676_10007844 3300026095 Bacteria 7591
302 Ga0207676_10609677 3300026095 Bacteria 1049
303 Ga0207676_11624599 3300026095 Unclassified 644
304 Ga0207674_10000269 3300026116 Bacteria 65505
305 Ga0207674_10009833 3300026116 Bacteria 10891
306 Ga0207675_100194624 3300026118 Bacteria 1946
307 Ga0207698_10801172 3300026142 Unclassified 944
308 Ga0209588_1131791 3300027671 Bacteria 797
309 Ga0268266_10020488 3300028379 Bacteria 5637
310 Ga0268264_10113114 3300028381 Unclassified 2381
311 Ga0268264_10188110 3300028381 Bacteria 1880
312 Ga0268264_10347490 3300028381 Bacteria 1411
313 Ga0265338_10110809 3300028800 Bacteria 2211
314 Ga0265762_1000419 3300030760 Bacteria 7350
315 Ga0265762_1009734 3300030760 Bacteria 1715
316 Ga0265770_1019094 3300030878 Bacteria 1073
317 Ga0265760_10004596 3300031090 Bacteria 3955
318 Ga0265760_10132439 3300031090 Unclassified 807
319 Ga0265340_10077299 3300031247 Bacteria 1571
320 Ga0265339_10055711 3300031249 Bacteria 2143
321 Ga0265339_10071269 3300031249 Bacteria 1852
322 Ga0265316_10008863 3300031344 Bacteria 9290
323 Ga0265316_10045199 3300031344 Bacteria 3498
324 Ga0265314_10000348 3300031711 Bacteria 64175
325 Ga0265314_10116237 3300031711 Bacteria 1691
326 Ga0316214_1026620 3300033545 Unclassified 815
327 Ga0373930_0044257 3300034816 Bacteria 956
328 Ga0373930_0103046 3300034816 Unclassified 680
329 Ga0373929_0020846 3300035085 Bacteria 1325
330 Ga0373949_0025635 3300035090 Bacteria 1377
331 Ga0373952_0076151 3300035092 Unclassified 848
332 Ga0373923_0286730 3300035111 Unclassified 777
333 Ga0373932_0036260 3300035112 Unclassified 1399
334 Ga0373932_0103440 3300035112 Bacteria 930
335 Ga0373936_0010025 3300035113 Bacteria 3577
336 Ga0373954_0282232 3300035118 Bacteria 819
337 Ga0373955_0439220 3300035172 Bacteria 795
338 Ga0373962_0072507 3300035242 Unclassified 1032
339 Ga0373931_0038333 3300035691 Bacteria 2506
340 Ga0373931_0209493 3300035691 Unclassified 1168
341 Ga0373927_0026586 3300035695 Unclassified 3783
342 Ga0373927_0083601 3300035695 Bacteria 2070
343 Ga0373927_0165086 3300035695 Bacteria 1451
344 Ga0373927_0356972 3300035695 Unclassified 963
345 Ga0373933_0388900 3300035724 Bacteria 909
346 Ga0373937_0355040 3300036401 Unclassified 1389
347 Ga0373925_0007941 3300037068 Bacteria 7727
348 Ga0373925_0143423 3300037068 Bacteria 1870
349 Ga0373925_0313431 3300037068 Bacteria 1268
350 Ga0451577_0673202 3300042876 Unclassified 938
351 Ga0466957_0118069 3300044842 Unclassified 1689
352 Ga0466958_0021866 3300045836 Unclassified 3741
353 Ga0466967_0025290 3300045976 Bacteria 4894
354 Ga0495590_0114097 3300046457 Bacteria 965
355 Ga0495651_0362893 3300046462 Unclassified 954
356 Ga0495580_0009627 3300046472 Bacteria 7588
357 Ga0495580_0054655 3300046472 Unclassified 2815
358 Ga0495580_0164145 3300046472 Bacteria 1537
359 Ga0495580_0322344 3300046472 Bacteria 1050
360 Ga0495580_0416473 3300046472 Bacteria 904
361 Ga0495580_0463871 3300046472 Bacteria 849
362 Ga0495628_0444063 3300046516 Bacteria 943
363 Ga0495665_0302966 3300046531 Bacteria 818
364 Ga0495623_0251785 3300046679 Bacteria 993
365 Ga0495624_0294930 3300046690 Bacteria 978
366 Ga0495604_0497820 3300047317 Bacteria 791
367 Ga0495674_0167061 3300047319 Unclassified 1838
368 Ga0495675_0105204 3300047444 Bacteria 1764
369 Ga0495602_0191647 3300048088 Bacteria 1567
370 Ga0496100_0080039 3300048903 Unclassified 2203
371 Ga0496100_0577807 3300048903 Bacteria 871
372 Ga0496100_0657895 3300048903 Unclassified 816
373 Ga0496101_0005449 3300048904 Bacteria 8112
374 Ga0496101_0618433 3300048904 Unclassified 856
375 Ga0496102_0229206 3300048905 Bacteria 1751
376 Ga0496103_0177530 3300048906 Bacteria 1368
377 Ga0496104_0084381 3300048907 Unclassified 3031
378 Ga0496105_0105710 3300048908 Bacteria 2324
379 Ga0496106_0042977 3300048909 Unclassified 3390
380 Ga0496106_0386747 3300048909 Bacteria 1124
381 Ga0496107_0093390 3300048910 Bacteria 2200
382 Ga0496107_0713660 3300048910 Bacteria 737
383 Ga0496111_0132270 3300048914 Bacteria 1847
384 Ga0496112_0002144 3300048915 Bacteria 15666
385 Ga0496112_0082550 3300048915 Bacteria 3178
386 Ga0496112_0239138 3300048915 Bacteria 1769
387 Ga0496113_0327219 3300048916 Bacteria 1229
388 Ga0496113_0372487 3300048916 Bacteria 1146
389 Ga0496114_0056227 3300048917 Unclassified 3283
390 Ga0496115_0005520 3300048918 Bacteria 9205
391 Ga0501083_0048634 3300049744 Bacteria 2862
392 Ga0501083_0143584 3300049744 Bacteria 1563
393 nmdc:mga0n895_33375_c1 3300050512 Bacteria 4947
394 nmdc:mga0n895_75427_c1 3300050512 Bacteria 3352
395 nmdc:mga08x19_57200_c1 3300050514 Bacteria 2519
396 Ga0495612_0118002 3300053078 Bacteria 1140
397 Ga0097621_100182188
398 MRS1b_contig_5539674
399 Ga0065715_10177872
400 Ga0070658_10390108
401 Ga0070683_100056869
402 Ga0070683_100387444
403 Ga0070683_100703884
404 Ga0070690_100029649
405 Ga0070670_100003141
406 Ga0070670_100413358
407 Ga0070677_10011486
408 Ga0068869_100102128
409 Ga0068869_100247778
410 Ga0070666_10119548
411 Ga0070680_100083803
412 Ga0070682_100027390
413 Ga0068868_100002767
414 Ga0068868_100023693
415 Ga0070689_100152379
416 Ga0070691_10101457
417 Ga0070691_10114120
418 Ga0070661_100026229
419 Ga0070661_100035231
420 Ga0070692_10092292
421 Ga0070668_100069015
422 Ga0070675_100672341
423 Ga0070673_100202088
424 Ga0070673_100490193
425 Ga0070659_100023555
426 Ga0070667_100043881
427 Ga0070714_100750858
428 Ga0070713_100031216
429 Ga0070713_100267730
430 Ga0070710_10059901
431 Ga0070710_10075443
432 Ga0070711_100516153
433 Ga0070711_100770399
434 Ga0070708_100153866
435 Ga0070708_100187282
436 Ga0070708_100971280
437 Ga0070662_100006022
438 Ga0070681_10000516
439 Ga0070681_10012090
440 Ga0070681_10253161
441 Ga0070681_10455758
442 Ga0068867_100010239
443 Ga0068867_100035485
444 Ga0070685_10022368
445 Ga0070706_100488368
446 Ga0070707_100080828
447 Ga0070707_100137302
448 Ga0070698_100351327
449 Ga0070679_100080649
450 Ga0070679_100355525
451 Ga0070684_100088462
452 Ga0070684_100267531
453 Ga0070697_100000208
454 Ga0070697_100364452
455 Ga0068853_100028983
456 Ga0068853_100181390
457 Ga0070695_100117074
458 Ga0070696_100556674
459 Ga0070665_100146303
460 Ga0070704_100509486
461 Ga0068855_100001369
462 Ga0068855_100046547
463 Ga0068855_100224745
464 Ga0068855_100240445
465 Ga0070664_100000897
466 Ga0070664_100170543
467 Ga0068857_100000335
468 Ga0068857_100067871
469 Ga0068854_100029503
470 Ga0068854_100060205
471 Ga0068854_100234720
472 Ga0068854_100289543
473 Ga0068856_100001225
474 Ga0068856_100002789
475 Ga0068856_100015411
476 Ga0068856_100054926
477 Ga0068856_100363792
478 Ga0068856_100509537
479 Ga0068852_100265873
480 Ga0068852_100395297
481 Ga0068852_100632745
482 Ga0068859_100002226
483 Ga0068859_100139647
484 Ga0068864_100015408
485 Ga0068864_100185553
486 Ga0068864_100456099
487 Ga0068866_10001444
488 Ga0068866_10257188
489 Ga0068851_10059694
490 Ga0068851_10153275
491 Ga0068851_10302147
492 Ga0068870_10070048
493 Ga0068863_100043025
494 Ga0068863_100509163
495 Ga0068858_100000404
496 Ga0068858_100038311
497 Ga0068860_100061698
498 Ga0068860_100218006
499 Ga0068860_100279266
500 Ga0070717_10022837
501 Ga0070717_10030119
502 Ga0070717_10091754
503 Ga0070717_11065573
504 Ga0070717_11136243
505 Ga0070716_100102891
506 Ga0070716_100500312
507 Ga0070712_100142507
508 Ga0097621_100002200
509 Ga0097621_100004945
510 Ga0097621_100114229
511 Ga0097621_100124425
512 Ga0068871_100000941
513 Ga0068871_100135313
514 Ga0068871_100207122
515 Ga0068871_100250517
516 Ga0075434_100086217
517 Ga0068865_100075923
518 Ga0075436_100126752
519 Ga0075436_100130061
520 Ga0097620_100002226
521 Ga0097620_100139645
522 Ga0099794_10053856
523 Ga0099795_10064690
524 Ga0105240_10038596
525 Ga0105240_10052198
526 Ga0105240_10109707
527 Ga0105240_10133133
528 Ga0105240_10277856
529 Ga0105245_10415190
530 Ga0105243_10063482
531 Ga0105241_10014810
532 Ga0105241_10016902
533 Ga0105241_10039489
534 Ga0105241_10071595
535 Ga0105241_10596686
536 Ga0105241_10686425
537 Ga0105242_10131214
538 Ga0105242_10237724
539 Ga0105242_10382735
540 Ga0105248_10077437
541 Ga0105248_10112601
542 Ga0105248_10195751
543 Ga0105237_10083580
544 Ga0105237_10142623
545 Ga0105237_10280199
546 Ga0105237_10670995
547 Ga0105237_10838664
548 Ga0105238_10000214
549 Ga0105238_10157455
550 Ga0105238_10230435
551 Ga0105238_10245541
552 Ga0105249_10001809
553 Ga0099796_10004673
554 Ga0099796_10117730
555 Ga0105239_10182873
556 Ga0105239_10431895
557 Ga0105246_10064219
558 Ga0157373_10025123
559 Ga0157373_10083629
560 Ga0157373_10461574
561 Ga0157371_10024054
562 Ga0157371_10027153
563 Ga0157371_10038944
564 Ga0157370_10140535
565 Ga0157370_10269034
566 Ga0157370_10814265
567 Ga0157369_10001356
568 Ga0157369_10064714
569 Ga0157369_10170892
570 Ga0157374_10002242
571 Ga0157374_10003412
572 Ga0157374_10008786
573 Ga0157374_10014876
574 Ga0157374_10147642
575 Ga0157374_10232256
576 Ga0157374_10367963
577 Ga0157378_10000202
578 Ga0157378_10012479
579 Ga0157378_10176162
580 Ga0157378_10441505
581 Ga0163162_10015319
582 Ga0163162_10018385
583 Ga0163162_10778678
584 Ga0163162_11777868
585 Ga0157372_10001157
586 Ga0157372_10001445
587 Ga0157372_10016566
588 Ga0157372_10074232
589 Ga0157372_10360301
590 Ga0157372_10477475
591 Ga0157372_10546541
592 Ga0157375_10201432
593 Ga0157375_10478331
594 Ga0163163_10073978
595 Ga0163163_10124836
596 Ga0163163_10424138
597 Ga0157379_10053986
598 Ga0157376_10004196
599 Ga0157376_10053505
600 Ga0157376_10191129
601 Ga0157376_10322023
602 Ga0213874_10246250
603 Ga0224712_10179067
604 Ga0224572_1003252
605 Ga0228598_1003182
606 Ga0228598_1006277
607 Ga0228598_1009952
608 Ga0228598_1059983
609 Ga0207656_10107448
610 Ga0207692_10015303
611 Ga0207692_10057077
612 Ga0207692_10205087
613 Ga0207642_10008415
614 Ga0207642_10036503
615 Ga0207710_10153006
616 Ga0207647_10124909
617 Ga0207699_10187849
618 Ga0207654_10021347
619 Ga0207654_10023868
620 Ga0207654_10075894
621 Ga0207654_10136336
622 Ga0207707_10026329
623 Ga0207707_10040331
624 Ga0207707_10364314
625 Ga0207695_10031007
626 Ga0207695_10040403
627 Ga0207695_10067734
628 Ga0207695_10319641
629 Ga0207671_10046215
630 Ga0207671_10095873
631 Ga0207671_10236249
632 Ga0207671_10428111
633 Ga0207693_10003867
634 Ga0207663_10022671
635 Ga0207663_10281840
636 Ga0207660_10162716
637 Ga0207662_10305462
638 Ga0207657_10001258
639 Ga0207649_10024680
640 Ga0207649_10105588
641 Ga0207652_10022027
642 Ga0207652_10074822
643 Ga0207646_10052457
644 Ga0207646_10531959
645 Ga0207646_10577331
646 Ga0207681_10234045
647 Ga0207694_10125181
648 Ga0207694_10180115
649 Ga0207650_10177852
650 Ga0207659_10468583
651 Ga0207687_10018335
652 Ga0207687_10451617
653 Ga0207700_10023366
654 Ga0207700_10033000
655 Ga0207664_10657360
656 Ga0207706_10000698
657 Ga0207686_10339979
658 Ga0207686_10409295
659 Ga0207709_10832335
660 Ga0207670_10164517
661 Ga0207670_10322610
662 Ga0207711_10031547
663 Ga0207711_10308456
664 Ga0207689_10035890
665 Ga0207689_10090679
666 Ga0207661_10039518
667 Ga0207661_10063337
668 Ga0207679_10001734
669 Ga0207679_10154841
670 Ga0207667_10002495
671 Ga0207667_10077333
672 Ga0207667_10125965
673 Ga0207667_10186436
674 Ga0207667_10421977
675 Ga0207651_10247170
676 Ga0207712_10404733
677 Ga0207668_10070687
678 Ga0207640_10125347
679 Ga0207640_10143967
680 Ga0207640_10222145
681 Ga0207640_10254351
682 Ga0207640_10555047
683 Ga0207658_10076931
684 Ga0207677_10010671
685 Ga0207677_10013824
686 Ga0207703_10001237
687 Ga0207639_10017672
688 Ga0207639_10310686
689 Ga0207678_10000646
690 Ga0207702_10000866
691 Ga0207702_10007585
692 Ga0207702_10056513
693 Ga0207702_10196133
694 Ga0207702_10616645
695 Ga0207641_10067937
696 Ga0207648_10007372
697 Ga0207676_10007844
698 Ga0207676_10609677
699 Ga0207676_11624599
700 Ga0207674_10000269
701 Ga0207674_10009833
702 Ga0207675_100194624
703 Ga0207698_10801172
704 Ga0209588_1131791
705 Ga0268266_10020488
706 Ga0268264_10113114
707 Ga0268264_10188110
708 Ga0268264_10347490
709 Ga0265338_10110809
710 Ga0265762_1000419
711 Ga0265762_1009734
712 Ga0265770_1019094
713 Ga0265760_10004596
714 Ga0265760_10132439
715 Ga0265340_10077299
716 Ga0265339_10055711
717 Ga0265339_10071269
718 Ga0265316_10008863
719 Ga0265316_10045199
720 Ga0265314_10000348
721 Ga0265314_10116237
722 Ga0316214_1026620
723 Ga0373930_0044257
724 Ga0373930_0103046
725 Ga0373929_0020846
726 Ga0373949_0025635
727 Ga0373952_0076151
728 Ga0373923_0286730
729 Ga0373932_0036260
730 Ga0373932_0103440
731 Ga0373936_0010025
732 Ga0373954_0282232
733 Ga0373955_0439220
734 Ga0373962_0072507
735 Ga0373931_0038333
736 Ga0373931_0209493
737 Ga0373927_0026586
738 Ga0373927_0083601
739 Ga0373927_0165086
740 Ga0373927_0356972
741 Ga0373933_0388900
742 Ga0373937_0355040
743 Ga0373925_0007941
744 Ga0373925_0143423
745 Ga0373925_0313431
746 Ga0451577_0673202
747 Ga0466957_0118069
748 Ga0466958_0021866
749 Ga0466967_0025290
750 Ga0495590_0114097
751 Ga0495651_0362893
752 Ga0495580_0009627
753 Ga0495580_0054655
754 Ga0495580_0164145
755 Ga0495580_0322344
756 Ga0495580_0416473
757 Ga0495580_0463871
758 Ga0495628_0444063
759 Ga0495665_0302966
760 Ga0495623_0251785
761 Ga0495624_0294930
762 Ga0495604_0497820
763 Ga0495674_0167061
764 Ga0495675_0105204
765 Ga0495602_0191647
766 Ga0496100_0080039
767 Ga0496100_0577807
768 Ga0496100_0657895
769 Ga0496101_0005449
770 Ga0496101_0618433
771 Ga0496102_0229206
772 Ga0496103_0177530
773 Ga0496104_0084381
774 Ga0496105_0105710
775 Ga0496106_0042977
776 Ga0496106_0386747
777 Ga0496107_0093390
778 Ga0496107_0713660
779 Ga0496111_0132270
780 Ga0496112_0002144
781 Ga0496112_0082550
782 Ga0496112_0239138
783 Ga0496113_0327219
784 Ga0496113_0372487
785 Ga0496114_0056227
786 Ga0496115_0005520
787 Ga0501083_0048634
788 Ga0501083_0143584
789 nmdc:mga0n895_33375_c1
790 nmdc:mga0n895_75427_c1
791 nmdc:mga08x19_57200_c1
792 Ga0495612_0118002

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

68

150

0.75

PF00034

Cytochrom_C

Cytochrome c

70

154

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vzr-assembly1.cif.gz_c structure of the acidobacteria homodimeric reaction center bound with cytochrome c (the smaller form) 0.7941 106 151
6lod-assembly1.cif.gz_E cryo-em structure of the air-oxidized photosynthetic alternative complex iii from roseiflexus castenholzii 0.783 54 151
6loe-assembly1.cif.gz_E cryo-em structure of the dithionite-reduced photosynthetic alternative complex iii from roseiflexus castenholzii 0.7522 54 151
6rte-assembly2.cif.gz_B dihydro-heme d1 dehydrogenase nirn in complex with dhe 0.7491 66 152
6rte-assembly1.cif.gz_A dihydro-heme d1 dehydrogenase nirn in complex with dhe 0.7482 66 152
ID Description Score Start End Superfamily
1h9yA01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7271 60 145 1.10.760.10
1ls9A00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6876 62 145 1.10.760.10
1hzuA01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6776 51 145 1.10.760.10
4eifA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.6757 66 145 1.10.760.10
1h9yA01 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.655 60 145 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A2V5P7I6-F1-model_v4 Cytochrome c domain-containing protein 0.9063 66 159 GO:0009055
GO:0020037
GO:0046872
AF-A0A2V9S9M6-F1-model_v4 Cytochrome c domain-containing protein 0.8718 83 180 GO:0009055
GO:0020037
AF-A0A6B1A509-F1-model_v4 C-type cytochrome 0.8684 53 144 GO:0005507
GO:0005886
GO:0006825
GO:0009055
GO:0020037
GO:0042597
GO:0046688
AF-A0A2V5P7I6-F1-model_v4 Cytochrome c domain-containing protein 0.8634 66 159 GO:0009055
GO:0020037
GO:0046872
AF-T1BQH8-F1-model_v4 Cytochrome C class I protein 0.8631 23 158 GO:0009055
GO:0020037
GO:0046872

Map