F432681

General Info

Members Datasets Scaffolds Average Seq Length
393 200 393 214

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0214060|Ga0495580_0214060_523_1233
Length 236
Sequence MMSDGEASRPVTPQEPEMIRVITIDREYGSGGADIAKALADRLGWKLWDQALTNEIARYMECDCRVVEEHEEKRDPLYYRLLKSFMRGSYEGSQNAHRIKMADTECIREVTEGVVKRAADSGECVIVGRGSAYYLQSRRDAFHVFIYAPVKDKVRRLRNSGKSEGDAAHLAETVDQERAAFIKQYFNVEWPDRHKFHLMVNSTVGVSAAVDTILNSIALLQKSPAAPAPQEQPATQ

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
82 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
123 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
125 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
126 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
134 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
135 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
136 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
155 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
156 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.95
Metatranscriptomes 3.05
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.51
Rhizosphere 98.73
Stem 0
Stem Tuber 0
Unclassified 0.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_12905874 2162886012 Bacteria 1835
2 Ga0058862_12631993 3300004803 Unclassified 799
3 Ga0070658_10001930 3300005327 Bacteria 17424
4 Ga0070683_100110761 3300005329 Bacteria 2590
5 Ga0070680_100199903 3300005336 Bacteria 1685
6 Ga0070680_100554661 3300005336 Unclassified 985
7 Ga0070682_100318911 3300005337 Bacteria 1147
8 Ga0068868_100053489 3300005338 Bacteria 3181
9 Ga0068868_100232495 3300005338 Bacteria 1547
10 Ga0070692_10161162 3300005345 Unclassified 1285
11 Ga0070671_100110672 3300005355 Bacteria 2307
12 Ga0070671_100501590 3300005355 Unclassified 1044
13 Ga0070659_100275918 3300005366 Bacteria 1398
14 Ga0070667_100474370 3300005367 Unclassified 1145
15 Ga0070709_10203182 3300005434 Unclassified 1404
16 Ga0070705_100161741 3300005440 Bacteria 1497
17 Ga0070694_100178709 3300005444 Bacteria 1568
18 Ga0070694_100239605 3300005444 Bacteria 1368
19 Ga0070708_100013319 3300005445 Bacteria 6730
20 Ga0070708_100047026 3300005445 Bacteria 3810
21 Ga0070708_100170172 3300005445 Bacteria 2033
22 Ga0070708_100310531 3300005445 Bacteria 1485
23 Ga0070708_100464073 3300005445 Bacteria 1195
24 Ga0070681_10001893 3300005458 Bacteria 18889
25 Ga0070681_10006524 3300005458 Bacteria 11357
26 Ga0070681_10073516 3300005458 Unclassified 3380
27 Ga0068867_100009223 3300005459 Bacteria 6966
28 Ga0068867_100170499 3300005459 Unclassified 1723
29 Ga0070706_100003312 3300005467 Bacteria 15905
30 Ga0070706_100054430 3300005467 Bacteria 3693
31 Ga0070706_100056500 3300005467 Bacteria 3622
32 Ga0070706_100197025 3300005467 Bacteria 1882
33 Ga0070706_100217547 3300005467 Unclassified 1783
34 Ga0070706_100720885 3300005467 Bacteria 924
35 Ga0070707_100006177 3300005468 Bacteria 11159
36 Ga0070707_100144530 3300005468 Bacteria 2315
37 Ga0070707_100447482 3300005468 Bacteria 1252
38 Ga0070707_100561358 3300005468 Bacteria 1104
39 Ga0070698_100000150 3300005471 Bacteria 63199
40 Ga0070698_100001750 3300005471 Bacteria 24223
41 Ga0070698_100017991 3300005471 Bacteria 7442
42 Ga0070699_100003694 3300005518 Bacteria 13534
43 Ga0070699_100022467 3300005518 Bacteria 5437
44 Ga0070699_100029391 3300005518 Bacteria 4738
45 Ga0070699_100143652 3300005518 Bacteria 2108
46 Ga0070699_100242149 3300005518 Bacteria 1610
47 Ga0070699_100252059 3300005518 Unclassified 1577
48 Ga0070679_100008088 3300005530 Bacteria 9886
49 Ga0070679_100028732 3300005530 Bacteria 5485
50 Ga0070679_100099476 3300005530 Bacteria 2895
51 Ga0070679_100099477 3300005530 Bacteria 2895
52 Ga0070679_100340250 3300005530 Bacteria 1448
53 Ga0070684_100015691 3300005535 Bacteria 6180
54 Ga0070684_100138040 3300005535 Bacteria 2203
55 Ga0070697_100000638 3300005536 Bacteria 26584
56 Ga0070697_100009042 3300005536 Bacteria 7783
57 Ga0070697_100016319 3300005536 Bacteria 5841
58 Ga0070697_100020050 3300005536 Bacteria 5285
59 Ga0070697_100046673 3300005536 Unclassified 3511
60 Ga0070697_100049786 3300005536 Bacteria 3400
61 Ga0070697_100102707 3300005536 Bacteria 2375
62 Ga0070697_100474100 3300005536 Bacteria 1092
63 Ga0070697_100745349 3300005536 Bacteria 865
64 Ga0070697_100911120 3300005536 Bacteria 780
65 Ga0068853_100053323 3300005539 Bacteria 3483
66 Ga0070672_100151570 3300005543 Bacteria 1918
67 Ga0070695_100002145 3300005545 Bacteria 11307
68 Ga0070695_100041025 3300005545 Bacteria 2932
69 Ga0070696_100209983 3300005546 Bacteria 1457
70 Ga0070665_100790626 3300005548 Unclassified 962
71 Ga0070704_100263282 3300005549 Bacteria 1421
72 Ga0068855_100013652 3300005563 Bacteria 9796
73 Ga0068855_100154051 3300005563 Bacteria 2612
74 Ga0068855_100346216 3300005563 Bacteria 1638
75 Ga0070664_100052486 3300005564 Bacteria 3454
76 Ga0070664_100249192 3300005564 Bacteria 1596
77 Ga0070664_100550679 3300005564 Bacteria 1067
78 Ga0068857_100087208 3300005577 Unclassified 2791
79 Ga0068856_100025846 3300005614 Bacteria 5725
80 Ga0068856_100950108 3300005614 Unclassified 878
81 Ga0068852_100012037 3300005616 Bacteria 6547
82 Ga0068859_100942121 3300005617 Unclassified 947
83 Ga0068864_100455017 3300005618 Unclassified 1225
84 Ga0068866_10088577 3300005718 Bacteria 1680
85 Ga0068863_100032707 3300005841 Bacteria 4956
86 Ga0068863_100071340 3300005841 Unclassified 3286
87 Ga0068858_100039357 3300005842 Bacteria 4384
88 Ga0068858_100529430 3300005842 Unclassified 1140
89 Ga0068858_100556642 3300005842 Bacteria 1110
90 Ga0068858_101034659 3300005842 Unclassified 805
91 Ga0068860_100017677 3300005843 Bacteria 6947
92 Ga0070717_10028259 3300006028 Bacteria 4488
93 Ga0070716_100681183 3300006173 Unclassified 783
94 Ga0097621_100005283 3300006237 Bacteria 9091
95 Ga0097621_100013812 3300006237 Bacteria 6029
96 Ga0068871_100020876 3300006358 Bacteria 5024
97 Ga0068871_100066000 3300006358 Bacteria 2966
98 Ga0075428_100031883 3300006844 Bacteria 5822
99 Ga0075430_100007803 3300006846 Bacteria 9039
100 Ga0075431_100018898 3300006847 Bacteria 7020
101 Ga0075431_100491859 3300006847 Unclassified 1219
102 Ga0075433_10029017 3300006852 Bacteria 4709
103 Ga0075433_10030917 3300006852 Bacteria 4572
104 Ga0075433_10443558 3300006852 Bacteria 1144
105 Ga0075433_10514842 3300006852 Bacteria 1053
106 Ga0075434_100001983 3300006871 Bacteria 17751
107 Ga0075434_100131173 3300006871 Bacteria 2525
108 Ga0075434_100298075 3300006871 Bacteria 1633
109 Ga0075429_100178745 3300006880 Unclassified 1860
110 Ga0075429_100737396 3300006880 Unclassified 863
111 Ga0068865_100004900 3300006881 Bacteria 8092
112 Ga0075436_100026622 3300006914 Bacteria 3981
113 Ga0075436_100038720 3300006914 Bacteria 3291
114 Ga0097620_100942184 3300006931 Unclassified 947
115 Ga0075435_100030438 3300007076 Bacteria 4244
116 Ga0075435_100032100 3300007076 Bacteria 4145
117 Ga0075435_100037264 3300007076 Bacteria 3870
118 Ga0075435_100262560 3300007076 Bacteria 1471
119 Ga0099794_10088773 3300007265 Bacteria 1532
120 Ga0105251_10247670 3300009011 Unclassified 803
121 Ga0105240_10000350 3300009093 Bacteria 86419
122 Ga0105240_10010188 3300009093 Bacteria 13230
123 Ga0105240_10178822 3300009093 Bacteria 2505
124 Ga0105240_10247105 3300009093 Bacteria 2065
125 Ga0111539_10042080 3300009094 Bacteria 5489
126 Ga0105245_10003120 3300009098 Bacteria 14818
127 Ga0105245_10004516 3300009098 Bacteria 12294
128 Ga0105245_10019319 3300009098 Bacteria 5966
129 Ga0105245_10043055 3300009098 Bacteria 4028
130 Ga0105247_10225361 3300009101 Unclassified 1271
131 Ga0114129_10025490 3300009147 Bacteria 8380
132 Ga0114129_10082540 3300009147 Bacteria 4465
133 Ga0114129_10085065 3300009147 Bacteria 4388
134 Ga0114129_10108434 3300009147 Unclassified 3834
135 Ga0114129_10318035 3300009147 Bacteria 2070
136 Ga0114129_10389391 3300009147 Bacteria 1839
137 Ga0105243_10077372 3300009148 Bacteria 2706
138 Ga0105243_10672504 3300009148 Bacteria 1006
139 Ga0105241_10047818 3300009174 Bacteria 3254
140 Ga0105242_10005154 3300009176 Bacteria 10080
141 Ga0105242_10072822 3300009176 Bacteria 2855
142 Ga0105242_10129820 3300009176 Bacteria 2174
143 Ga0105248_10008212 3300009177 Bacteria 11468
144 Ga0105248_10038218 3300009177 Bacteria 5371
145 Ga0105248_10093861 3300009177 Bacteria 3379
146 Ga0105237_10019950 3300009545 Bacteria 6920
147 Ga0105237_10187561 3300009545 Bacteria 2068
148 Ga0105237_10219121 3300009545 Bacteria 1903
149 Ga0105237_10234740 3300009545 Bacteria 1835
150 Ga0105238_10000854 3300009551 Bacteria 31404
151 Ga0105238_10025815 3300009551 Bacteria 5989
152 Ga0105238_10027282 3300009551 Bacteria 5818
153 Ga0105238_10146762 3300009551 Bacteria 2335
154 Ga0105238_10225464 3300009551 Bacteria 1851
155 Ga0105238_10608131 3300009551 Unclassified 1101
156 Ga0105238_10749367 3300009551 Bacteria 990
157 Ga0105239_10041543 3300010375 Bacteria 5040
158 Ga0105239_10104422 3300010375 Bacteria 3137
159 Ga0105239_10469064 3300010375 Unclassified 1429
160 Ga0105239_10877945 3300010375 Unclassified 1029
161 Ga0105246_10052769 3300011119 Bacteria 2796
162 Ga0105246_10107694 3300011119 Bacteria 2042
163 Ga0105246_10656347 3300011119 Unclassified 914
164 Ga0157370_10011694 3300013104 Bacteria 9161
165 Ga0157370_10037691 3300013104 Bacteria 4684
166 Ga0157369_10014072 3300013105 Bacteria 9039
167 Ga0157369_10403594 3300013105 Bacteria 1418
168 Ga0157374_10049241 3300013296 Unclassified 3913
169 Ga0157374_10076187 3300013296 Bacteria 3172
170 Ga0157374_10161110 3300013296 Bacteria 2185
171 Ga0157374_10471332 3300013296 Bacteria 1258
172 Ga0157378_10008746 3300013297 Bacteria 8814
173 Ga0157378_10025586 3300013297 Bacteria 5196
174 Ga0157378_10061145 3300013297 Bacteria 3360
175 Ga0157378_10170838 3300013297 Bacteria 2039
176 Ga0163162_10005514 3300013306 Bacteria 12233
177 Ga0163162_10124121 3300013306 Bacteria 2687
178 Ga0163162_11901868 3300013306 Unclassified 681
179 Ga0157372_10021155 3300013307 Bacteria 7026
180 Ga0157372_10526269 3300013307 Unclassified 1378
181 Ga0157375_10173899 3300013308 Bacteria 2302
182 Ga0157375_10233162 3300013308 Bacteria 2000
183 Ga0157375_10579266 3300013308 Bacteria 1283
184 Ga0163163_10000822 3300014325 Bacteria 26449
185 Ga0163163_10024660 3300014325 Bacteria 5726
186 Ga0163163_10042991 3300014325 Bacteria 4428
187 Ga0163163_10051422 3300014325 Bacteria 4063
188 Ga0163163_10067750 3300014325 Bacteria 3550
189 Ga0163163_10108085 3300014325 Bacteria 2808
190 Ga0157376_10011082 3300014969 Bacteria 6629
191 Ga0157376_10115234 3300014969 Bacteria 2372
192 Ga0157376_10425047 3300014969 Unclassified 1290
193 Ga0197907_11397655 3300020069 Unclassified 1256
194 Ga0206355_1205025 3300020076 Unclassified 842
195 Ga0206355_1453800 3300020076 Bacteria 2714
196 Ga0206355_1654698 3300020076 Unclassified 1288
197 Ga0206350_11067123 3300020080 Unclassified 1192
198 Ga0154015_1620555 3300020610 Bacteria 3906
199 Ga0224712_10038364 3300022467 Bacteria 1789
200 Ga0224712_10133983 3300022467 Unclassified 1084
201 Ga0224712_10225170 3300022467 Unclassified 860
202 Ga0207642_10048383 3300025899 Bacteria 1906
203 Ga0207642_10215445 3300025899 Bacteria 1070
204 Ga0207680_10091731 3300025903 Bacteria 1933
205 Ga0207699_10045843 3300025906 Bacteria 2554
206 Ga0207705_10004015 3300025909 Bacteria 11192
207 Ga0207684_10012504 3300025910 Bacteria 7379
208 Ga0207684_10097450 3300025910 Bacteria 2511
209 Ga0207684_10405217 3300025910 Bacteria 1172
210 Ga0207707_10005621 3300025912 Bacteria 10966
211 Ga0207707_10006598 3300025912 Bacteria 10124
212 Ga0207707_10007268 3300025912 Bacteria 9641
213 Ga0207707_10077826 3300025912 Bacteria 2895
214 Ga0207707_10090793 3300025912 Bacteria 2669
215 Ga0207695_10003786 3300025913 Bacteria 20991
216 Ga0207695_10008003 3300025913 Bacteria 13314
217 Ga0207695_10021701 3300025913 Bacteria 7319
218 Ga0207695_10074242 3300025913 Bacteria 3463
219 Ga0207671_10012137 3300025914 Bacteria 6954
220 Ga0207663_10211486 3300025916 Bacteria 1406
221 Ga0207660_10071378 3300025917 Bacteria 2526
222 Ga0207660_10185163 3300025917 Unclassified 1619
223 Ga0207657_10011606 3300025919 Bacteria 8738
224 Ga0207652_10026617 3300025921 Bacteria 4819
225 Ga0207652_10223772 3300025921 Unclassified 1695
226 Ga0207652_10262208 3300025921 Bacteria 1559
227 Ga0207646_10624636 3300025922 Bacteria 966
228 Ga0207694_10001849 3300025924 Bacteria 17623
229 Ga0207694_10008442 3300025924 Bacteria 7775
230 Ga0207694_10037841 3300025924 Bacteria 3708
231 Ga0207694_10454241 3300025924 Unclassified 1070
232 Ga0207687_10029470 3300025927 Bacteria 3692
233 Ga0207687_10059560 3300025927 Bacteria 2691
234 Ga0207644_10176800 3300025931 Bacteria 1670
235 Ga0207644_10373114 3300025931 Unclassified 1162
236 Ga0207686_10023418 3300025934 Bacteria 3567
237 Ga0207686_10036450 3300025934 Bacteria 2961
238 Ga0207686_10349206 3300025934 Unclassified 1113
239 Ga0207686_10431996 3300025934 Unclassified 1009
240 Ga0207704_10002805 3300025938 Bacteria 7864
241 Ga0207704_10374701 3300025938 Bacteria 1115
242 Ga0207665_10083161 3300025939 Unclassified 2207
243 Ga0207665_10146089 3300025939 Bacteria 1690
244 Ga0207711_10011605 3300025941 Bacteria 7320
245 Ga0207711_10114509 3300025941 Bacteria 2402
246 Ga0207711_10292823 3300025941 Unclassified 1501
247 Ga0207661_10224455 3300025944 Bacteria 1661
248 Ga0207661_10559665 3300025944 Unclassified 1048
249 Ga0207661_11045345 3300025944 Unclassified 752
250 Ga0207679_10157525 3300025945 Bacteria 1856
251 Ga0207667_10007547 3300025949 Bacteria 13050
252 Ga0207667_10375850 3300025949 Unclassified 1448
253 Ga0207667_10528355 3300025949 Unclassified 1195
254 Ga0207658_10012054 3300025986 Bacteria 5898
255 Ga0207677_10651223 3300026023 Unclassified 930
256 Ga0207703_10368304 3300026035 Unclassified 1327
257 Ga0207703_10454277 3300026035 Unclassified 1197
258 Ga0207703_10706748 3300026035 Bacteria 959
259 Ga0207639_10564611 3300026041 Bacteria 1046
260 Ga0207702_10380504 3300026078 Bacteria 1357
261 Ga0207641_10062535 3300026088 Unclassified 3177
262 Ga0207641_10123065 3300026088 Unclassified 2318
263 Ga0207648_10019727 3300026089 Bacteria 6082
264 Ga0207648_10206632 3300026089 Unclassified 1742
265 Ga0207676_10125568 3300026095 Bacteria 2172
266 Ga0207676_10275156 3300026095 Unclassified 1526
267 Ga0207674_10031487 3300026116 Bacteria 5573
268 Ga0207674_10045534 3300026116 Bacteria 4511
269 Ga0207698_10038964 3300026142 Bacteria 3517
270 Ga0207428_10067745 3300027907 Bacteria 2810
271 Ga0268266_10545832 3300028379 Unclassified 1110
272 Ga0268264_10053432 3300028381 Bacteria 3370
273 Ga0265338_10002418 3300028800 Bacteria 28077
274 Ga0265338_10031676 3300028800 Bacteria 5179
275 Ga0265338_10072352 3300028800 Bacteria 2944
276 Ga0265324_10032721 3300029957 Unclassified 1816
277 Ga0265770_1003982 3300030878 Bacteria 2012
278 Ga0265332_10024581 3300031238 Bacteria 2649
279 Ga0265328_10022532 3300031239 Unclassified 2396
280 Ga0265320_10000836 3300031240 Bacteria 23203
281 Ga0265340_10020144 3300031247 Bacteria 3432
282 Ga0265331_10165621 3300031250 Unclassified 1001
283 Ga0265316_10001372 3300031344 Bacteria 26246
284 Ga0265316_10186285 3300031344 Bacteria 1544
285 Ga0265313_10086763 3300031595 Bacteria 1412
286 Ga0265314_10012575 3300031711 Bacteria 6894
287 Ga0265314_10051096 3300031711 Unclassified 2881
288 Ga0265314_10068884 3300031711 Bacteria 2377
289 Ga0265342_10017846 3300031712 Bacteria 4608
290 Ga0373934_0021891 3300035086 Bacteria 2464
291 Ga0373953_0009705 3300035117 Bacteria 3323
292 Ga0373954_0010737 3300035118 Bacteria 4049
293 Ga0373956_0009196 3300035119 Bacteria 4009
294 Ga0373955_0032363 3300035172 Bacteria 2744
295 Ga0373955_0335174 3300035172 Bacteria 915
296 Ga0373931_0193663 3300035691 Unclassified 1211
297 Ga0373927_0038164 3300035695 Bacteria 3119
298 Ga0373933_0001961 3300035724 Bacteria 11873
299 Ga0373947_0050909 3300035725 Bacteria 2491
300 Ga0373937_0000170 3300036401 Bacteria 63587
301 Ga0373937_0025833 3300036401 Bacteria 5304
302 Ga0373937_0169731 3300036401 Bacteria 2047
303 Ga0373937_0176994 3300036401 Unclassified 2003
304 Ga0373937_0295352 3300036401 Bacteria 1531
305 Ga0373937_0420997 3300036401 Bacteria 1268
306 Ga0373925_0772137 3300037068 Unclassified 792
307 Ga0395898_0376574 3300037466 Unclassified 1354
308 Ga0395905_0350245 3300037471 Unclassified 1369
309 Ga0436364_1253532 3300037853 Unclassified 919
310 Ga0436364_1391782 3300037853 Bacteria 1943
311 Ga0436362_0269899 3300039453 Unclassified 1292
312 Ga0495651_0003026 3300046462 Bacteria 12973
313 Ga0495651_0487818 3300046462 Bacteria 791
314 Ga0495580_0011283 3300046472 Bacteria 6915
315 Ga0495580_0019295 3300046472 Bacteria 5066
316 Ga0495580_0040094 3300046472 Bacteria 3348
317 Ga0495580_0214060 3300046472 Bacteria 1325
318 Ga0495585_0137301 3300046492 Bacteria 1283
319 Ga0495608_0264132 3300046511 Bacteria 1071
320 Ga0495587_0000292 3300046536 Bacteria 35533
321 Ga0495667_0094965 3300046559 Bacteria 1931
322 Ga0495656_0075857 3300046615 Bacteria 1505
323 Ga0495659_0009797 3300046664 Bacteria 3066
324 Ga0495623_0033469 3300046679 Bacteria 3298
325 Ga0495623_0129062 3300046679 Bacteria 1516
326 Ga0495669_0054464 3300046684 Unclassified 1801
327 Ga0495604_0163422 3300047317 Unclassified 1571
328 Ga0495675_0001123 3300047444 Bacteria 16274
329 Ga0495684_0079411 3300047471 Bacteria 2491
330 Ga0495602_0000456 3300048088 Bacteria 38089
331 Ga0496109_0677787 3300048912 Unclassified 968
332 Ga0496112_0125106 3300048915 Unclassified 2542
333 Ga0496126_0318114 3300048929 Unclassified 1280
334 Ga0501031_0006612 3300049568 Bacteria 7563
335 Ga0501032_0001669 3300049569 Bacteria 17636
336 Ga0501032_0383011 3300049569 Unclassified 904
337 Ga0501033_0022513 3300049570 Bacteria 4754
338 Ga0501033_0095417 3300049570 Bacteria 2174
339 Ga0501034_0006585 3300049571 Bacteria 12463
340 Ga0501036_0000317 3300049572 Bacteria 33714
341 Ga0501037_0001865 3300049573 Bacteria 15302
342 Ga0501038_0004956 3300049574 Bacteria 12365
343 Ga0501038_0159217 3300049574 Bacteria 1836
344 Ga0501039_0010691 3300049575 Bacteria 6991
345 Ga0501043_0001774 3300049579 Bacteria 18554
346 Ga0501043_0137064 3300049579 Bacteria 1917
347 Ga0501046_0027163 3300049580 Bacteria 4673
348 Ga0501047_0040145 3300049581 Bacteria 4526
349 Ga0501047_0103053 3300049581 Bacteria 2733
350 Ga0501048_0063862 3300049582 Bacteria 2603
351 Ga0501067_0002035 3300049583 Bacteria 11149
352 Ga0501068_0003882 3300049584 Bacteria 8117
353 Ga0501069_0001718 3300049585 Bacteria 10908
354 Ga0501069_0389837 3300049585 Unclassified 823
355 Ga0501070_0007805 3300049586 Bacteria 9072
356 Ga0501070_0048848 3300049586 Bacteria 3514
357 Ga0501072_0001561 3300049588 Bacteria 17101
358 Ga0501073_0004233 3300049589 Bacteria 10757
359 Ga0501073_0228734 3300049589 Bacteria 1285
360 Ga0501074_0003777 3300049590 Bacteria 10764
361 Ga0501076_0004165 3300049592 Bacteria 10237
362 Ga0501080_0001630 3300049742 Bacteria 19095
363 Ga0501080_0494384 3300049742 Bacteria 1094
364 Ga0501083_0001551 3300049744 Bacteria 15695
365 Ga0501035_0011759 3300049822 Bacteria 8105
366 Ga0501035_0056344 3300049822 Bacteria 3507
367 Ga0501044_0016405 3300049823 Bacteria 7952
368 Ga0501044_0161511 3300049823 Bacteria 2217
369 Ga0501045_0225800 3300049824 Bacteria 1394
370 nmdc:mga05p37_311708_c1 3300050507 Bacteria 1865
371 nmdc:mga05p37_458405_c1 3300050507 Bacteria 1474
372 nmdc:mga05p37_506725_c1 3300050507 Unclassified 1384
373 nmdc:mga05p37_61875_c1 3300050507 Bacteria 4607
374 nmdc:mga05p37_96152_c1 3300050507 Bacteria 3649
375 nmdc:mga0qj67_37078_c1 3300050509 Bacteria 3818
376 nmdc:mga06r32_121782_c1 3300050510 Bacteria 2574
377 nmdc:mga06r32_283968_c1 3300050510 Bacteria 1642
378 nmdc:mga06r32_552031_c1 3300050510 Unclassified 1126
379 nmdc:mga08y16_44493_c1 3300050511 Bacteria 4651
380 nmdc:mga0n895_18639_c1 3300050512 Bacteria 6427
381 nmdc:mga0n895_48840_c1 3300050512 Bacteria 4144
382 nmdc:mga0n895_8169_c1 3300050512 Bacteria 9045
383 nmdc:mga0rr50_17950_c1 3300050513 Bacteria 4739
384 nmdc:mga0rr50_694218_c1 3300050513 Bacteria 869
385 nmdc:mga08x19_36126_c2 3300050514 Bacteria 2284
386 nmdc:mga08x19_83624_c1 3300050514 Bacteria 2099
387 nmdc:mga0a205_33637_c1 3300050515 Bacteria 4915
388 nmdc:mga0a205_401_c1 3300050515 Bacteria 33097
389 nmdc:mga0a205_406448_c1 3300050515 Bacteria 1225
390 nmdc:mga0a205_680440_c1 3300050515 Bacteria 879
391 Ga0501084_0004543 3300054114 Bacteria 11348
392 Ga0587080_019023 3300059503 Unclassified 1109
393 Ga0501082_0002010 3300060353 Bacteria 17886

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014969 Ga0157376_10115234 Ga0157376_101152342 183
2 3300049823 Ga0501044_0161511 Ga0501044_0161511_1574_2191 191
3 3300005444 Ga0070694_100178709 Ga0070694_1001787092 199
4 3300005536 Ga0070697_100000638 Ga0070697_1000006388 199
5 3300005545 Ga0070695_100002145 Ga0070695_1000021458 199
6 3300009147 Ga0114129_10108434 Ga0114129_101084342 199
7 3300004803 Ga0058862_12631993 Ga0058862_126319931 200
8 3300020069 Ga0197907_11397655 Ga0197907_113976552 200
9 3300020076 Ga0206355_1654698 Ga0206355_16546982 200
10 3300020080 Ga0206350_11067123 Ga0206350_110671232 200
11 3300022467 Ga0224712_10038364 Ga0224712_100383641 200
12 3300006028 Ga0070717_10028259 Ga0070717_100282593 203
13 3300009551 Ga0105238_10749367 Ga0105238_107493671 203
14 3300013306 Ga0163162_11901868 Ga0163162_119018681 204
15 3300050515 nmdc:mga0a205_680440_c1 nmdc:mga0a205_680440_c1_230_865 204
16 3300013306 Ga0163162_10005514 Ga0163162_1000551410 205
17 3300036401 Ga0373937_0176994 Ga0373937_0176994_853_1470 205
18 3300037853 Ga0436364_1253532 Ga0436364_1253532_157_786 205
19 3300039453 Ga0436362_0269899 Ga0436362_0269899_574_1203 205
20 3300005327 Ga0070658_10001930 Ga0070658_1000193018 206
21 3300005329 Ga0070683_100110761 Ga0070683_1001107613 206
22 3300005338 Ga0068868_100053489 Ga0068868_1000534893 206
23 3300005355 Ga0070671_100501590 Ga0070671_1005015902 206
24 3300005445 Ga0070708_100310531 Ga0070708_1003105312 206
25 3300005458 Ga0070681_10001893 Ga0070681_100018937 206
26 3300005459 Ga0068867_100009223 Ga0068867_1000092233 206
27 3300005467 Ga0070706_100197025 Ga0070706_1001970251 206
28 3300005518 Ga0070699_100003694 Ga0070699_1000036948 206
29 3300005518 Ga0070699_100029391 Ga0070699_1000293914 206
30 3300005530 Ga0070679_100099477 Ga0070679_1000994772 206
31 3300005530 Ga0070679_100340250 Ga0070679_1003402502 206
32 3300005535 Ga0070684_100015691 Ga0070684_1000156912 206
33 3300005536 Ga0070697_100102707 Ga0070697_1001027073 206
34 3300005536 Ga0070697_100911120 Ga0070697_1009111201 206
35 3300005539 Ga0068853_100053323 Ga0068853_1000533232 206
36 3300005563 Ga0068855_100013652 Ga0068855_1000136525 206
37 3300005564 Ga0070664_100052486 Ga0070664_1000524862 206
38 3300005616 Ga0068852_100012037 Ga0068852_1000120378 206
39 3300005841 Ga0068863_100071340 Ga0068863_1000713402 206
40 3300005842 Ga0068858_100529430 Ga0068858_1005294302 206
41 3300006173 Ga0070716_100681183 Ga0070716_1006811832 206
42 3300006237 Ga0097621_100013812 Ga0097621_1000138122 206
43 3300006358 Ga0068871_100066000 Ga0068871_1000660002 206
44 3300009011 Ga0105251_10247670 Ga0105251_102476701 206
45 3300009093 Ga0105240_10178822 Ga0105240_101788223 206
46 3300009098 Ga0105245_10003120 Ga0105245_1000312011 206
47 3300009098 Ga0105245_10004516 Ga0105245_1000451612 206
48 3300009148 Ga0105243_10077372 Ga0105243_100773722 206
49 3300009174 Ga0105241_10047818 Ga0105241_100478182 206
50 3300009176 Ga0105242_10005154 Ga0105242_100051545 206
51 3300009176 Ga0105242_10129820 Ga0105242_101298202 206
52 3300009177 Ga0105248_10093861 Ga0105248_100938612 206
53 3300009545 Ga0105237_10187561 Ga0105237_101875612 206
54 3300009545 Ga0105237_10234740 Ga0105237_102347402 206
55 3300009551 Ga0105238_10025815 Ga0105238_100258156 206
56 3300009551 Ga0105238_10027282 Ga0105238_100272823 206
57 3300010375 Ga0105239_10041543 Ga0105239_100415432 206
58 3300010375 Ga0105239_10104422 Ga0105239_101044222 206
59 3300011119 Ga0105246_10107694 Ga0105246_101076943 206
60 3300013104 Ga0157370_10037691 Ga0157370_100376912 206
61 3300013105 Ga0157369_10014072 Ga0157369_100140725 206
62 3300013296 Ga0157374_10049241 Ga0157374_100492415 206
63 3300013296 Ga0157374_10076187 Ga0157374_100761873 206
64 3300013296 Ga0157374_10161110 Ga0157374_101611102 206
65 3300013297 Ga0157378_10025586 Ga0157378_100255863 206
66 3300013297 Ga0157378_10170838 Ga0157378_101708382 206
67 3300013306 Ga0163162_10124121 Ga0163162_101241213 206
68 3300013307 Ga0157372_10021155 Ga0157372_100211557 206
69 3300013308 Ga0157375_10173899 Ga0157375_101738992 206
70 3300013308 Ga0157375_10579266 Ga0157375_105792661 206
71 3300014325 Ga0163163_10000822 Ga0163163_1000082234 206
72 3300014325 Ga0163163_10042991 Ga0163163_100429912 206
73 3300014325 Ga0163163_10051422 Ga0163163_100514223 206
74 3300014969 Ga0157376_10011082 Ga0157376_100110826 206
75 3300025899 Ga0207642_10215445 Ga0207642_102154451 206
76 3300025909 Ga0207705_10004015 Ga0207705_100040154 206
77 3300025912 Ga0207707_10007268 Ga0207707_100072686 206
78 3300025912 Ga0207707_10090793 Ga0207707_100907931 206
79 3300025913 Ga0207695_10021701 Ga0207695_100217017 206
80 3300025919 Ga0207657_10011606 Ga0207657_100116067 206
81 3300025921 Ga0207652_10026617 Ga0207652_100266174 206
82 3300025921 Ga0207652_10262208 Ga0207652_102622082 206
83 3300025922 Ga0207646_10624636 Ga0207646_106246362 206
84 3300025924 Ga0207694_10008442 Ga0207694_100084427 206
85 3300025924 Ga0207694_10037841 Ga0207694_100378413 206
86 3300025927 Ga0207687_10029470 Ga0207687_100294702 206
87 3300025931 Ga0207644_10176800 Ga0207644_101768001 206
88 3300025934 Ga0207686_10023418 Ga0207686_100234183 206
89 3300025934 Ga0207686_10036450 Ga0207686_100364502 206
90 3300025938 Ga0207704_10374701 Ga0207704_103747011 206
91 3300025939 Ga0207665_10083161 Ga0207665_100831613 206
92 3300025941 Ga0207711_10114509 Ga0207711_101145093 206
93 3300025944 Ga0207661_10224455 Ga0207661_102244553 206
94 3300025944 Ga0207661_10559665 Ga0207661_105596651 206
95 3300025949 Ga0207667_10007547 Ga0207667_100075474 206
96 3300026035 Ga0207703_10368304 Ga0207703_103683042 206
97 3300026041 Ga0207639_10564611 Ga0207639_105646112 206
98 3300026088 Ga0207641_10062535 Ga0207641_100625352 206
99 3300026089 Ga0207648_10019727 Ga0207648_100197273 206
100 3300026095 Ga0207676_10125568 Ga0207676_101255682 206
101 3300026142 Ga0207698_10038964 Ga0207698_100389644 206
102 3300028800 Ga0265338_10072352 Ga0265338_100723523 206
103 3300031250 Ga0265331_10165621 Ga0265331_101656211 206
104 3300031344 Ga0265316_10186285 Ga0265316_101862852 206
105 3300031595 Ga0265313_10086763 Ga0265313_100867632 206
106 3300031711 Ga0265314_10012575 Ga0265314_100125753 206
107 3300046492 Ga0495585_0137301 Ga0495585_0137301_275_907 206
108 3300046615 Ga0495656_0075857 Ga0495656_0075857_55_744 206
109 3300046664 Ga0495659_0009797 Ga0495659_0009797_1988_2677 206
110 3300046684 Ga0495669_0054464 Ga0495669_0054464_196_885 206
111 3300005445 Ga0070708_100013319 Ga0070708_1000133196 207
112 3300005445 Ga0070708_100464073 Ga0070708_1004640731 207
113 3300005467 Ga0070706_100003312 Ga0070706_10000331217 207
114 3300005468 Ga0070707_100144530 Ga0070707_1001445302 207
115 3300005471 Ga0070698_100000150 Ga0070698_1000001504 207
116 3300005536 Ga0070697_100046673 Ga0070697_1000466732 207
117 3300005548 Ga0070665_100790626 Ga0070665_1007906262 207
118 3300005564 Ga0070664_100550679 Ga0070664_1005506791 207
119 3300007265 Ga0099794_10088773 Ga0099794_100887732 207
120 3300025910 Ga0207684_10012504 Ga0207684_100125044 207
121 3300025939 Ga0207665_10146089 Ga0207665_101460892 207
122 3300028379 Ga0268266_10545832 Ga0268266_105458322 207
123 3300035691 Ga0373931_0193663 Ga0373931_0193663_214_840 207
124 3300037853 Ga0436364_1391782 Ga0436364_1391782_547_1182 207
125 2162886012 MBSR1b_contig_12905874 MBSR1b_0571.00004950 208
126 3300005336 Ga0070680_100199903 Ga0070680_1001999032 208
127 3300005336 Ga0070680_100554661 Ga0070680_1005546612 208
128 3300005337 Ga0070682_100318911 Ga0070682_1003189112 208
129 3300005338 Ga0068868_100232495 Ga0068868_1002324952 208
130 3300005345 Ga0070692_10161162 Ga0070692_101611621 208
131 3300005355 Ga0070671_100110672 Ga0070671_1001106722 208
132 3300005366 Ga0070659_100275918 Ga0070659_1002759182 208
133 3300005367 Ga0070667_100474370 Ga0070667_1004743702 208
134 3300005434 Ga0070709_10203182 Ga0070709_102031822 208
135 3300005440 Ga0070705_100161741 Ga0070705_1001617412 208
136 3300005444 Ga0070694_100239605 Ga0070694_1002396052 208
137 3300005445 Ga0070708_100047026 Ga0070708_1000470262 208
138 3300005445 Ga0070708_100170172 Ga0070708_1001701722 208
139 3300005458 Ga0070681_10006524 Ga0070681_100065247 208
140 3300005458 Ga0070681_10073516 Ga0070681_100735164 208
141 3300005459 Ga0068867_100170499 Ga0068867_1001704992 208
142 3300005467 Ga0070706_100054430 Ga0070706_1000544304 208
143 3300005467 Ga0070706_100056500 Ga0070706_1000565002 208
144 3300005467 Ga0070706_100217547 Ga0070706_1002175472 208
145 3300005467 Ga0070706_100720885 Ga0070706_1007208851 208
146 3300005468 Ga0070707_100006177 Ga0070707_1000061779 208
147 3300005468 Ga0070707_100447482 Ga0070707_1004474822 208
148 3300005468 Ga0070707_100561358 Ga0070707_1005613582 208
149 3300005471 Ga0070698_100001750 Ga0070698_10000175027 208
150 3300005471 Ga0070698_100017991 Ga0070698_1000179915 208
151 3300005518 Ga0070699_100022467 Ga0070699_1000224674 208
152 3300005518 Ga0070699_100143652 Ga0070699_1001436522 208
153 3300005518 Ga0070699_100242149 Ga0070699_1002421491 208
154 3300005518 Ga0070699_100252059 Ga0070699_1002520591 208
155 3300005530 Ga0070679_100008088 Ga0070679_1000080888 208
156 3300005530 Ga0070679_100028732 Ga0070679_1000287323 208
157 3300005530 Ga0070679_100099476 Ga0070679_1000994763 208
158 3300005535 Ga0070684_100138040 Ga0070684_1001380403 208
159 3300005536 Ga0070697_100009042 Ga0070697_1000090424 208
160 3300005536 Ga0070697_100016319 Ga0070697_1000163195 208
161 3300005536 Ga0070697_100020050 Ga0070697_1000200503 208
162 3300005536 Ga0070697_100049786 Ga0070697_1000497862 208
163 3300005536 Ga0070697_100474100 Ga0070697_1004741002 208
164 3300005536 Ga0070697_100745349 Ga0070697_1007453492 208
165 3300005543 Ga0070672_100151570 Ga0070672_1001515702 208
166 3300005545 Ga0070695_100041025 Ga0070695_1000410252 208
167 3300005546 Ga0070696_100209983 Ga0070696_1002099832 208
168 3300005549 Ga0070704_100263282 Ga0070704_1002632822 208
169 3300005563 Ga0068855_100154051 Ga0068855_1001540512 208
170 3300005563 Ga0068855_100346216 Ga0068855_1003462162 208
171 3300005564 Ga0070664_100249192 Ga0070664_1002491922 208
172 3300005577 Ga0068857_100087208 Ga0068857_1000872084 208
173 3300005614 Ga0068856_100025846 Ga0068856_10002584610 208
174 3300005614 Ga0068856_100950108 Ga0068856_1009501081 208
175 3300005617 Ga0068859_100942121 Ga0068859_1009421211 208
176 3300005618 Ga0068864_100455017 Ga0068864_1004550172 208
177 3300005718 Ga0068866_10088577 Ga0068866_100885772 208
178 3300005841 Ga0068863_100032707 Ga0068863_1000327073 208
179 3300005842 Ga0068858_100039357 Ga0068858_1000393573 208
180 3300005842 Ga0068858_100556642 Ga0068858_1005566422 208
181 3300005842 Ga0068858_101034659 Ga0068858_1010346591 208
182 3300005843 Ga0068860_100017677 Ga0068860_1000176775 208
183 3300006237 Ga0097621_100005283 Ga0097621_10000528315 208
184 3300006358 Ga0068871_100020876 Ga0068871_1000208762 208
185 3300006844 Ga0075428_100031883 Ga0075428_1000318834 208
186 3300006846 Ga0075430_100007803 Ga0075430_1000078036 208
187 3300006847 Ga0075431_100018898 Ga0075431_1000188985 208
188 3300006847 Ga0075431_100491859 Ga0075431_1004918592 208
189 3300006852 Ga0075433_10029017 Ga0075433_100290172 208
190 3300006852 Ga0075433_10030917 Ga0075433_100309172 208
191 3300006852 Ga0075433_10443558 Ga0075433_104435582 208
192 3300006852 Ga0075433_10514842 Ga0075433_105148422 208
193 3300006871 Ga0075434_100001983 Ga0075434_1000019833 208
194 3300006871 Ga0075434_100131173 Ga0075434_1001311731 208
195 3300006871 Ga0075434_100298075 Ga0075434_1002980752 208
196 3300006880 Ga0075429_100178745 Ga0075429_1001787452 208
197 3300006880 Ga0075429_100737396 Ga0075429_1007373961 208
198 3300006881 Ga0068865_100004900 Ga0068865_10000490014 208
199 3300006914 Ga0075436_100026622 Ga0075436_1000266223 208
200 3300006914 Ga0075436_100038720 Ga0075436_1000387202 208
201 3300006931 Ga0097620_100942184 Ga0097620_1009421841 208
202 3300007076 Ga0075435_100030438 Ga0075435_1000304382 208
203 3300007076 Ga0075435_100032100 Ga0075435_1000321003 208
204 3300007076 Ga0075435_100037264 Ga0075435_1000372645 208
205 3300007076 Ga0075435_100262560 Ga0075435_1002625601 208
206 3300009093 Ga0105240_10000350 Ga0105240_1000035061 208
207 3300009093 Ga0105240_10010188 Ga0105240_100101885 208
208 3300009093 Ga0105240_10247105 Ga0105240_102471051 208
209 3300009094 Ga0111539_10042080 Ga0111539_100420803 208
210 3300009098 Ga0105245_10019319 Ga0105245_100193198 208
211 3300009098 Ga0105245_10043055 Ga0105245_100430552 208
212 3300009101 Ga0105247_10225361 Ga0105247_102253612 208
213 3300009147 Ga0114129_10025490 Ga0114129_100254906 208
214 3300009147 Ga0114129_10082540 Ga0114129_100825403 208
215 3300009147 Ga0114129_10085065 Ga0114129_100850654 208
216 3300009147 Ga0114129_10318035 Ga0114129_103180353 208
217 3300009147 Ga0114129_10389391 Ga0114129_103893912 208
218 3300009148 Ga0105243_10672504 Ga0105243_106725042 208
219 3300009176 Ga0105242_10072822 Ga0105242_100728222 208
220 3300009177 Ga0105248_10008212 Ga0105248_100082125 208
221 3300009177 Ga0105248_10038218 Ga0105248_100382187 208
222 3300009545 Ga0105237_10019950 Ga0105237_100199502 208
223 3300009545 Ga0105237_10219121 Ga0105237_102191212 208
224 3300009551 Ga0105238_10000854 Ga0105238_1000085416 208
225 3300009551 Ga0105238_10146762 Ga0105238_101467623 208
226 3300009551 Ga0105238_10225464 Ga0105238_102254642 208
227 3300009551 Ga0105238_10608131 Ga0105238_106081312 208
228 3300010375 Ga0105239_10469064 Ga0105239_104690642 208
229 3300010375 Ga0105239_10877945 Ga0105239_108779452 208
230 3300011119 Ga0105246_10052769 Ga0105246_100527693 208
231 3300011119 Ga0105246_10656347 Ga0105246_106563472 208
232 3300013104 Ga0157370_10011694 Ga0157370_100116942 208
233 3300013105 Ga0157369_10403594 Ga0157369_104035942 208
234 3300013296 Ga0157374_10471332 Ga0157374_104713322 208
235 3300013297 Ga0157378_10008746 Ga0157378_100087461 208
236 3300013297 Ga0157378_10061145 Ga0157378_100611452 208
237 3300013307 Ga0157372_10526269 Ga0157372_105262692 208
238 3300013308 Ga0157375_10233162 Ga0157375_102331622 208
239 3300014325 Ga0163163_10024660 Ga0163163_100246603 208
240 3300014325 Ga0163163_10067750 Ga0163163_100677501 208
241 3300014325 Ga0163163_10108085 Ga0163163_101080852 208
242 3300014969 Ga0157376_10425047 Ga0157376_104250471 208
243 3300020076 Ga0206355_1205025 Ga0206355_12050251 208
244 3300020076 Ga0206355_1453800 Ga0206355_14538002 208
245 3300020610 Ga0154015_1620555 Ga0154015_16205556 208
246 3300022467 Ga0224712_10133983 Ga0224712_101339832 208
247 3300022467 Ga0224712_10225170 Ga0224712_102251702 208
248 3300025899 Ga0207642_10048383 Ga0207642_100483832 208
249 3300025903 Ga0207680_10091731 Ga0207680_100917312 208
250 3300025906 Ga0207699_10045843 Ga0207699_100458432 208
251 3300025910 Ga0207684_10097450 Ga0207684_100974501 208
252 3300025910 Ga0207684_10405217 Ga0207684_104052172 208
253 3300025912 Ga0207707_10005621 Ga0207707_100056213 208
254 3300025912 Ga0207707_10006598 Ga0207707_100065987 208
255 3300025912 Ga0207707_10077826 Ga0207707_100778262 208
256 3300025913 Ga0207695_10003786 Ga0207695_100037869 208
257 3300025913 Ga0207695_10008003 Ga0207695_100080032 208
258 3300025913 Ga0207695_10074242 Ga0207695_100742422 208
259 3300025914 Ga0207671_10012137 Ga0207671_100121376 208
260 3300025916 Ga0207663_10211486 Ga0207663_102114862 208
261 3300025917 Ga0207660_10071378 Ga0207660_100713783 208
262 3300025917 Ga0207660_10185163 Ga0207660_101851631 208
263 3300025921 Ga0207652_10223772 Ga0207652_102237722 208
264 3300025924 Ga0207694_10001849 Ga0207694_100018499 208
265 3300025924 Ga0207694_10454241 Ga0207694_104542412 208
266 3300025927 Ga0207687_10059560 Ga0207687_100595602 208
267 3300025931 Ga0207644_10373114 Ga0207644_103731142 208
268 3300025934 Ga0207686_10349206 Ga0207686_103492062 208
269 3300025934 Ga0207686_10431996 Ga0207686_104319962 208
270 3300025938 Ga0207704_10002805 Ga0207704_1000280512 208
271 3300025941 Ga0207711_10011605 Ga0207711_100116052 208
272 3300025941 Ga0207711_10292823 Ga0207711_102928232 208
273 3300025944 Ga0207661_11045345 Ga0207661_110453451 208
274 3300025945 Ga0207679_10157525 Ga0207679_101575251 208
275 3300025949 Ga0207667_10375850 Ga0207667_103758502 208
276 3300025949 Ga0207667_10528355 Ga0207667_105283551 208
277 3300025986 Ga0207658_10012054 Ga0207658_100120542 208
278 3300026023 Ga0207677_10651223 Ga0207677_106512231 208
279 3300026035 Ga0207703_10454277 Ga0207703_104542772 208
280 3300026035 Ga0207703_10706748 Ga0207703_107067481 208
281 3300026078 Ga0207702_10380504 Ga0207702_103805042 208
282 3300026088 Ga0207641_10123065 Ga0207641_101230652 208
283 3300026089 Ga0207648_10206632 Ga0207648_102066322 208
284 3300026095 Ga0207676_10275156 Ga0207676_102751562 208
285 3300026116 Ga0207674_10031487 Ga0207674_100314872 208
286 3300026116 Ga0207674_10045534 Ga0207674_100455345 208
287 3300027907 Ga0207428_10067745 Ga0207428_100677453 208
288 3300028381 Ga0268264_10053432 Ga0268264_100534323 208
289 3300028800 Ga0265338_10002418 Ga0265338_1000241815 208
290 3300028800 Ga0265338_10031676 Ga0265338_100316763 208
291 3300029957 Ga0265324_10032721 Ga0265324_100327211 208
292 3300030878 Ga0265770_1003982 Ga0265770_10039821 208
293 3300031238 Ga0265332_10024581 Ga0265332_100245814 208
294 3300031239 Ga0265328_10022532 Ga0265328_100225322 208
295 3300031240 Ga0265320_10000836 Ga0265320_100008369 208
296 3300031247 Ga0265340_10020144 Ga0265340_100201443 208
297 3300031344 Ga0265316_10001372 Ga0265316_1000137219 208
298 3300031711 Ga0265314_10051096 Ga0265314_100510964 208
299 3300031711 Ga0265314_10068884 Ga0265314_100688844 208
300 3300031712 Ga0265342_10017846 Ga0265342_100178462 208
301 3300035086 Ga0373934_0021891 Ga0373934_0021891_216_875 208
302 3300035117 Ga0373953_0009705 Ga0373953_0009705_906_1565 208
303 3300035118 Ga0373954_0010737 Ga0373954_0010737_3123_3782 208
304 3300035119 Ga0373956_0009196 Ga0373956_0009196_2229_2891 208
305 3300035172 Ga0373955_0032363 Ga0373955_0032363_408_1070 208
306 3300035172 Ga0373955_0335174 Ga0373955_0335174_207_866 208
307 3300035695 Ga0373927_0038164 Ga0373927_0038164_565_1197 208
308 3300035724 Ga0373933_0001961 Ga0373933_0001961_8923_9585 208
309 3300035725 Ga0373947_0050909 Ga0373947_0050909_1330_1962 208
310 3300036401 Ga0373937_0000170 Ga0373937_0000170_62320_62982 208
311 3300036401 Ga0373937_0025833 Ga0373937_0025833_2388_3047 208
312 3300036401 Ga0373937_0169731 Ga0373937_0169731_496_1146 208
313 3300036401 Ga0373937_0295352 Ga0373937_0295352_520_1194 208
314 3300036401 Ga0373937_0420997 Ga0373937_0420997_387_1019 208
315 3300037068 Ga0373925_0772137 Ga0373925_0772137_95_730 208
316 3300037466 Ga0395898_0376574 Ga0395898_0376574_401_1075 208
317 3300037471 Ga0395905_0350245 Ga0395905_0350245_377_1045 208
318 3300046462 Ga0495651_0003026 Ga0495651_0003026_2679_3341 208
319 3300046462 Ga0495651_0487818 Ga0495651_0487818_47_679 208
320 3300046472 Ga0495580_0011283 Ga0495580_0011283_392_1027 208
321 3300046472 Ga0495580_0019295 Ga0495580_0019295_3873_4532 208
322 3300046472 Ga0495580_0040094 Ga0495580_0040094_2530_3210 208
323 3300046472 Ga0495580_0214060 Ga0495580_0214060_523_1233 208
324 3300046511 Ga0495608_0264132 Ga0495608_0264132_268_927 208
325 3300046536 Ga0495587_0000292 Ga0495587_0000292_20919_21581 208
326 3300046559 Ga0495667_0094965 Ga0495667_0094965_187_846 208
327 3300046679 Ga0495623_0033469 Ga0495623_0033469_1446_2108 208
328 3300046679 Ga0495623_0129062 Ga0495623_0129062_759_1418 208
329 3300047317 Ga0495604_0163422 Ga0495604_0163422_642_1304 208
330 3300047444 Ga0495675_0001123 Ga0495675_0001123_4614_5276 208
331 3300047471 Ga0495684_0079411 Ga0495684_0079411_66_725 208
332 3300048088 Ga0495602_0000456 Ga0495602_0000456_579_1241 208
333 3300048912 Ga0496109_0677787 Ga0496109_0677787_305_937 208
334 3300048915 Ga0496112_0125106 Ga0496112_0125106_1126_1758 208
335 3300048929 Ga0496126_0318114 Ga0496126_0318114_44_712 208
336 3300049568 Ga0501031_0006612 Ga0501031_0006612_1242_1901 208
337 3300049569 Ga0501032_0001669 Ga0501032_0001669_4562_5221 208
338 3300049569 Ga0501032_0383011 Ga0501032_0383011_51_719 208
339 3300049570 Ga0501033_0022513 Ga0501033_0022513_1285_1944 208
340 3300049570 Ga0501033_0095417 Ga0501033_0095417_668_1336 208
341 3300049571 Ga0501034_0006585 Ga0501034_0006585_2729_3388 208
342 3300049572 Ga0501036_0000317 Ga0501036_0000317_17646_18305 208
343 3300049573 Ga0501037_0001865 Ga0501037_0001865_5123_5782 208
344 3300049574 Ga0501038_0004956 Ga0501038_0004956_1759_2418 208
345 3300049574 Ga0501038_0159217 Ga0501038_0159217_208_876 208
346 3300049575 Ga0501039_0010691 Ga0501039_0010691_5043_5702 208
347 3300049579 Ga0501043_0001774 Ga0501043_0001774_15167_15826 208
348 3300049579 Ga0501043_0137064 Ga0501043_0137064_121_789 208
349 3300049580 Ga0501046_0027163 Ga0501046_0027163_3859_4518 208
350 3300049581 Ga0501047_0040145 Ga0501047_0040145_2323_2982 208
351 3300049581 Ga0501047_0103053 Ga0501047_0103053_1879_2547 208
352 3300049582 Ga0501048_0063862 Ga0501048_0063862_38_697 208
353 3300049583 Ga0501067_0002035 Ga0501067_0002035_8732_9391 208
354 3300049584 Ga0501068_0003882 Ga0501068_0003882_4648_5307 208
355 3300049585 Ga0501069_0001718 Ga0501069_0001718_6536_7195 208
356 3300049585 Ga0501069_0389837 Ga0501069_0389837_138_806 208
357 3300049586 Ga0501070_0007805 Ga0501070_0007805_7129_7788 208
358 3300049586 Ga0501070_0048848 Ga0501070_0048848_2375_3043 208
359 3300049588 Ga0501072_0001561 Ga0501072_0001561_5326_5985 208
360 3300049589 Ga0501073_0004233 Ga0501073_0004233_1759_2418 208
361 3300049589 Ga0501073_0228734 Ga0501073_0228734_154_822 208
362 3300049590 Ga0501074_0003777 Ga0501074_0003777_9758_10417 208
363 3300049592 Ga0501076_0004165 Ga0501076_0004165_2079_2738 208
364 3300049742 Ga0501080_0001630 Ga0501080_0001630_5252_5911 208
365 3300049742 Ga0501080_0494384 Ga0501080_0494384_293_961 208
366 3300049744 Ga0501083_0001551 Ga0501083_0001551_13624_14283 208
367 3300049822 Ga0501035_0011759 Ga0501035_0011759_2195_2854 208
368 3300049822 Ga0501035_0056344 Ga0501035_0056344_308_976 208
369 3300049823 Ga0501044_0016405 Ga0501044_0016405_2170_2829 208
370 3300049824 Ga0501045_0225800 Ga0501045_0225800_452_1111 208
371 3300050507 nmdc:mga05p37_311708_c1 nmdc:mga05p37_311708_c1_919_1578 208
372 3300050507 nmdc:mga05p37_458405_c1 nmdc:mga05p37_458405_c1_732_1358 208
373 3300050507 nmdc:mga05p37_506725_c1 nmdc:mga05p37_506725_c1_509_1135 208
374 3300050507 nmdc:mga05p37_61875_c1 nmdc:mga05p37_61875_c1_1109_1735 208
375 3300050507 nmdc:mga05p37_96152_c1 nmdc:mga05p37_96152_c1_256_906 208
376 3300050509 nmdc:mga0qj67_37078_c1 nmdc:mga0qj67_37078_c1_882_1508 208
377 3300050510 nmdc:mga06r32_121782_c1 nmdc:mga06r32_121782_c1_749_1375 208
378 3300050510 nmdc:mga06r32_283968_c1 nmdc:mga06r32_283968_c1_141_773 208
379 3300050510 nmdc:mga06r32_552031_c1 nmdc:mga06r32_552031_c1_95_721 208
380 3300050511 nmdc:mga08y16_44493_c1 nmdc:mga08y16_44493_c1_2964_3590 208
381 3300050512 nmdc:mga0n895_18639_c1 nmdc:mga0n895_18639_c1_5556_6206 208
382 3300050512 nmdc:mga0n895_48840_c1 nmdc:mga0n895_48840_c1_949_1617 208
383 3300050512 nmdc:mga0n895_8169_c1 nmdc:mga0n895_8169_c1_5527_6186 208
384 3300050513 nmdc:mga0rr50_17950_c1 nmdc:mga0rr50_17950_c1_2882_3553 208
385 3300050513 nmdc:mga0rr50_694218_c1 nmdc:mga0rr50_694218_c1_181_849 208
386 3300050514 nmdc:mga08x19_36126_c2 nmdc:mga08x19_36126_c2_1442_2110 208
387 3300050514 nmdc:mga08x19_83624_c1 nmdc:mga08x19_83624_c1_1208_1879 208
388 3300050515 nmdc:mga0a205_33637_c1 nmdc:mga0a205_33637_c1_2136_2804 208
389 3300050515 nmdc:mga0a205_401_c1 nmdc:mga0a205_401_c1_31158_31808 208
390 3300050515 nmdc:mga0a205_406448_c1 nmdc:mga0a205_406448_c1_188_817 208
391 3300054114 Ga0501084_0004543 Ga0501084_0004543_9253_9912 208
392 3300059503 Ga0587080_019023 Ga0587080_019023_44_676 208
393 3300060353 Ga0501082_0002010 Ga0501082_0002010_2170_2829 208

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13189

Cytidylate_kin2

Cytidylate kinase-like family

21

204

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fdi-assembly1.cif.gz_A crystal structure of uncharacterized protein from eubacterium ventriosum atcc 27560. 0.8824 1 200
3fdi-assembly1.cif.gz_A crystal structure of uncharacterized protein from eubacterium ventriosum atcc 27560. 0.8618 1 200
3hdt-assembly1.cif.gz_B crystal structure of putative kinase from clostridium symbiosum atcc 14940 0.8493 2 202
3hdt-assembly1.cif.gz_B crystal structure of putative kinase from clostridium symbiosum atcc 14940 0.8157 2 202
3fdi-assembly1.cif.gz_B crystal structure of uncharacterized protein from eubacterium ventriosum atcc 27560. 0.7964 1 200
ID Description Score Start End Superfamily
3fdiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8666 1 196 3.40.50.300
3hdtB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8536 2 202 3.40.50.300
3fdiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8303 1 196 3.40.50.300
3hdtB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8239 2 202 3.40.50.300
af_Q58071_1_176_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.757 4 200 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2V6QY41-F1-model_v4 Cytidylate kinase-like family protein 0.9814 95 203
AF-A0A5P0Q2C0-F1-model_v4 deleted 0.9374 84 200
AF-A0A5P0Q2C0-F1-model_v4 deleted 0.9077 84 200
AF-A0A412WRU4-F1-model_v4 Cytidylate kinase family protein (MFS transporter) 0.9044 1 204 GO:0016020
GO:0016301
GO:0022857
AF-A0A2U3QDV4-F1-model_v4 Putative Cytidylate kinase-like family 0.9035 2 206 GO:0016301

Feature Viewer

pLDDT pTM Quality
86.59 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map