F432569

General Info

Members Datasets Scaffolds Average Seq Length
393 230 786 297

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10011572|Ga0105245_100115725
Length 303
Sequence MFRGTFTALVTPFRSGAVDLDALGKLVEQQIAAGITGVVAVGTTGESPTLSHDERLSVIRNCVEVAKGRCLVLAGTGSYSTRDAIEASKQAQAIGVDGLLIVAPYYNKPSQEGLFQHFSTIAQTTSLPIMLYNIPGRCGVDIGVETVVRLAGSCRNIVSIKEASGSVDRVSELRTRLDKAFTILSGDDSLTLPFMSVGAAGVVSVASNLIPEEVGALVRAYQKGDVQRAAELHRLCYGMFKDLFVEPNPVPIKTAMEWNGMVSSEVRLPLCAMSKANQERLRKTFDTFQRVRGAATVPAAKVA

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
125 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
136 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
190 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
191 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
194 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
209 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
210 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
211 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
212 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
213 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
214 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
217 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
218 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
228 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.75
Metatranscriptomes 0.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.25
Nodule 0
Rhizoplane 0.76
Rhizosphere 98.73
Stem 0
Stem Tuber 0
Unclassified 9.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10011572 3300009098 Bacteria 7686
2 MBSR1b_contig_742276 2162886012 Bacteria 4472
3 MBSR1b_contig_8562938 2162886012 Unclassified 2176
4 Ga0058863_11542014 3300004799 Bacteria 1553
5 Ga0065715_10095297 3300005293 Bacteria 4117
6 Ga0065707_10268092 3300005295 Bacteria 1079
7 Ga0070658_10010761 3300005327 Bacteria 7334
8 Ga0070658_10014420 3300005327 Bacteria 6342
9 Ga0070658_10025653 3300005327 Bacteria 4724
10 Ga0070658_10064540 3300005327 Bacteria 2987
11 Ga0070683_100001703 3300005329 Bacteria 17096
12 Ga0070683_100006264 3300005329 Bacteria 9983
13 Ga0070683_100063355 3300005329 Bacteria 3439
14 Ga0070683_100065813 3300005329 Bacteria 3375
15 Ga0070683_100098151 3300005329 Bacteria 2756
16 Ga0070670_100002124 3300005331 Bacteria 16265
17 Ga0068869_100011969 3300005334 Bacteria 5709
18 Ga0070680_100010008 3300005336 Bacteria 7305
19 Ga0070680_100010080 3300005336 Bacteria 7280
20 Ga0070680_100013803 3300005336 Bacteria 6300
21 Ga0070680_100145319 3300005336 Bacteria 1989
22 Ga0070680_100218253 3300005336 Bacteria 1609
23 Ga0070682_100001135 3300005337 Bacteria 15176
24 Ga0070682_100001146 3300005337 Bacteria 15127
25 Ga0070682_100012652 3300005337 Bacteria 4841
26 Ga0070682_100014752 3300005337 Bacteria 4519
27 Ga0068868_100131134 3300005338 Unclassified 2051
28 Ga0070660_100010374 3300005339 Bacteria 6584
29 Ga0070660_100174203 3300005339 Bacteria 1739
30 Ga0070689_100010567 3300005340 Bacteria 6581
31 Ga0070689_100127788 3300005340 Bacteria 2036
32 Ga0070661_100004560 3300005344 Bacteria 9527
33 Ga0070661_100006124 3300005344 Bacteria 8281
34 Ga0070692_10018132 3300005345 Bacteria 3379
35 Ga0070692_10118763 3300005345 Unclassified 1472
36 Ga0070668_100409645 3300005347 Bacteria 1159
37 Ga0070669_100113007 3300005353 Bacteria 2063
38 Ga0070675_100018454 3300005354 Bacteria 5553
39 Ga0070671_100129742 3300005355 Bacteria 2123
40 Ga0070674_100166024 3300005356 Unclassified 1679
41 Ga0070673_100024059 3300005364 Bacteria 4459
42 Ga0070659_100003132 3300005366 Bacteria 11773
43 Ga0070659_100021136 3300005366 Bacteria 4951
44 Ga0070667_100208480 3300005367 Bacteria 1737
45 Ga0070667_100329609 3300005367 Bacteria 1379
46 Ga0070703_10055906 3300005406 Unclassified 1276
47 Ga0070709_10012131 3300005434 Bacteria 4818
48 Ga0070709_10359344 3300005434 Unclassified 1078
49 Ga0070714_100030295 3300005435 Bacteria 4502
50 Ga0070714_100034034 3300005435 Bacteria 4266
51 Ga0070713_100002685 3300005436 Bacteria 11604
52 Ga0070713_100655624 3300005436 Bacteria 1000
53 Ga0070710_10035865 3300005437 Bacteria 2707
54 Ga0070694_100068441 3300005444 Bacteria 2440
55 Ga0070708_100002854 3300005445 Bacteria 13420
56 Ga0070708_100217390 3300005445 Unclassified 1791
57 Ga0070678_100038280 3300005456 Bacteria 3375
58 Ga0070678_100521630 3300005456 Bacteria 1051
59 Ga0070681_10010967 3300005458 Bacteria 8962
60 Ga0070681_10018825 3300005458 Bacteria 6910
61 Ga0070681_10028771 3300005458 Bacteria 5585
62 Ga0070681_10037600 3300005458 Bacteria 4856
63 Ga0070681_10060107 3300005458 Bacteria 3779
64 Ga0070681_10101344 3300005458 Bacteria 2825
65 Ga0070681_10131971 3300005458 Unclassified 2430
66 Ga0070681_10147321 3300005458 Bacteria 2282
67 Ga0070681_10532531 3300005458 Bacteria 1088
68 Ga0070706_100006964 3300005467 Bacteria 10665
69 Ga0070707_100178906 3300005468 Bacteria 2067
70 Ga0070698_100210834 3300005471 Unclassified 1877
71 Ga0070699_100127145 3300005518 Bacteria 2245
72 Ga0070679_100003307 3300005530 Bacteria 14761
73 Ga0070679_100008859 3300005530 Bacteria 9497
74 Ga0070679_100010655 3300005530 Bacteria 8724
75 Ga0070679_100013719 3300005530 Bacteria 7761
76 Ga0070679_100017125 3300005530 Bacteria 7007
77 Ga0070679_100032942 3300005530 Bacteria 5129
78 Ga0070679_100050142 3300005530 Bacteria 4158
79 Ga0070679_100236593 3300005530 Bacteria 1785
80 Ga0070679_100537050 3300005530 Bacteria 1113
81 Ga0070684_100000363 3300005535 Bacteria 31171
82 Ga0070684_100055061 3300005535 Unclassified 3466
83 Ga0070684_100088696 3300005535 Bacteria 2748
84 Ga0070684_100271226 3300005535 Bacteria 1553
85 Ga0070697_100053277 3300005536 Unclassified 3288
86 Ga0070697_100110099 3300005536 Bacteria 2294
87 Ga0068853_100037697 3300005539 Bacteria 4114
88 Ga0068853_100051552 3300005539 Bacteria 3542
89 Ga0070672_100057807 3300005543 Unclassified 3046
90 Ga0070672_100266637 3300005543 Bacteria 1445
91 Ga0070686_100148720 3300005544 Bacteria 1638
92 Ga0070695_100004202 3300005545 Bacteria 8426
93 Ga0070695_100309048 3300005545 Bacteria 1171
94 Ga0070696_100000897 3300005546 Bacteria 19309
95 Ga0070696_100067042 3300005546 Bacteria 2518
96 Ga0070696_100095987 3300005546 Bacteria 2118
97 Ga0070693_100010780 3300005547 Bacteria 4586
98 Ga0070693_100070119 3300005547 Bacteria 2062
99 Ga0070704_100142853 3300005549 Unclassified 1871
100 Ga0068855_100011515 3300005563 Bacteria 10689
101 Ga0068855_100019531 3300005563 Bacteria 8141
102 Ga0068855_100095821 3300005563 Bacteria 3420
103 Ga0070664_100001705 3300005564 Bacteria 17596
104 Ga0070664_100052144 3300005564 Bacteria 3464
105 Ga0070664_100162149 3300005564 Bacteria 1979
106 Ga0068857_100046077 3300005577 Bacteria 3869
107 Ga0068856_100011344 3300005614 Bacteria 8644
108 Ga0068856_100014566 3300005614 Bacteria 7598
109 Ga0068856_100088452 3300005614 Unclassified 3080
110 Ga0068856_100187393 3300005614 Bacteria 2083
111 Ga0068856_100384835 3300005614 Unclassified 1422
112 Ga0070702_100100178 3300005615 Bacteria 1775
113 Ga0068852_100073070 3300005616 Bacteria 3016
114 Ga0068852_100083784 3300005616 Bacteria 2836
115 Ga0068859_100005557 3300005617 Bacteria 12839
116 Ga0068859_100065659 3300005617 Bacteria 3662
117 Ga0068863_100021862 3300005841 Bacteria 6104
118 Ga0068858_100017344 3300005842 Bacteria 6753
119 Ga0081539_10000261 3300005985 Bacteria 121256
120 Ga0070717_10053971 3300006028 Unclassified 3313
121 Ga0070716_100049177 3300006173 Bacteria 2388
122 Ga0070716_100335946 3300006173 Unclassified 1064
123 Ga0070712_100099742 3300006175 Unclassified 2144
124 Ga0068871_100064264 3300006358 Bacteria 3004
125 Ga0068871_100457760 3300006358 Bacteria 1144
126 Ga0075428_100250545 3300006844 Bacteria 1909
127 Ga0075433_10173226 3300006852 Unclassified 1920
128 Ga0075434_100013171 3300006871 Bacteria 7857
129 Ga0075434_100126725 3300006871 Bacteria 2570
130 Ga0075429_100056808 3300006880 Bacteria 3407
131 Ga0075436_100055749 3300006914 Bacteria 2730
132 Ga0097620_100005557 3300006931 Bacteria 12839
133 Ga0097620_100065656 3300006931 Bacteria 3662
134 Ga0075435_100573284 3300007076 Bacteria 978
135 Ga0111539_10060282 3300009094 Bacteria 4497
136 Ga0105245_10002818 3300009098 Bacteria 15629
137 Ga0105245_10181458 3300009098 Bacteria 2011
138 Ga0114129_10126794 3300009147 Bacteria 3509
139 Ga0105243_10062693 3300009148 Bacteria 2977
140 Ga0105242_10429388 3300009176 Bacteria 1240
141 Ga0105248_10004343 3300009177 Bacteria 15679
142 Ga0105248_10189231 3300009177 Bacteria 2319
143 Ga0105238_10365944 3300009551 Bacteria 1432
144 Ga0105246_10006705 3300011119 Bacteria 7039
145 Ga0157373_10055901 3300013100 Bacteria 2803
146 Ga0157371_10013643 3300013102 Bacteria 6166
147 Ga0157369_10009426 3300013105 Bacteria 11159
148 Ga0157369_10217522 3300013105 Bacteria 2001
149 Ga0157369_10496396 3300013105 Bacteria 1263
150 Ga0157378_10031317 3300013297 Bacteria 4699
151 Ga0157378_10035521 3300013297 Bacteria 4409
152 Ga0157378_10040812 3300013297 Bacteria 4116
153 Ga0157378_10297408 3300013297 Bacteria 1561
154 Ga0157372_10000900 3300013307 Bacteria 32279
155 Ga0157372_10001125 3300013307 Bacteria 29067
156 Ga0157372_10004513 3300013307 Bacteria 14851
157 Ga0157372_10005135 3300013307 Bacteria 13915
158 Ga0157372_10021412 3300013307 Bacteria 6985
159 Ga0157372_10026258 3300013307 Bacteria 6337
160 Ga0157372_10031998 3300013307 Bacteria 5763
161 Ga0157372_10037629 3300013307 Bacteria 5339
162 Ga0157372_10059286 3300013307 Bacteria 4281
163 Ga0157372_10271876 3300013307 Bacteria 1969
164 Ga0157375_10008875 3300013308 Bacteria 8799
165 Ga0157375_10027106 3300013308 Bacteria 5351
166 Ga0157375_10172869 3300013308 Bacteria 2309
167 Ga0157377_10004941 3300014745 Bacteria 6212
168 Ga0157377_10089491 3300014745 Bacteria 1815
169 Ga0207653_10062910 3300025885 Unclassified 1255
170 Ga0207692_10095077 3300025898 Bacteria 1624
171 Ga0207645_10098104 3300025907 Bacteria 1889
172 Ga0207705_10006989 3300025909 Bacteria 8331
173 Ga0207705_10012222 3300025909 Bacteria 6205
174 Ga0207705_10016169 3300025909 Bacteria 5353
175 Ga0207684_10094290 3300025910 Bacteria 2553
176 Ga0207684_10151463 3300025910 Bacteria 1996
177 Ga0207654_10000695 3300025911 Bacteria 18750
178 Ga0207654_10041539 3300025911 Unclassified 2597
179 Ga0207654_10079920 3300025911 Bacteria 1965
180 Ga0207707_10004712 3300025912 Bacteria 11965
181 Ga0207707_10005116 3300025912 Bacteria 11496
182 Ga0207707_10013058 3300025912 Bacteria 7234
183 Ga0207707_10021332 3300025912 Bacteria 5662
184 Ga0207707_10023211 3300025912 Bacteria 5428
185 Ga0207707_10046200 3300025912 Bacteria 3792
186 Ga0207707_10512371 3300025912 Bacteria 1022
187 Ga0207695_10186252 3300025913 Bacteria 1995
188 Ga0207671_10500924 3300025914 Bacteria 968
189 Ga0207693_10054657 3300025915 Bacteria 3132
190 Ga0207693_10112043 3300025915 Unclassified 2140
191 Ga0207693_10473684 3300025915 Bacteria 978
192 Ga0207663_10079447 3300025916 Bacteria 2142
193 Ga0207660_10000273 3300025917 Bacteria 33994
194 Ga0207660_10069645 3300025917 Bacteria 2555
195 Ga0207660_10102861 3300025917 Bacteria 2136
196 Ga0207660_10218122 3300025917 Unclassified 1496
197 Ga0207657_10016769 3300025919 Bacteria 7052
198 Ga0207652_10005512 3300025921 Bacteria 10259
199 Ga0207652_10006608 3300025921 Bacteria 9345
200 Ga0207652_10015026 3300025921 Bacteria 6280
201 Ga0207652_10015042 3300025921 Bacteria 6277
202 Ga0207652_10050149 3300025921 Bacteria 3575
203 Ga0207652_10050280 3300025921 Bacteria 3571
204 Ga0207652_10211405 3300025921 Unclassified 1747
205 Ga0207646_10025633 3300025922 Bacteria 5392
206 Ga0207650_10051989 3300025925 Bacteria 3033
207 Ga0207659_10025789 3300025926 Bacteria 3956
208 Ga0207659_10165431 3300025926 Bacteria 1741
209 Ga0207687_10032880 3300025927 Unclassified 3515
210 Ga0207687_10037944 3300025927 Bacteria 3290
211 Ga0207700_10037731 3300025928 Bacteria 3502
212 Ga0207700_10148982 3300025928 Bacteria 1932
213 Ga0207644_10172209 3300025931 Bacteria 1691
214 Ga0207690_10060482 3300025932 Bacteria 2571
215 Ga0207706_10003904 3300025933 Bacteria 14147
216 Ga0207686_10041460 3300025934 Bacteria 2807
217 Ga0207670_10019431 3300025936 Bacteria 4151
218 Ga0207691_10057465 3300025940 Bacteria 3541
219 Ga0207711_10397989 3300025941 Bacteria 1279
220 Ga0207661_10001462 3300025944 Bacteria 15978
221 Ga0207661_10008297 3300025944 Bacteria 7422
222 Ga0207661_10010225 3300025944 Bacteria 6747
223 Ga0207661_10023912 3300025944 Bacteria 4623
224 Ga0207661_10072799 3300025944 Bacteria 2812
225 Ga0207661_10075809 3300025944 Bacteria 2761
226 Ga0207661_10227287 3300025944 Archaea 1651
227 Ga0207679_10031556 3300025945 Bacteria 3709
228 Ga0207679_10126885 3300025945 Bacteria 2040
229 Ga0207667_10016482 3300025949 Bacteria 8348
230 Ga0207667_10158417 3300025949 Bacteria 2329
231 Ga0207712_10449313 3300025961 Bacteria 1093
232 Ga0207658_10244233 3300025986 Bacteria 1523
233 Ga0207658_10280679 3300025986 Bacteria 1428
234 Ga0207703_10095534 3300026035 Bacteria 2507
235 Ga0207702_10012955 3300026078 Bacteria 6937
236 Ga0207702_10049289 3300026078 Bacteria 3554
237 Ga0207702_10055579 3300026078 Bacteria 3357
238 Ga0207702_10312671 3300026078 Bacteria 1494
239 Ga0207702_10341744 3300026078 Unclassified 1430
240 Ga0207674_10000384 3300026116 Bacteria 57541
241 Ga0207674_10032716 3300026116 Bacteria 5452
242 Ga0207683_10160653 3300026121 Bacteria 2031
243 Ga0207683_10519776 3300026121 Bacteria 1100
244 Ga0207698_10022960 3300026142 Bacteria 4351
245 Ga0207698_10247112 3300026142 Bacteria 1630
246 Ga0209966_1003536 3300027695 Bacteria 2631
247 Ga0209998_10000494 3300027717 Bacteria 10852
248 Ga0207428_10062844 3300027907 Bacteria 2934
249 Ga0268265_10077049 3300028380 Bacteria 2618
250 Ga0268264_10015501 3300028381 Bacteria 6248
251 Ga0265334_10030860 3300028573 Unclassified 2144
252 Ga0307408_100035399 3300031548 Bacteria 3504
253 Ga0307405_10030156 3300031731 Bacteria 3178
254 Ga0307413_10187760 3300031824 Unclassified 1481
255 Ga0307410_10066472 3300031852 Bacteria 2484
256 Ga0307407_10262864 3300031903 Unclassified 1188
257 Ga0307412_10175654 3300031911 Bacteria 1605
258 Ga0307409_100005408 3300031995 Bacteria 7343
259 Ga0307409_100262150 3300031995 Unclassified 1587
260 Ga0307416_100002390 3300032002 Bacteria 10754
261 Ga0307416_100044116 3300032002 Unclassified 3498
262 Ga0307411_10045913 3300032005 Bacteria 2813
263 Ga0373923_0095623 3300035111 Unclassified 1304
264 Ga0373953_0007161 3300035117 Unclassified 3721
265 Ga0373954_0007338 3300035118 Bacteria 4823
266 Ga0373956_0000183 3300035119 Bacteria 23812
267 Ga0373956_0029547 3300035119 Bacteria 2391
268 Ga0373960_0003121 3300035121 Bacteria 3741
269 Ga0373943_0004815 3300035170 Bacteria 6097
270 Ga0373943_0028163 3300035170 Bacteria 2646
271 Ga0373946_0004828 3300035171 Bacteria 4852
272 Ga0373955_0002073 3300035172 Bacteria 8644
273 Ga0373955_0006624 3300035172 Bacteria 5284
274 Ga0373935_0004136 3300035692 Bacteria 8491
275 Ga0373935_0145561 3300035692 Bacteria 1604
276 Ga0373927_0015628 3300035695 Bacteria 5013
277 Ga0373933_0000131 3300035724 Bacteria 47471
278 Ga0373947_0004258 3300035725 Bacteria 8397
279 Ga0373937_0000512 3300036401 Bacteria 35027
280 Ga0373937_0003798 3300036401 Bacteria 12761
281 Ga0373925_0002642 3300037068 Bacteria 14220
282 Ga0395900_0115936 3300037418 Bacteria 2749
283 Ga0395905_0006343 3300037471 Bacteria 11917
284 Ga0436365_0952982 3300039437 Bacteria 2042
285 Ga0439453_0023358 3300041408 Bacteria 1128
286 Ga0466963_0156447 3300044694 Unclassified 1585
287 Ga0466963_0204376 3300044694 Bacteria 1381
288 Ga0451576_0042391 3300045051 Bacteria 4805
289 Ga0466958_0071636 3300045836 Bacteria 2122
290 Ga0466967_0128109 3300045976 Bacteria 2353
291 Ga0466967_0485844 3300045976 Bacteria 1210
292 Ga0495592_0011776 3300046454 Bacteria 6626
293 Ga0495603_0011823 3300046455 Bacteria 5283
294 Ga0495629_0072242 3300046459 Bacteria 2408
295 Ga0495651_0000098 3300046462 Bacteria 63881
296 Ga0495653_0000168 3300046463 Bacteria 54127
297 Ga0495580_0010779 3300046472 Bacteria 7099
298 Ga0495582_0015748 3300046473 Bacteria 4147
299 Ga0495582_0051700 3300046473 Bacteria 2265
300 Ga0495639_0000789 3300046475 Bacteria 14448
301 Ga0495639_0069893 3300046475 Bacteria 1620
302 Ga0495664_0011168 3300046477 Bacteria 5056
303 Ga0495664_0169690 3300046477 Bacteria 1324
304 Ga0495594_0002580 3300046499 Bacteria 9422
305 Ga0495608_0000614 3300046511 Bacteria 24586
306 Ga0495618_0068578 3300046514 Bacteria 2255
307 Ga0495628_0000991 3300046516 Bacteria 25951
308 Ga0495630_0000544 3300046517 Bacteria 27577
309 Ga0495630_0012981 3300046517 Bacteria 6052
310 Ga0495643_0039608 3300046522 Bacteria 2577
311 Ga0495652_0000694 3300046529 Bacteria 39080
312 Ga0495665_0001769 3300046531 Bacteria 11640
313 Ga0495665_0124617 3300046531 Bacteria 1349
314 Ga0495586_0085212 3300046535 Bacteria 1741
315 Ga0495587_0001449 3300046536 Bacteria 15814
316 Ga0495645_0000106 3300046543 Bacteria 57528
317 Ga0495645_0000388 3300046543 Bacteria 30469
318 Ga0495667_0002671 3300046559 Bacteria 11916
319 Ga0495667_0024998 3300046559 Bacteria 4025
320 Ga0495635_0000223 3300046663 Bacteria 35975
321 Ga0495588_0070569 3300046674 Bacteria 1816
322 Ga0495657_0001006 3300046675 Bacteria 24822
323 Ga0495599_0000150 3300046678 Bacteria 45637
324 Ga0495599_0010651 3300046678 Bacteria 5627
325 Ga0495623_0000531 3300046679 Bacteria 25253
326 Ga0495623_0001541 3300046679 Bacteria 15557
327 Ga0495646_0001461 3300046680 Bacteria 14048
328 Ga0495658_0002931 3300046683 Bacteria 8560
329 Ga0495658_0011397 3300046683 Bacteria 4471
330 Ga0495613_0188747 3300046689 Bacteria 1457
331 Ga0495600_0000156 3300046809 Bacteria 39196
332 Ga0495600_0015433 3300046809 Bacteria 4828
333 Ga0495581_0007959 3300047315 Bacteria 6140
334 Ga0495581_0110982 3300047315 Bacteria 1595
335 Ga0495604_0000519 3300047317 Bacteria 33907
336 Ga0495604_0082012 3300047317 Bacteria 2413
337 Ga0495674_0001810 3300047319 Bacteria 21069
338 Ga0495672_0007359 3300047320 Bacteria 8292
339 Ga0495680_0003653 3300047322 Bacteria 15030
340 Ga0495675_0016583 3300047444 Bacteria 4660
341 Ga0495684_0000216 3300047471 Bacteria 44631
342 Ga0495684_0040260 3300047471 Bacteria 3583
343 Ga0495593_0002299 3300047673 Bacteria 11458
344 Ga0495614_0002616 3300048089 Bacteria 8001
345 Ga0496112_0009997 3300048915 Bacteria 8585
346 Ga0496112_0054120 3300048915 Bacteria 3942
347 Ga0496112_0135067 3300048915 Bacteria 2437
348 Ga0501031_0129916 3300049568 Bacteria 1646
349 Ga0501032_0187452 3300049569 Bacteria 1353
350 Ga0501033_0040471 3300049570 Bacteria 3479
351 Ga0501034_0031467 3300049571 Bacteria 5389
352 Ga0501034_0144070 3300049571 Bacteria 2361
353 Ga0501036_0064667 3300049572 Bacteria 3096
354 Ga0501037_0190385 3300049573 Archaea 1453
355 Ga0501039_0463472 3300049575 Archaea 995
356 Ga0501043_0060015 3300049579 Bacteria 2985
357 Ga0501046_0136705 3300049580 Bacteria 1856
358 Ga0501047_0012971 3300049581 Bacteria 7891
359 Ga0501047_0018868 3300049581 Bacteria 6615
360 Ga0501070_0016096 3300049586 Bacteria 6286
361 Ga0501070_0017732 3300049586 Bacteria 5978
362 Ga0501073_0060530 3300049589 Bacteria 2642
363 Ga0501230_005877 3300049667 Bacteria 1757
364 Ga0501233_003770 3300049668 Unclassified 2743
365 Ga0501235_000735 3300049669 Bacteria 6686
366 Ga0501240_003925 3300049673 Bacteria 1693
367 Ga0501250_001929 3300049680 Bacteria 1804
368 Ga0501225_0003142 3300049705 Bacteria 5045
369 Ga0501234_002700 3300049707 Unclassified 2790
370 Ga0501080_0209194 3300049742 Bacteria 1788
371 Ga0501266_003130 3300049763 Unclassified 2059
372 Ga0501268_000200 3300049765 Bacteria 5753
373 Ga0501273_006589 3300049770 Bacteria 1347
374 Ga0501035_0025861 3300049822 Bacteria 5379
375 Ga0501035_0150331 3300049822 Bacteria 2021
376 Ga0501044_0037364 3300049823 Bacteria 5076
377 Ga0501044_0073387 3300049823 Bacteria 3478
378 Ga0501044_0288839 3300049823 Bacteria 1572
379 nmdc:mga05p37_53520_c1 3300050507 Bacteria 4963
380 nmdc:mga08y16_32290_c1 3300050511 Bacteria 5505
381 nmdc:mga0n895_112056_c1 3300050512 Bacteria 2745
382 nmdc:mga0n895_30932_c1 3300050512 Bacteria 5121
383 nmdc:mga0n895_592012_c1 3300050512 Bacteria 1112
384 nmdc:mga0rr50_163870_c1 3300050513 Bacteria 1806
385 nmdc:mga0rr50_357069_c1 3300050513 Bacteria 1230
386 nmdc:mga0a205_39302_c2 3300050515 Bacteria 2936
387 Ga0495601_0010925 3300053077 Bacteria 5419
388 Ga0495612_0000485 3300053078 Bacteria 15861
389 Ga0495595_0001098 3300053084 Bacteria 10483
390 Ga0495595_0056795 3300053084 Bacteria 1825
391 Ga0495619_0001053 3300053085 Bacteria 18088
392 Ga0495619_0138282 3300053085 Bacteria 1676
393 Ga0500583_0022866 3300053092 Bacteria 2627
394 Ga0105245_10011572
395 MBSR1b_contig_742276
396 MBSR1b_contig_8562938
397 Ga0058863_11542014
398 Ga0065715_10095297
399 Ga0065707_10268092
400 Ga0070658_10010761
401 Ga0070658_10014420
402 Ga0070658_10025653
403 Ga0070658_10064540
404 Ga0070683_100001703
405 Ga0070683_100006264
406 Ga0070683_100063355
407 Ga0070683_100065813
408 Ga0070683_100098151
409 Ga0070670_100002124
410 Ga0068869_100011969
411 Ga0070680_100010008
412 Ga0070680_100010080
413 Ga0070680_100013803
414 Ga0070680_100145319
415 Ga0070680_100218253
416 Ga0070682_100001135
417 Ga0070682_100001146
418 Ga0070682_100012652
419 Ga0070682_100014752
420 Ga0068868_100131134
421 Ga0070660_100010374
422 Ga0070660_100174203
423 Ga0070689_100010567
424 Ga0070689_100127788
425 Ga0070661_100004560
426 Ga0070661_100006124
427 Ga0070692_10018132
428 Ga0070692_10118763
429 Ga0070668_100409645
430 Ga0070669_100113007
431 Ga0070675_100018454
432 Ga0070671_100129742
433 Ga0070674_100166024
434 Ga0070673_100024059
435 Ga0070659_100003132
436 Ga0070659_100021136
437 Ga0070667_100208480
438 Ga0070667_100329609
439 Ga0070703_10055906
440 Ga0070709_10012131
441 Ga0070709_10359344
442 Ga0070714_100030295
443 Ga0070714_100034034
444 Ga0070713_100002685
445 Ga0070713_100655624
446 Ga0070710_10035865
447 Ga0070694_100068441
448 Ga0070708_100002854
449 Ga0070708_100217390
450 Ga0070678_100038280
451 Ga0070678_100521630
452 Ga0070681_10010967
453 Ga0070681_10018825
454 Ga0070681_10028771
455 Ga0070681_10037600
456 Ga0070681_10060107
457 Ga0070681_10101344
458 Ga0070681_10131971
459 Ga0070681_10147321
460 Ga0070681_10532531
461 Ga0070706_100006964
462 Ga0070707_100178906
463 Ga0070698_100210834
464 Ga0070699_100127145
465 Ga0070679_100003307
466 Ga0070679_100008859
467 Ga0070679_100010655
468 Ga0070679_100013719
469 Ga0070679_100017125
470 Ga0070679_100032942
471 Ga0070679_100050142
472 Ga0070679_100236593
473 Ga0070679_100537050
474 Ga0070684_100000363
475 Ga0070684_100055061
476 Ga0070684_100088696
477 Ga0070684_100271226
478 Ga0070697_100053277
479 Ga0070697_100110099
480 Ga0068853_100037697
481 Ga0068853_100051552
482 Ga0070672_100057807
483 Ga0070672_100266637
484 Ga0070686_100148720
485 Ga0070695_100004202
486 Ga0070695_100309048
487 Ga0070696_100000897
488 Ga0070696_100067042
489 Ga0070696_100095987
490 Ga0070693_100010780
491 Ga0070693_100070119
492 Ga0070704_100142853
493 Ga0068855_100011515
494 Ga0068855_100019531
495 Ga0068855_100095821
496 Ga0070664_100001705
497 Ga0070664_100052144
498 Ga0070664_100162149
499 Ga0068857_100046077
500 Ga0068856_100011344
501 Ga0068856_100014566
502 Ga0068856_100088452
503 Ga0068856_100187393
504 Ga0068856_100384835
505 Ga0070702_100100178
506 Ga0068852_100073070
507 Ga0068852_100083784
508 Ga0068859_100005557
509 Ga0068859_100065659
510 Ga0068863_100021862
511 Ga0068858_100017344
512 Ga0081539_10000261
513 Ga0070717_10053971
514 Ga0070716_100049177
515 Ga0070716_100335946
516 Ga0070712_100099742
517 Ga0068871_100064264
518 Ga0068871_100457760
519 Ga0075428_100250545
520 Ga0075433_10173226
521 Ga0075434_100013171
522 Ga0075434_100126725
523 Ga0075429_100056808
524 Ga0075436_100055749
525 Ga0097620_100005557
526 Ga0097620_100065656
527 Ga0075435_100573284
528 Ga0111539_10060282
529 Ga0105245_10002818
530 Ga0105245_10181458
531 Ga0114129_10126794
532 Ga0105243_10062693
533 Ga0105242_10429388
534 Ga0105248_10004343
535 Ga0105248_10189231
536 Ga0105238_10365944
537 Ga0105246_10006705
538 Ga0157373_10055901
539 Ga0157371_10013643
540 Ga0157369_10009426
541 Ga0157369_10217522
542 Ga0157369_10496396
543 Ga0157378_10031317
544 Ga0157378_10035521
545 Ga0157378_10040812
546 Ga0157378_10297408
547 Ga0157372_10000900
548 Ga0157372_10001125
549 Ga0157372_10004513
550 Ga0157372_10005135
551 Ga0157372_10021412
552 Ga0157372_10026258
553 Ga0157372_10031998
554 Ga0157372_10037629
555 Ga0157372_10059286
556 Ga0157372_10271876
557 Ga0157375_10008875
558 Ga0157375_10027106
559 Ga0157375_10172869
560 Ga0157377_10004941
561 Ga0157377_10089491
562 Ga0207653_10062910
563 Ga0207692_10095077
564 Ga0207645_10098104
565 Ga0207705_10006989
566 Ga0207705_10012222
567 Ga0207705_10016169
568 Ga0207684_10094290
569 Ga0207684_10151463
570 Ga0207654_10000695
571 Ga0207654_10041539
572 Ga0207654_10079920
573 Ga0207707_10004712
574 Ga0207707_10005116
575 Ga0207707_10013058
576 Ga0207707_10021332
577 Ga0207707_10023211
578 Ga0207707_10046200
579 Ga0207707_10512371
580 Ga0207695_10186252
581 Ga0207671_10500924
582 Ga0207693_10054657
583 Ga0207693_10112043
584 Ga0207693_10473684
585 Ga0207663_10079447
586 Ga0207660_10000273
587 Ga0207660_10069645
588 Ga0207660_10102861
589 Ga0207660_10218122
590 Ga0207657_10016769
591 Ga0207652_10005512
592 Ga0207652_10006608
593 Ga0207652_10015026
594 Ga0207652_10015042
595 Ga0207652_10050149
596 Ga0207652_10050280
597 Ga0207652_10211405
598 Ga0207646_10025633
599 Ga0207650_10051989
600 Ga0207659_10025789
601 Ga0207659_10165431
602 Ga0207687_10032880
603 Ga0207687_10037944
604 Ga0207700_10037731
605 Ga0207700_10148982
606 Ga0207644_10172209
607 Ga0207690_10060482
608 Ga0207706_10003904
609 Ga0207686_10041460
610 Ga0207670_10019431
611 Ga0207691_10057465
612 Ga0207711_10397989
613 Ga0207661_10001462
614 Ga0207661_10008297
615 Ga0207661_10010225
616 Ga0207661_10023912
617 Ga0207661_10072799
618 Ga0207661_10075809
619 Ga0207661_10227287
620 Ga0207679_10031556
621 Ga0207679_10126885
622 Ga0207667_10016482
623 Ga0207667_10158417
624 Ga0207712_10449313
625 Ga0207658_10244233
626 Ga0207658_10280679
627 Ga0207703_10095534
628 Ga0207702_10012955
629 Ga0207702_10049289
630 Ga0207702_10055579
631 Ga0207702_10312671
632 Ga0207702_10341744
633 Ga0207674_10000384
634 Ga0207674_10032716
635 Ga0207683_10160653
636 Ga0207683_10519776
637 Ga0207698_10022960
638 Ga0207698_10247112
639 Ga0209966_1003536
640 Ga0209998_10000494
641 Ga0207428_10062844
642 Ga0268265_10077049
643 Ga0268264_10015501
644 Ga0265334_10030860
645 Ga0307408_100035399
646 Ga0307405_10030156
647 Ga0307413_10187760
648 Ga0307410_10066472
649 Ga0307407_10262864
650 Ga0307412_10175654
651 Ga0307409_100005408
652 Ga0307409_100262150
653 Ga0307416_100002390
654 Ga0307416_100044116
655 Ga0307411_10045913
656 Ga0373923_0095623
657 Ga0373953_0007161
658 Ga0373954_0007338
659 Ga0373956_0000183
660 Ga0373956_0029547
661 Ga0373960_0003121
662 Ga0373943_0004815
663 Ga0373943_0028163
664 Ga0373946_0004828
665 Ga0373955_0002073
666 Ga0373955_0006624
667 Ga0373935_0004136
668 Ga0373935_0145561
669 Ga0373927_0015628
670 Ga0373933_0000131
671 Ga0373947_0004258
672 Ga0373937_0000512
673 Ga0373937_0003798
674 Ga0373925_0002642
675 Ga0395900_0115936
676 Ga0395905_0006343
677 Ga0436365_0952982
678 Ga0439453_0023358
679 Ga0466963_0156447
680 Ga0466963_0204376
681 Ga0451576_0042391
682 Ga0466958_0071636
683 Ga0466967_0128109
684 Ga0466967_0485844
685 Ga0495592_0011776
686 Ga0495603_0011823
687 Ga0495629_0072242
688 Ga0495651_0000098
689 Ga0495653_0000168
690 Ga0495580_0010779
691 Ga0495582_0015748
692 Ga0495582_0051700
693 Ga0495639_0000789
694 Ga0495639_0069893
695 Ga0495664_0011168
696 Ga0495664_0169690
697 Ga0495594_0002580
698 Ga0495608_0000614
699 Ga0495618_0068578
700 Ga0495628_0000991
701 Ga0495630_0000544
702 Ga0495630_0012981
703 Ga0495643_0039608
704 Ga0495652_0000694
705 Ga0495665_0001769
706 Ga0495665_0124617
707 Ga0495586_0085212
708 Ga0495587_0001449
709 Ga0495645_0000106
710 Ga0495645_0000388
711 Ga0495667_0002671
712 Ga0495667_0024998
713 Ga0495635_0000223
714 Ga0495588_0070569
715 Ga0495657_0001006
716 Ga0495599_0000150
717 Ga0495599_0010651
718 Ga0495623_0000531
719 Ga0495623_0001541
720 Ga0495646_0001461
721 Ga0495658_0002931
722 Ga0495658_0011397
723 Ga0495613_0188747
724 Ga0495600_0000156
725 Ga0495600_0015433
726 Ga0495581_0007959
727 Ga0495581_0110982
728 Ga0495604_0000519
729 Ga0495604_0082012
730 Ga0495674_0001810
731 Ga0495672_0007359
732 Ga0495680_0003653
733 Ga0495675_0016583
734 Ga0495684_0000216
735 Ga0495684_0040260
736 Ga0495593_0002299
737 Ga0495614_0002616
738 Ga0496112_0009997
739 Ga0496112_0054120
740 Ga0496112_0135067
741 Ga0501031_0129916
742 Ga0501032_0187452
743 Ga0501033_0040471
744 Ga0501034_0031467
745 Ga0501034_0144070
746 Ga0501036_0064667
747 Ga0501037_0190385
748 Ga0501039_0463472
749 Ga0501043_0060015
750 Ga0501046_0136705
751 Ga0501047_0012971
752 Ga0501047_0018868
753 Ga0501070_0016096
754 Ga0501070_0017732
755 Ga0501073_0060530
756 Ga0501230_005877
757 Ga0501233_003770
758 Ga0501235_000735
759 Ga0501240_003925
760 Ga0501250_001929
761 Ga0501225_0003142
762 Ga0501234_002700
763 Ga0501080_0209194
764 Ga0501266_003130
765 Ga0501268_000200
766 Ga0501273_006589
767 Ga0501035_0025861
768 Ga0501035_0150331
769 Ga0501044_0037364
770 Ga0501044_0073387
771 Ga0501044_0288839
772 nmdc:mga05p37_53520_c1
773 nmdc:mga08y16_32290_c1
774 nmdc:mga0n895_112056_c1
775 nmdc:mga0n895_30932_c1
776 nmdc:mga0n895_592012_c1
777 nmdc:mga0rr50_163870_c1
778 nmdc:mga0rr50_357069_c1
779 nmdc:mga0a205_39302_c2
780 Ga0495601_0010925
781 Ga0495612_0000485
782 Ga0495595_0001098
783 Ga0495595_0056795
784 Ga0495619_0001053
785 Ga0495619_0138282
786 Ga0500583_0022866

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00701

DHDPS

Dihydrodipicolinate synthetase family

1

287

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mqh-assembly1.cif.gz_A crystal structure of 4-hydroxy-tetrahydrodipicolinate synthase (htpa synthase) from burkholderia mallei 0.9871 5 295
6p90-assembly1.cif.gz_B crystal structure of padhdps2-h56q mutant 0.9871 6 295
3noe-assembly1.cif.gz_A crystal structure of dihydrodipicolinate synthase from pseudomonas aeruginosa 0.9858 7 296
3flu-assembly1.cif.gz_B crystal structure of dihydrodipicolinate synthase from the pathogen neisseria meningitidis 0.9851 6 295
3qze-assembly2.cif.gz_D crystal structure of dapa (pa1010) at 1.6 a resolution 0.985 6 295
ID Description Score Start End Superfamily
3pb2D00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9796 7 295 3.20.20.70
6nvaA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.975 6 295 3.20.20.70
2rfgB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9745 7 292 3.20.20.70
3a5fA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9714 7 295 3.20.20.70
2yxgD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9692 6 295 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2P5KB96-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) 0.987 4 296 GO:0005829
GO:0008840
GO:0009089
GO:0019877
AF-A0A2T0PB33-F1-model_v4 deleted 0.9868 6 295
AF-A0A4R0PRU8-F1-model_v4 deleted 0.9867 7 296
AF-A0A4Q9R1A5-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (HTPA synthase) (EC 4.3.3.7) 0.9866 7 295 GO:0005829
GO:0008840
GO:0009089
GO:0019877
AF-A0A1K2DBG4-F1-model_v4 deleted 0.9864 6 295

Map