F432554

General Info

Members Datasets Scaffolds Average Seq Length
393 175 393 241

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10120167|Ga0070717_101201671
Length 266
Sequence MLATSQTLTHHVFVHGKDSIKERAVVEPAPTAVLDPCEDDEQPNHSAYSYPQVDWTGLVRRIHLGEDAGMEELYKLFARGIRFYLCRQLGPQELDDKVHDTFLIVVQAIRRGELREPDRLMGFVRTVVRRQVAAHIDQVVHSRREELNMDVGVRIADRRRNPEQSAVFHEKVQLMTEVLSRLSERDREILTRFYLHEEAQEQICEEMNLSETQFRLLKSRAKARFGEIGKRKLQQKSLPSFFMRTSGLGTHSSAKSRSWPTEGPSV

Samples

Sample ID Description Type Environment
1 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
77 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
118 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
120 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
121 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
122 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
123 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
140 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
141 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.73
Metatranscriptomes 1.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.02
Rhizosphere 89.82
Stem 0
Stem Tuber 0
Unclassified 9.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_10007773 3300004799 Unclassified 1132
2 Ga0058863_11013217 3300004799 Unclassified 1165
3 Ga0058861_11572783 3300004800 Unclassified 1126
4 Ga0058862_12654812 3300004803 Unclassified 1638
5 Ga0070658_10075731 3300005327 Bacteria 2760
6 Ga0070683_100001168 3300005329 Bacteria 19903
7 Ga0070683_100017347 3300005329 Bacteria 6364
8 Ga0070683_100021125 3300005329 Bacteria 5805
9 Ga0070683_100026827 3300005329 Bacteria 5191
10 Ga0070683_100042672 3300005329 Bacteria 4177
11 Ga0070683_100185185 3300005329 Unclassified 1976
12 Ga0070690_100085053 3300005330 Unclassified 2074
13 Ga0070690_100150528 3300005330 Unclassified 1587
14 Ga0070680_100069337 3300005336 Bacteria 2895
15 Ga0070680_100139748 3300005336 Bacteria 2030
16 Ga0070682_100208346 3300005337 Unclassified 1384
17 Ga0070682_100530762 3300005337 Unclassified 917
18 Ga0070660_100069206 3300005339 Bacteria 2752
19 Ga0070660_100341025 3300005339 Bacteria 1233
20 Ga0070689_100292229 3300005340 Bacteria 1354
21 Ga0070691_10002536 3300005341 Bacteria 8134
22 Ga0070661_100179947 3300005344 Unclassified 1608
23 Ga0070661_100245860 3300005344 Bacteria 1379
24 Ga0070692_10424885 3300005345 Unclassified 845
25 Ga0070671_100025392 3300005355 Bacteria 4862
26 Ga0070673_100057378 3300005364 Bacteria 3076
27 Ga0070688_100017288 3300005365 Unclassified 4137
28 Ga0070709_10043216 3300005434 Bacteria 2786
29 Ga0070709_10126986 3300005434 Unclassified 1736
30 Ga0070709_10151731 3300005434 Bacteria 1602
31 Ga0070714_100081708 3300005435 Unclassified 2814
32 Ga0070714_100225865 3300005435 Bacteria 1723
33 Ga0070714_100350044 3300005435 Unclassified 1387
34 Ga0070713_100023829 3300005436 Unclassified 4757
35 Ga0070713_100181999 3300005436 Unclassified 1889
36 Ga0070711_100013612 3300005439 Bacteria 5111
37 Ga0070711_100044666 3300005439 Unclassified 3008
38 Ga0070711_100083046 3300005439 Bacteria 2287
39 Ga0070700_100213072 3300005441 Bacteria 1364
40 Ga0070662_100020740 3300005457 Bacteria 4481
41 Ga0070681_10000705 3300005458 Bacteria 27766
42 Ga0070681_10057676 3300005458 Bacteria 3863
43 Ga0070681_10086481 3300005458 Bacteria 3088
44 Ga0070681_10162541 3300005458 Unclassified 2157
45 Ga0070681_10680922 3300005458 Unclassified 944
46 Ga0068867_100209739 3300005459 Unclassified 1564
47 Ga0070699_100052080 3300005518 Unclassified 3544
48 Ga0070679_100000252 3300005530 Bacteria 44954
49 Ga0070679_100020172 3300005530 Bacteria 6496
50 Ga0070679_100066080 3300005530 Bacteria 3605
51 Ga0070684_100001010 3300005535 Bacteria 20074
52 Ga0070684_100054173 3300005535 Bacteria 3494
53 Ga0070684_100071276 3300005535 Bacteria 3059
54 Ga0070684_100081332 3300005535 Bacteria 2866
55 Ga0070684_100314690 3300005535 Unclassified 1438
56 Ga0070684_100665246 3300005535 Bacteria 970
57 Ga0070697_100091005 3300005536 Unclassified 2522
58 Ga0068853_100069535 3300005539 Bacteria 3063
59 Ga0068853_100109989 3300005539 Bacteria 2447
60 Ga0070686_100270836 3300005544 Bacteria 1248
61 Ga0070695_100020759 3300005545 Unclassified 4013
62 Ga0070695_100057161 3300005545 Unclassified 2520
63 Ga0070695_100101575 3300005545 Bacteria 1938
64 Ga0070695_100923724 3300005545 Unclassified 706
65 Ga0070696_100003726 3300005546 Bacteria 10172
66 Ga0070693_100143577 3300005547 Unclassified 1505
67 Ga0070693_100185581 3300005547 Bacteria 1342
68 Ga0070665_100077044 3300005548 Bacteria 3341
69 Ga0070665_100109685 3300005548 Unclassified 2762
70 Ga0068855_100002712 3300005563 Bacteria 21829
71 Ga0068855_100003299 3300005563 Bacteria 19755
72 Ga0068855_100043148 3300005563 Bacteria 5344
73 Ga0068855_100104778 3300005563 Bacteria 3253
74 Ga0070664_100070417 3300005564 Bacteria 2995
75 Ga0068857_100000348 3300005577 Bacteria 31972
76 Ga0068857_100018299 3300005577 Bacteria 6146
77 Ga0068854_100246806 3300005578 Unclassified 1424
78 Ga0068856_100000439 3300005614 Bacteria 45829
79 Ga0068856_100002106 3300005614 Bacteria 20644
80 Ga0068856_100005460 3300005614 Bacteria 12523
81 Ga0068856_100027447 3300005614 Bacteria 5555
82 Ga0068856_100038926 3300005614 Bacteria 4668
83 Ga0068856_100367155 3300005614 Bacteria 1458
84 Ga0068856_100495202 3300005614 Bacteria 1243
85 Ga0068856_100637658 3300005614 Unclassified 1086
86 Ga0068852_100043596 3300005616 Bacteria 3806
87 Ga0068859_100331108 3300005617 Bacteria 1617
88 Ga0068864_100232706 3300005618 Bacteria 1705
89 Ga0068870_10119999 3300005840 Bacteria 1513
90 Ga0068863_100013776 3300005841 Bacteria 7792
91 Ga0068863_100385027 3300005841 Bacteria 1370
92 Ga0068858_100002142 3300005842 Bacteria 20008
93 Ga0068858_100103781 3300005842 Bacteria 2652
94 Ga0068858_100140582 3300005842 Bacteria 2266
95 Ga0068858_100223694 3300005842 Unclassified 1783
96 Ga0068858_100863817 3300005842 Unclassified 884
97 Ga0068860_100047103 3300005843 Bacteria 4109
98 Ga0068860_100130788 3300005843 Bacteria 2408
99 Ga0068860_100319813 3300005843 Unclassified 1523
100 Ga0081455_10015906 3300005937 Bacteria 7282
101 Ga0070717_10012251 3300006028 Bacteria 6539
102 Ga0070717_10120167 3300006028 Unclassified 2250
103 Ga0070717_10215991 3300006028 Bacteria 1684
104 Ga0070717_10457982 3300006028 Unclassified 1150
105 Ga0070716_100033760 3300006173 Unclassified 2801
106 Ga0070712_100501912 3300006175 Unclassified 1017
107 Ga0070712_100604825 3300006175 Unclassified 928
108 Ga0068871_100048173 3300006358 Bacteria 3439
109 Ga0068871_100049467 3300006358 Bacteria 3398
110 Ga0068871_100116752 3300006358 Unclassified 2250
111 Ga0068871_100269692 3300006358 Bacteria 1487
112 Ga0075434_101074041 3300006871 Unclassified 818
113 Ga0068865_100026748 3300006881 Unclassified 3805
114 Ga0068865_100067686 3300006881 Unclassified 2523
115 Ga0068865_100119183 3300006881 Bacteria 1959
116 Ga0075436_100027824 3300006914 Bacteria 3891
117 Ga0097620_100331128 3300006931 Bacteria 1617
118 Ga0105240_10000391 3300009093 Bacteria 81829
119 Ga0105240_10001905 3300009093 Bacteria 34637
120 Ga0105240_10064786 3300009093 Bacteria 4539
121 Ga0105240_10190817 3300009093 Bacteria 2410
122 Ga0105240_10567369 3300009093 Bacteria 1254
123 Ga0105245_10001163 3300009098 Bacteria 23815
124 Ga0105245_10057774 3300009098 Bacteria 3491
125 Ga0105245_10128248 3300009098 Bacteria 2377
126 Ga0105245_10160737 3300009098 Bacteria 2131
127 Ga0105245_10187819 3300009098 Bacteria 1978
128 Ga0105245_10234673 3300009098 Unclassified 1776
129 Ga0105245_11189369 3300009098 Bacteria 810
130 Ga0105243_10099044 3300009148 Unclassified 2416
131 Ga0105243_11016749 3300009148 Unclassified 832
132 Ga0105241_10012341 3300009174 Bacteria 6267
133 Ga0105241_10151055 3300009174 Bacteria 1900
134 Ga0105241_10266108 3300009174 Unclassified 1459
135 Ga0105241_10374240 3300009174 Unclassified 1243
136 Ga0105241_10830927 3300009174 Unclassified 853
137 Ga0105242_10033811 3300009176 Bacteria 4096
138 Ga0105242_10066636 3300009176 Bacteria 2975
139 Ga0105248_10004451 3300009177 Bacteria 15508
140 Ga0105248_10019484 3300009177 Bacteria 7508
141 Ga0105248_10021191 3300009177 Bacteria 7202
142 Ga0105248_10181479 3300009177 Bacteria 2372
143 Ga0105248_10195387 3300009177 Unclassified 2279
144 Ga0105248_10426604 3300009177 Bacteria 1493
145 Ga0105237_10001318 3300009545 Bacteria 32923
146 Ga0105237_10011293 3300009545 Bacteria 9448
147 Ga0105237_10042166 3300009545 Unclassified 4603
148 Ga0105237_10069783 3300009545 Bacteria 3509
149 Ga0105237_10303081 3300009545 Bacteria 1601
150 Ga0105237_10516351 3300009545 Bacteria 1201
151 Ga0105238_10008448 3300009551 Bacteria 10310
152 Ga0105238_10011255 3300009551 Bacteria 9003
153 Ga0105238_10123110 3300009551 Bacteria 2573
154 Ga0105249_10002395 3300009553 Bacteria 16286
155 Ga0105239_10016477 3300010375 Bacteria 8174
156 Ga0105239_10066104 3300010375 Bacteria 3973
157 Ga0105239_10305024 3300010375 Bacteria 1793
158 Ga0105239_10324431 3300010375 Bacteria 1737
159 Ga0105246_10002255 3300011119 Bacteria 11636
160 Ga0105246_10054799 3300011119 Bacteria 2749
161 Ga0105246_10107064 3300011119 Bacteria 2046
162 Ga0157370_10002529 3300013104 Bacteria 21985
163 Ga0157370_10272225 3300013104 Unclassified 1565
164 Ga0157370_10305290 3300013104 Unclassified 1469
165 Ga0157369_10001078 3300013105 Bacteria 34157
166 Ga0157369_10003559 3300013105 Bacteria 18509
167 Ga0157369_10029371 3300013105 Bacteria 6076
168 Ga0157369_10114148 3300013105 Bacteria 2869
169 Ga0157369_10296085 3300013105 Unclassified 1684
170 Ga0157369_10314554 3300013105 Unclassified 1628
171 Ga0157369_10404808 3300013105 Bacteria 1415
172 Ga0157374_10005880 3300013296 Bacteria 10363
173 Ga0157374_10081084 3300013296 Bacteria 3079
174 Ga0157374_10199316 3300013296 Unclassified 1960
175 Ga0157374_10749595 3300013296 Bacteria 991
176 Ga0157378_10054792 3300013297 Bacteria 3551
177 Ga0163162_11124797 3300013306 Bacteria 890
178 Ga0157372_10011299 3300013307 Bacteria 9500
179 Ga0157372_10024248 3300013307 Bacteria 6586
180 Ga0157372_10088274 3300013307 Bacteria 3520
181 Ga0157372_10095866 3300013307 Bacteria 3381
182 Ga0157372_10200029 3300013307 Bacteria 2314
183 Ga0157372_11053750 3300013307 Bacteria 941
184 Ga0157372_11063557 3300013307 Unclassified 936
185 Ga0157375_10098905 3300013308 Bacteria 2995
186 Ga0163163_10021786 3300014325 Bacteria 6053
187 Ga0163163_10023184 3300014325 Bacteria 5889
188 Ga0163163_10153699 3300014325 Bacteria 2344
189 Ga0163163_10390056 3300014325 Bacteria 1450
190 Ga0157376_10083180 3300014969 Bacteria 2752
191 Ga0157376_10287577 3300014969 Bacteria 1551
192 Ga0157376_10356775 3300014969 Unclassified 1401
193 Ga0157376_10478591 3300014969 Bacteria 1220
194 Ga0213873_10014226 3300021358 Bacteria 1760
195 Ga0213874_10003222 3300021377 Bacteria 3600
196 Ga0213876_10043014 3300021384 Bacteria 2387
197 Ga0213875_10000004 3300021388 Bacteria 703388
198 Ga0213875_10000349 3300021388 Bacteria 43467
199 Ga0213875_10002156 3300021388 Bacteria 12008
200 Ga0213875_10008144 3300021388 Bacteria 5382
201 Ga0213875_10014422 3300021388 Unclassified 3856
202 Ga0213875_10029077 3300021388 Unclassified 2620
203 Ga0213875_10035527 3300021388 Bacteria 2351
204 Ga0213875_10157875 3300021388 Bacteria 1064
205 Ga0213871_10004158 3300021441 Bacteria 2870
206 Ga0207699_10051256 3300025906 Bacteria 2438
207 Ga0207699_10138236 3300025906 Bacteria 1598
208 Ga0207654_10040303 3300025911 Bacteria 2631
209 Ga0207707_10000321 3300025912 Bacteria 50664
210 Ga0207707_10048271 3300025912 Bacteria 3708
211 Ga0207707_10064956 3300025912 Bacteria 3178
212 Ga0207695_10002387 3300025913 Bacteria 27843
213 Ga0207695_10003624 3300025913 Bacteria 21588
214 Ga0207695_10008798 3300025913 Bacteria 12582
215 Ga0207671_10017450 3300025914 Bacteria 5533
216 Ga0207671_10035704 3300025914 Bacteria 3687
217 Ga0207671_10179039 3300025914 Bacteria 1649
218 Ga0207663_10015544 3300025916 Bacteria 4202
219 Ga0207663_10024682 3300025916 Unclassified 3465
220 Ga0207663_10027618 3300025916 Bacteria 3311
221 Ga0207660_10027833 3300025917 Bacteria 3862
222 Ga0207657_10029221 3300025919 Bacteria 5020
223 Ga0207657_10202852 3300025919 Bacteria 1594
224 Ga0207649_10028895 3300025920 Bacteria 3270
225 Ga0207652_10075825 3300025921 Bacteria 2931
226 Ga0207652_10078769 3300025921 Bacteria 2878
227 Ga0207694_10025385 3300025924 Unclassified 4505
228 Ga0207694_10069996 3300025924 Bacteria 2741
229 Ga0207694_10100234 3300025924 Bacteria 2294
230 Ga0207650_10664645 3300025925 Unclassified 879
231 Ga0207687_10000852 3300025927 Bacteria 20635
232 Ga0207687_10143506 3300025927 Bacteria 1814
233 Ga0207687_10146097 3300025927 Unclassified 1799
234 Ga0207700_10009599 3300025928 Bacteria 6059
235 Ga0207700_10013330 3300025928 Bacteria 5344
236 Ga0207700_10510062 3300025928 Bacteria 1065
237 Ga0207664_10061460 3300025929 Unclassified 2997
238 Ga0207690_10434157 3300025932 Bacteria 1053
239 Ga0207706_10020537 3300025933 Bacteria 5936
240 Ga0207706_10201577 3300025933 Bacteria 1745
241 Ga0207686_10049756 3300025934 Bacteria 2603
242 Ga0207686_10073775 3300025934 Unclassified 2202
243 Ga0207686_10116973 3300025934 Bacteria 1808
244 Ga0207686_10434976 3300025934 Bacteria 1006
245 Ga0207711_10004415 3300025941 Bacteria 11989
246 Ga0207711_10094024 3300025941 Bacteria 2641
247 Ga0207711_10114600 3300025941 Bacteria 2401
248 Ga0207711_10163777 3300025941 Unclassified 2015
249 Ga0207711_10210583 3300025941 Bacteria 1775
250 Ga0207689_10040131 3300025942 Unclassified 3875
251 Ga0207661_10000493 3300025944 Bacteria 25372
252 Ga0207661_10011202 3300025944 Bacteria 6487
253 Ga0207661_10031132 3300025944 Bacteria 4117
254 Ga0207667_10001162 3300025949 Bacteria 33070
255 Ga0207667_10005400 3300025949 Bacteria 15584
256 Ga0207667_10023993 3300025949 Bacteria 6709
257 Ga0207667_10089188 3300025949 Bacteria 3188
258 Ga0207667_10612482 3300025949 Bacteria 1097
259 Ga0207712_10016021 3300025961 Unclassified 4845
260 Ga0207712_10033380 3300025961 Unclassified 3479
261 Ga0207640_10103218 3300025981 Bacteria 2004
262 Ga0207640_10287492 3300025981 Bacteria 1295
263 Ga0207658_10312048 3300025986 Unclassified 1359
264 Ga0207703_10005327 3300026035 Bacteria 10362
265 Ga0207703_10084692 3300026035 Bacteria 2652
266 Ga0207703_10151832 3300026035 Bacteria 2021
267 Ga0207703_10430219 3300026035 Unclassified 1230
268 Ga0207639_10072015 3300026041 Bacteria 2705
269 Ga0207639_10086242 3300026041 Bacteria 2499
270 Ga0207708_10343186 3300026075 Bacteria 1223
271 Ga0207702_10014805 3300026078 Bacteria 6470
272 Ga0207702_10015086 3300026078 Bacteria 6406
273 Ga0207702_10031948 3300026078 Bacteria 4391
274 Ga0207702_10213530 3300026078 Bacteria 1795
275 Ga0207702_10540623 3300026078 Unclassified 1139
276 Ga0207641_10029440 3300026088 Unclassified 4541
277 Ga0207641_10145181 3300026088 Bacteria 2145
278 Ga0207641_10838227 3300026088 Unclassified 911
279 Ga0207676_10107100 3300026095 Bacteria 2331
280 Ga0207674_10001379 3300026116 Bacteria 31386
281 Ga0207674_10001597 3300026116 Bacteria 29174
282 Ga0207698_10095954 3300026142 Bacteria 2442
283 Ga0207698_10313826 3300026142 Unclassified 1465
284 Ga0268264_10085248 3300028381 Bacteria 2711
285 Ga0268264_10302246 3300028381 Bacteria 1507
286 Ga0268264_10513666 3300028381 Unclassified 1170
287 Ga0268264_10921569 3300028381 Unclassified 878
288 Ga0265325_10014530 3300031241 Bacteria 4445
289 Ga0265325_10050330 3300031241 Unclassified 2146
290 Ga0265314_10000541 3300031711 Bacteria 48544
291 Ga0265314_10007557 3300031711 Bacteria 9418
292 Ga0373934_0005187 3300035086 Bacteria 4821
293 Ga0373923_0011897 3300035111 Bacteria 3204
294 Ga0373953_0164679 3300035117 Bacteria 953
295 Ga0373954_0119537 3300035118 Bacteria 1278
296 Ga0373956_0133425 3300035119 Bacteria 1163
297 Ga0373957_0066925 3300035120 Bacteria 1400
298 Ga0373957_0140929 3300035120 Bacteria 986
299 Ga0373955_0044339 3300035172 Bacteria 2395
300 Ga0373935_0017968 3300035692 Bacteria 4298
301 Ga0373927_0008027 3300035695 Bacteria 7125
302 Ga0373933_0001398 3300035724 Bacteria 14169
303 Ga0373933_0037683 3300035724 Unclassified 2838
304 Ga0373933_0119582 3300035724 Bacteria 1649
305 Ga0373947_0016677 3300035725 Bacteria 4221
306 Ga0373947_0023313 3300035725 Bacteria 3599
307 Ga0373947_0162320 3300035725 Unclassified 1446
308 Ga0373937_0012341 3300036401 Bacteria 7513
309 Ga0373937_0034059 3300036401 Unclassified 4631
310 Ga0373937_0088547 3300036401 Bacteria 2866
311 Ga0373925_0009664 3300037068 Bacteria 7023
312 Ga0373925_0023441 3300037068 Bacteria 4503
313 Ga0373925_0025048 3300037068 Bacteria 4358
314 Ga0373925_0476651 3300037068 Bacteria 1023
315 Ga0395900_0406128 3300037418 Unclassified 1325
316 Ga0395900_0415093 3300037418 Unclassified 1308
317 Ga0395898_0143477 3300037466 Bacteria 2286
318 Ga0436364_0123092 3300037853 Bacteria 6773
319 Ga0436364_0343343 3300037853 Bacteria 5280
320 Ga0436364_0425396 3300037853 Unclassified 1795
321 Ga0436364_0425903 3300037853 Bacteria 5619
322 Ga0436364_0748068 3300037853 Bacteria 528910
323 Ga0436364_0812157 3300037853 Bacteria 6873
324 Ga0436364_0924337 3300037853 Bacteria 54634
325 Ga0436364_1060243 3300037853 Bacteria 14979
326 Ga0436364_1132894 3300037853 Bacteria 1540
327 Ga0436364_1160698 3300037853 Bacteria 9470
328 Ga0436364_1161746 3300037853 Bacteria 5006
329 Ga0436364_1298937 3300037853 Bacteria 123533
330 Ga0436364_1299943 3300037853 Bacteria 1610
331 Ga0436364_1423276 3300037853 Bacteria 1223
332 Ga0436364_1440911 3300037853 Bacteria 6617
333 Ga0436364_1476362 3300037853 Bacteria 2775
334 Ga0436365_0359624 3300039437 Unclassified 1335
335 Ga0436365_0393320 3300039437 Bacteria 33122
336 Ga0436365_0445685 3300039437 Bacteria 5153
337 Ga0436365_0475230 3300039437 Bacteria 758
338 Ga0436365_0653002 3300039437 Bacteria 6784
339 Ga0436365_1300555 3300039437 Bacteria 2386
340 Ga0436365_1865809 3300039437 Bacteria 2482
341 Ga0436360_0093560 3300039438 Bacteria 41118
342 Ga0436363_0389554 3300039450 Bacteria 3226
343 Ga0436363_0967090 3300039450 Bacteria 3582
344 Ga0436363_1669023 3300039450 Unclassified 956
345 Ga0436362_0219413 3300039453 Bacteria 8998
346 Ga0436362_0771973 3300039453 Bacteria 1940
347 Ga0466966_0021554 3300044684 Bacteria 4231
348 Ga0466963_0253752 3300044694 Unclassified 1234
349 Ga0466960_0106587 3300044901 Unclassified 1450
350 Ga0451576_0042534 3300045051 Unclassified 4796
351 Ga0466958_0077812 3300045836 Bacteria 2038
352 Ga0466967_0616097 3300045976 Bacteria 1072
353 Ga0495592_0006491 3300046454 Bacteria 8709
354 Ga0495580_0002878 3300046472 Bacteria 14816
355 Ga0495580_0090162 3300046472 Bacteria 2135
356 Ga0495580_0102675 3300046472 Bacteria 1988
357 Ga0495580_0246101 3300046472 Bacteria 1225
358 Ga0495582_0015625 3300046473 Bacteria 4167
359 Ga0495628_0205771 3300046516 Bacteria 1482
360 Ga0495630_0428925 3300046517 Unclassified 1013
361 Ga0495652_0465512 3300046529 Unclassified 882
362 Ga0495665_0034125 3300046531 Bacteria 2721
363 Ga0495586_0038205 3300046535 Bacteria 2577
364 Ga0495587_0000290 3300046536 Bacteria 35634
365 Ga0495587_0113010 3300046536 Bacteria 1559
366 Ga0495667_0029952 3300046559 Bacteria 3660
367 Ga0495635_0084003 3300046663 Unclassified 2179
368 Ga0495635_0139762 3300046663 Bacteria 1650
369 Ga0495599_0005766 3300046678 Bacteria 7430
370 Ga0495658_0022789 3300046683 Bacteria 3316
371 Ga0495658_0108509 3300046683 Bacteria 1666
372 Ga0495674_0498032 3300047319 Bacteria 975
373 Ga0495684_0510517 3300047471 Bacteria 825
374 Ga0495593_0136463 3300047673 Bacteria 1244
375 Ga0495602_0004252 3300048088 Bacteria 14904
376 Ga0496104_0193916 3300048907 Unclassified 1943
377 Ga0496109_0549333 3300048912 Bacteria 1090
378 Ga0496110_0218120 3300048913 Unclassified 1735
379 Ga0496115_0190229 3300048918 Bacteria 1696
380 Ga0501033_0162530 3300049570 Bacteria 1607
381 Ga0501034_0013966 3300049571 Bacteria 8267
382 Ga0501046_0028128 3300049580 Bacteria 4581
383 Ga0501047_0003077 3300049581 Bacteria 15816
384 Ga0501047_0066733 3300049581 Bacteria 3469
385 Ga0501070_0010779 3300049586 Bacteria 7723
386 Ga0501073_0142940 3300049589 Unclassified 1658
387 Ga0501035_0022388 3300049822 Bacteria 5803
388 Ga0501044_0001789 3300049823 Bacteria 25105
389 Ga0501044_0007160 3300049823 Bacteria 12272
390 nmdc:mga09592_118504_c1 3300050508 Bacteria 2272
391 nmdc:mga0n895_1067317_c1 3300050512 Unclassified 786
392 nmdc:mga08x19_24850_c1 3300050514 Unclassified 3728
393 Ga0587083_0055918 3300059505 Unclassified 875

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_10160737 Ga0105245_101607372 192
2 3300009545 Ga0105237_10042166 Ga0105237_100421665 192
3 3300010375 Ga0105239_10324431 Ga0105239_103244312 192
4 3300013105 Ga0157369_10404808 Ga0157369_104048082 192
5 3300035724 Ga0373933_0037683 Ga0373933_0037683_1183_1902 192
6 3300046454 Ga0495592_0006491 Ga0495592_0006491_601_1323 192
7 3300046473 Ga0495582_0015625 Ga0495582_0015625_2346_2996 192
8 3300046529 Ga0495652_0465512 Ga0495652_0465512_39_695 192
9 3300046535 Ga0495586_0038205 Ga0495586_0038205_1009_1659 192
10 3300046536 Ga0495587_0000290 Ga0495587_0000290_31705_32427 192
11 3300046663 Ga0495635_0139762 Ga0495635_0139762_462_1112 192
12 3300046683 Ga0495658_0022789 Ga0495658_0022789_2098_2748 192
13 3300046683 Ga0495658_0108509 Ga0495658_0108509_973_1650 192
14 3300048088 Ga0495602_0004252 Ga0495602_0004252_10751_11473 192
15 3300037068 Ga0373925_0025048 Ga0373925_0025048_338_1036 197
16 3300046472 Ga0495580_0090162 Ga0495580_0090162_399_1097 197
17 3300035118 Ga0373954_0119537 Ga0373954_0119537_104_811 198
18 3300047471 Ga0495684_0510517 Ga0495684_0510517_46_753 198
19 3300005339 Ga0070660_100341025 Ga0070660_1003410252 199
20 3300005535 Ga0070684_100054173 Ga0070684_1000541732 199
21 3300005547 Ga0070693_100185581 Ga0070693_1001855812 199
22 3300005548 Ga0070665_100077044 Ga0070665_1000770442 199
23 3300009093 Ga0105240_10190817 Ga0105240_101908173 199
24 3300009551 Ga0105238_10011255 Ga0105238_100112554 199
25 3300013104 Ga0157370_10305290 Ga0157370_103052902 199
26 3300025924 Ga0207694_10025385 Ga0207694_100253854 199
27 3300048907 Ga0496104_0193916 Ga0496104_0193916_37_1020 199
28 3300005329 Ga0070683_100026827 Ga0070683_1000268272 200
29 3300005365 Ga0070688_100017288 Ga0070688_1000172882 200
30 3300005439 Ga0070711_100013612 Ga0070711_1000136121 200
31 3300005563 Ga0068855_100104778 Ga0068855_1001047782 200
32 3300005577 Ga0068857_100018299 Ga0068857_1000182995 200
33 3300005614 Ga0068856_100038926 Ga0068856_1000389263 200
34 3300006028 Ga0070717_10457982 Ga0070717_104579822 200
35 3300006871 Ga0075434_101074041 Ga0075434_1010740411 200
36 3300013307 Ga0157372_10024248 Ga0157372_100242484 200
37 3300025916 Ga0207663_10015544 Ga0207663_100155443 200
38 3300025928 Ga0207700_10009599 Ga0207700_100095992 200
39 3300026116 Ga0207674_10001597 Ga0207674_1000159720 200
40 3300035725 Ga0373947_0016677 Ga0373947_0016677_1021_1731 200
41 3300035725 Ga0373947_0162320 Ga0373947_0162320_148_900 200
42 3300037068 Ga0373925_0009664 Ga0373925_0009664_4493_5203 200
43 3300050512 nmdc:mga0n895_1067317_c1 nmdc:mga0n895_1067317_c1_36_764 200
44 3300005563 Ga0068855_100043148 Ga0068855_1000431485 201
45 3300009098 Ga0105245_10128248 Ga0105245_101282482 201
46 3300009551 Ga0105238_10123110 Ga0105238_101231102 201
47 3300013105 Ga0157369_10001078 Ga0157369_100010787 201
48 3300014969 Ga0157376_10478591 Ga0157376_104785912 201
49 3300025924 Ga0207694_10100234 Ga0207694_101002342 201
50 3300025927 Ga0207687_10143506 Ga0207687_101435062 201
51 3300025949 Ga0207667_10005400 Ga0207667_1000540012 201
52 3300035117 Ga0373953_0164679 Ga0373953_0164679_11_835 201
53 3300046472 Ga0495580_0246101 Ga0495580_0246101_13_684 201
54 3300005548 Ga0070665_100109685 Ga0070665_1001096852 202
55 3300005614 Ga0068856_100005460 Ga0068856_1000054609 202
56 3300009093 Ga0105240_10001905 Ga0105240_1000190523 202
57 3300013104 Ga0157370_10002529 Ga0157370_1000252913 202
58 3300013307 Ga0157372_10095866 Ga0157372_100958662 202
59 3300014969 Ga0157376_10356775 Ga0157376_103567752 202
60 3300025913 Ga0207695_10008798 Ga0207695_1000879811 202
61 3300026078 Ga0207702_10015086 Ga0207702_100150862 202
62 3300037853 Ga0436364_1440911 Ga0436364_1440911_5650_6342 202
63 3300009093 Ga0105240_10567369 Ga0105240_105673692 204
64 3300009177 Ga0105248_10181479 Ga0105248_101814792 204
65 3300035086 Ga0373934_0005187 Ga0373934_0005187_3808_4632 204
66 3300035120 Ga0373957_0140929 Ga0373957_0140929_97_882 204
67 3300035724 Ga0373933_0001398 Ga0373933_0001398_2636_3421 204
68 3300036401 Ga0373937_0012341 Ga0373937_0012341_5342_6127 204
69 3300037853 Ga0436364_1476362 Ga0436364_1476362_583_1242 204
70 3300005337 Ga0070682_100530762 Ga0070682_1005307621 205
71 3300009098 Ga0105245_10057774 Ga0105245_100577742 205
72 3300009177 Ga0105248_10021191 Ga0105248_100211912 205
73 3300009553 Ga0105249_10002395 Ga0105249_1000239511 205
74 3300011119 Ga0105246_10002255 Ga0105246_1000225510 205
75 3300013104 Ga0157370_10272225 Ga0157370_102722252 205
76 3300013105 Ga0157369_10029371 Ga0157369_100293712 205
77 3300013308 Ga0157375_10098905 Ga0157375_100989051 205
78 3300014325 Ga0163163_10390056 Ga0163163_103900561 205
79 3300021388 Ga0213875_10035527 Ga0213875_100355272 205
80 3300037853 Ga0436364_1161746 Ga0436364_1161746_1167_1853 205
81 3300039437 Ga0436365_0359624 Ga0436365_0359624_360_1046 205
82 3300005841 Ga0068863_100013776 Ga0068863_1000137764 206
83 3300005843 Ga0068860_100319813 Ga0068860_1003198132 206
84 3300009098 Ga0105245_10187819 Ga0105245_101878191 206
85 3300026088 Ga0207641_10029440 Ga0207641_100294404 206
86 3300031711 Ga0265314_10007557 Ga0265314_100075573 206
87 3300037853 Ga0436364_1423276 Ga0436364_1423276_145_840 206
88 3300005329 Ga0070683_100185185 Ga0070683_1001851852 207
89 3300005336 Ga0070680_100139748 Ga0070680_1001397482 207
90 3300005337 Ga0070682_100208346 Ga0070682_1002083462 207
91 3300005345 Ga0070692_10424885 Ga0070692_104248851 207
92 3300005458 Ga0070681_10057676 Ga0070681_100576764 207
93 3300005530 Ga0070679_100020172 Ga0070679_1000201722 207
94 3300005535 Ga0070684_100314690 Ga0070684_1003146902 207
95 3300009545 Ga0105237_10516351 Ga0105237_105163512 207
96 3300013105 Ga0157369_10296085 Ga0157369_102960852 207
97 3300013105 Ga0157369_10314554 Ga0157369_103145542 207
98 3300013307 Ga0157372_10011299 Ga0157372_100112993 207
99 3300013307 Ga0157372_10088274 Ga0157372_100882743 207
100 3300025912 Ga0207707_10064956 Ga0207707_100649562 207
101 3300025921 Ga0207652_10075825 Ga0207652_100758252 207
102 3300037418 Ga0395900_0406128 Ga0395900_0406128_580_1269 207
103 3300037466 Ga0395898_0143477 Ga0395898_0143477_1339_2028 207
104 3300039450 Ga0436363_0389554 Ga0436363_0389554_833_1525 207
105 3300046536 Ga0495587_0113010 Ga0495587_0113010_720_1484 207
106 3300046678 Ga0495599_0005766 Ga0495599_0005766_4553_5317 207
107 3300005329 Ga0070683_100021125 Ga0070683_1000211255 208
108 3300005330 Ga0070690_100150528 Ga0070690_1001505281 208
109 3300005339 Ga0070660_100069206 Ga0070660_1000692062 208
110 3300005344 Ga0070661_100245860 Ga0070661_1002458601 208
111 3300005355 Ga0070671_100025392 Ga0070671_1000253922 208
112 3300005364 Ga0070673_100057378 Ga0070673_1000573781 208
113 3300005435 Ga0070714_100081708 Ga0070714_1000817082 208
114 3300005436 Ga0070713_100023829 Ga0070713_1000238292 208
115 3300005439 Ga0070711_100083046 Ga0070711_1000830463 208
116 3300005457 Ga0070662_100020740 Ga0070662_1000207403 208
117 3300005458 Ga0070681_10680922 Ga0070681_106809222 208
118 3300005459 Ga0068867_100209739 Ga0068867_1002097391 208
119 3300005535 Ga0070684_100081332 Ga0070684_1000813322 208
120 3300005539 Ga0068853_100069535 Ga0068853_1000695353 208
121 3300005544 Ga0070686_100270836 Ga0070686_1002708361 208
122 3300005547 Ga0070693_100143577 Ga0070693_1001435772 208
123 3300005563 Ga0068855_100002712 Ga0068855_10000271210 208
124 3300005564 Ga0070664_100070417 Ga0070664_1000704172 208
125 3300005614 Ga0068856_100002106 Ga0068856_10000210617 208
126 3300005614 Ga0068856_100027447 Ga0068856_1000274476 208
127 3300005614 Ga0068856_100637658 Ga0068856_1006376581 208
128 3300005616 Ga0068852_100043596 Ga0068852_1000435963 208
129 3300005617 Ga0068859_100331108 Ga0068859_1003311082 208
130 3300005618 Ga0068864_100232706 Ga0068864_1002327061 208
131 3300005842 Ga0068858_100863817 Ga0068858_1008638171 208
132 3300005843 Ga0068860_100130788 Ga0068860_1001307882 208
133 3300005937 Ga0081455_10015906 Ga0081455_100159066 208
134 3300006028 Ga0070717_10215991 Ga0070717_102159912 208
135 3300006175 Ga0070712_100604825 Ga0070712_1006048252 208
136 3300006358 Ga0068871_100048173 Ga0068871_1000481732 208
137 3300006358 Ga0068871_100049467 Ga0068871_1000494672 208
138 3300006881 Ga0068865_100026748 Ga0068865_1000267482 208
139 3300006881 Ga0068865_100067686 Ga0068865_1000676862 208
140 3300006931 Ga0097620_100331128 Ga0097620_1003311282 208
141 3300009148 Ga0105243_11016749 Ga0105243_110167491 208
142 3300009174 Ga0105241_10012341 Ga0105241_100123414 208
143 3300009174 Ga0105241_10151055 Ga0105241_101510552 208
144 3300009176 Ga0105242_10033811 Ga0105242_100338113 208
145 3300009177 Ga0105248_10004451 Ga0105248_1000445113 208
146 3300009545 Ga0105237_10303081 Ga0105237_103030812 208
147 3300009551 Ga0105238_10008448 Ga0105238_100084485 208
148 3300010375 Ga0105239_10016477 Ga0105239_100164776 208
149 3300010375 Ga0105239_10305024 Ga0105239_103050242 208
150 3300013105 Ga0157369_10003559 Ga0157369_100035598 208
151 3300013296 Ga0157374_10005880 Ga0157374_100058805 208
152 3300013296 Ga0157374_10081084 Ga0157374_100810842 208
153 3300013306 Ga0163162_11124797 Ga0163162_111247971 208
154 3300013307 Ga0157372_10200029 Ga0157372_102000291 208
155 3300013307 Ga0157372_11053750 Ga0157372_110537501 208
156 3300013307 Ga0157372_11063557 Ga0157372_110635571 208
157 3300014325 Ga0163163_10021786 Ga0163163_100217862 208
158 3300014325 Ga0163163_10153699 Ga0163163_101536992 208
159 3300014969 Ga0157376_10083180 Ga0157376_100831802 208
160 3300021358 Ga0213873_10014226 Ga0213873_100142262 208
161 3300021377 Ga0213874_10003222 Ga0213874_100032224 208
162 3300021384 Ga0213876_10043014 Ga0213876_100430141 208
163 3300021388 Ga0213875_10000004 Ga0213875_10000004211 208
164 3300021388 Ga0213875_10000349 Ga0213875_1000034914 208
165 3300021388 Ga0213875_10008144 Ga0213875_100081441 208
166 3300021388 Ga0213875_10029077 Ga0213875_100290772 208
167 3300021441 Ga0213871_10004158 Ga0213871_100041582 208
168 3300025916 Ga0207663_10027618 Ga0207663_100276182 208
169 3300025919 Ga0207657_10202852 Ga0207657_102028522 208
170 3300025920 Ga0207649_10028895 Ga0207649_100288953 208
171 3300025927 Ga0207687_10146097 Ga0207687_101460973 208
172 3300025928 Ga0207700_10013330 Ga0207700_100133302 208
173 3300025929 Ga0207664_10061460 Ga0207664_100614603 208
174 3300025932 Ga0207690_10434157 Ga0207690_104341572 208
175 3300025933 Ga0207706_10020537 Ga0207706_100205373 208
176 3300025933 Ga0207706_10201577 Ga0207706_102015772 208
177 3300025934 Ga0207686_10049756 Ga0207686_100497562 208
178 3300025934 Ga0207686_10073775 Ga0207686_100737752 208
179 3300025934 Ga0207686_10434976 Ga0207686_104349761 208
180 3300025941 Ga0207711_10094024 Ga0207711_100940242 208
181 3300025949 Ga0207667_10023993 Ga0207667_100239932 208
182 3300025949 Ga0207667_10612482 Ga0207667_106124822 208
183 3300025961 Ga0207712_10033380 Ga0207712_100333802 208
184 3300025981 Ga0207640_10103218 Ga0207640_101032182 208
185 3300025986 Ga0207658_10312048 Ga0207658_103120481 208
186 3300026035 Ga0207703_10430219 Ga0207703_104302192 208
187 3300026041 Ga0207639_10072015 Ga0207639_100720152 208
188 3300026078 Ga0207702_10031948 Ga0207702_100319482 208
189 3300026078 Ga0207702_10540623 Ga0207702_105406232 208
190 3300026142 Ga0207698_10095954 Ga0207698_100959542 208
191 3300028381 Ga0268264_10302246 Ga0268264_103022462 208
192 3300028381 Ga0268264_10921569 Ga0268264_109215691 208
193 3300037853 Ga0436364_0343343 Ga0436364_0343343_679_1368 208
194 3300037853 Ga0436364_0425396 Ga0436364_0425396_402_1097 208
195 3300037853 Ga0436364_0425903 Ga0436364_0425903_851_1543 208
196 3300037853 Ga0436364_0748068 Ga0436364_0748068_368079_368768 208
197 3300037853 Ga0436364_1060243 Ga0436364_1060243_12626_13315 208
198 3300037853 Ga0436364_1160698 Ga0436364_1160698_4651_5334 208
199 3300037853 Ga0436364_1298937 Ga0436364_1298937_94640_95326 208
200 3300037853 Ga0436364_1299943 Ga0436364_1299943_578_1249 208
201 3300039437 Ga0436365_0393320 Ga0436365_0393320_27393_28064 208
202 3300039437 Ga0436365_0475230 Ga0436365_0475230_36_695 208
203 3300039437 Ga0436365_0653002 Ga0436365_0653002_5074_5766 208
204 3300039437 Ga0436365_1300555 Ga0436365_1300555_1128_1814 208
205 3300039437 Ga0436365_1865809 Ga0436365_1865809_1638_2330 208
206 3300039438 Ga0436360_0093560 Ga0436360_0093560_24178_24852 208
207 3300039450 Ga0436363_0967090 Ga0436363_0967090_1877_2566 208
208 3300039450 Ga0436363_1669023 Ga0436363_1669023_238_903 208
209 3300039453 Ga0436362_0219413 Ga0436362_0219413_2749_3441 208
210 3300039453 Ga0436362_0771973 Ga0436362_0771973_72_758 208
211 3300044684 Ga0466966_0021554 Ga0466966_0021554_2934_3626 208
212 3300044694 Ga0466963_0253752 Ga0466963_0253752_528_1190 208
213 3300044901 Ga0466960_0106587 Ga0466960_0106587_692_1387 208
214 3300045836 Ga0466958_0077812 Ga0466958_0077812_310_999 208
215 3300045976 Ga0466967_0616097 Ga0466967_0616097_175_873 208
216 3300048918 Ga0496115_0190229 Ga0496115_0190229_496_1188 208
217 3300049581 Ga0501047_0066733 Ga0501047_0066733_984_1679 208
218 3300049823 Ga0501044_0007160 Ga0501044_0007160_2122_2817 208
219 3300005329 Ga0070683_100017347 Ga0070683_1000173473 209
220 3300005435 Ga0070714_100225865 Ga0070714_1002258652 209
221 3300005435 Ga0070714_100350044 Ga0070714_1003500442 209
222 3300005458 Ga0070681_10162541 Ga0070681_101625413 209
223 3300005535 Ga0070684_100665246 Ga0070684_1006652462 209
224 3300005614 Ga0068856_100367155 Ga0068856_1003671552 209
225 3300005842 Ga0068858_100140582 Ga0068858_1001405822 209
226 3300005843 Ga0068860_100047103 Ga0068860_1000471032 209
227 3300006175 Ga0070712_100501912 Ga0070712_1005019121 209
228 3300006358 Ga0068871_100269692 Ga0068871_1002696922 209
229 3300009098 Ga0105245_10001163 Ga0105245_1000116311 209
230 3300009098 Ga0105245_10234673 Ga0105245_102346731 209
231 3300011119 Ga0105246_10054799 Ga0105246_100547993 209
232 3300013296 Ga0157374_10199316 Ga0157374_101993162 209
233 3300013296 Ga0157374_10749595 Ga0157374_107495951 209
234 3300013297 Ga0157378_10054792 Ga0157378_100547923 209
235 3300014969 Ga0157376_10287577 Ga0157376_102875772 209
236 3300025928 Ga0207700_10510062 Ga0207700_105100622 209
237 3300025942 Ga0207689_10040131 Ga0207689_100401313 209
238 3300025949 Ga0207667_10089188 Ga0207667_100891883 209
239 3300025981 Ga0207640_10287492 Ga0207640_102874922 209
240 3300026035 Ga0207703_10151832 Ga0207703_101518322 209
241 3300026088 Ga0207641_10145181 Ga0207641_101451813 209
242 3300026095 Ga0207676_10107100 Ga0207676_101071002 209
243 3300028381 Ga0268264_10085248 Ga0268264_100852483 209
244 3300031241 Ga0265325_10050330 Ga0265325_100503301 209
245 3300037418 Ga0395900_0415093 Ga0395900_0415093_530_1225 209
246 3300037853 Ga0436364_0924337 Ga0436364_0924337_34262_34969 209
247 3300045051 Ga0451576_0042534 Ga0451576_0042534_1563_2219 209
248 3300049570 Ga0501033_0162530 Ga0501033_0162530_128_823 209
249 3300049571 Ga0501034_0013966 Ga0501034_0013966_3484_4179 209
250 3300049580 Ga0501046_0028128 Ga0501046_0028128_1322_2017 209
251 3300049581 Ga0501047_0003077 Ga0501047_0003077_3791_4486 209
252 3300049586 Ga0501070_0010779 Ga0501070_0010779_4413_5108 209
253 3300049589 Ga0501073_0142940 Ga0501073_0142940_17_712 209
254 3300049822 Ga0501035_0022388 Ga0501035_0022388_2506_3201 209
255 3300049823 Ga0501044_0001789 Ga0501044_0001789_783_1478 209
256 3300059505 Ga0587083_0055918 Ga0587083_0055918_110_805 209
257 3300004799 Ga0058863_11013217 Ga0058863_110132172 210
258 3300005327 Ga0070658_10075731 Ga0070658_100757312 210
259 3300005329 Ga0070683_100001168 Ga0070683_10000116819 210
260 3300005329 Ga0070683_100042672 Ga0070683_1000426722 210
261 3300005336 Ga0070680_100069337 Ga0070680_1000693372 210
262 3300005341 Ga0070691_10002536 Ga0070691_100025368 210
263 3300005344 Ga0070661_100179947 Ga0070661_1001799472 210
264 3300005439 Ga0070711_100044666 Ga0070711_1000446662 210
265 3300005458 Ga0070681_10000705 Ga0070681_100007052 210
266 3300005458 Ga0070681_10086481 Ga0070681_100864812 210
267 3300005530 Ga0070679_100000252 Ga0070679_10000025220 210
268 3300005535 Ga0070684_100001010 Ga0070684_1000010103 210
269 3300005535 Ga0070684_100071276 Ga0070684_1000712762 210
270 3300005539 Ga0068853_100109989 Ga0068853_1001099892 210
271 3300005545 Ga0070695_100020759 Ga0070695_1000207592 210
272 3300005563 Ga0068855_100003299 Ga0068855_10000329920 210
273 3300005577 Ga0068857_100000348 Ga0068857_10000034827 210
274 3300005578 Ga0068854_100246806 Ga0068854_1002468062 210
275 3300005614 Ga0068856_100000439 Ga0068856_1000004392 210
276 3300005614 Ga0068856_100495202 Ga0068856_1004952022 210
277 3300005842 Ga0068858_100002142 Ga0068858_10000214211 210
278 3300009093 Ga0105240_10000391 Ga0105240_1000039161 210
279 3300009093 Ga0105240_10064786 Ga0105240_100647862 210
280 3300009174 Ga0105241_10374240 Ga0105241_103742402 210
281 3300009545 Ga0105237_10001318 Ga0105237_1000131818 210
282 3300009545 Ga0105237_10011293 Ga0105237_100112935 210
283 3300009545 Ga0105237_10069783 Ga0105237_100697832 210
284 3300010375 Ga0105239_10066104 Ga0105239_100661042 210
285 3300013105 Ga0157369_10114148 Ga0157369_101141482 210
286 3300014325 Ga0163163_10023184 Ga0163163_100231845 210
287 3300021388 Ga0213875_10157875 Ga0213875_101578751 210
288 3300025911 Ga0207654_10040303 Ga0207654_100403032 210
289 3300025912 Ga0207707_10000321 Ga0207707_100003214 210
290 3300025912 Ga0207707_10048271 Ga0207707_100482712 210
291 3300025913 Ga0207695_10002387 Ga0207695_1000238724 210
292 3300025913 Ga0207695_10003624 Ga0207695_100036242 210
293 3300025914 Ga0207671_10017450 Ga0207671_100174504 210
294 3300025914 Ga0207671_10035704 Ga0207671_100357042 210
295 3300025914 Ga0207671_10179039 Ga0207671_101790392 210
296 3300025916 Ga0207663_10024682 Ga0207663_100246822 210
297 3300025917 Ga0207660_10027833 Ga0207660_100278332 210
298 3300025919 Ga0207657_10029221 Ga0207657_100292212 210
299 3300025921 Ga0207652_10078769 Ga0207652_100787692 210
300 3300025924 Ga0207694_10069996 Ga0207694_100699962 210
301 3300025927 Ga0207687_10000852 Ga0207687_100008524 210
302 3300025941 Ga0207711_10004415 Ga0207711_100044159 210
303 3300025944 Ga0207661_10000493 Ga0207661_1000049310 210
304 3300025944 Ga0207661_10011202 Ga0207661_100112023 210
305 3300025944 Ga0207661_10031132 Ga0207661_100311323 210
306 3300025949 Ga0207667_10001162 Ga0207667_100011622 210
307 3300025961 Ga0207712_10016021 Ga0207712_100160212 210
308 3300026035 Ga0207703_10005327 Ga0207703_100053273 210
309 3300026041 Ga0207639_10086242 Ga0207639_100862422 210
310 3300026078 Ga0207702_10014805 Ga0207702_100148055 210
311 3300026078 Ga0207702_10213530 Ga0207702_102135302 210
312 3300026116 Ga0207674_10001379 Ga0207674_100013792 210
313 3300026142 Ga0207698_10313826 Ga0207698_103138261 210
314 3300031711 Ga0265314_10000541 Ga0265314_100005412 210
315 3300037853 Ga0436364_1132894 Ga0436364_1132894_137_829 210
316 3300050508 nmdc:mga09592_118504_c1 nmdc:mga09592_118504_c1_331_1017 210
317 3300005330 Ga0070690_100085053 Ga0070690_1000850533 211
318 3300005842 Ga0068858_100223694 Ga0068858_1002236942 211
319 3300006358 Ga0068871_100116752 Ga0068871_1001167523 211
320 3300031241 Ga0265325_10014530 Ga0265325_100145303 211
321 3300046517 Ga0495630_0428925 Ga0495630_0428925_128_850 211
322 3300005434 Ga0070709_10043216 Ga0070709_100432161 212
323 3300005441 Ga0070700_100213072 Ga0070700_1002130722 212
324 3300005545 Ga0070695_100923724 Ga0070695_1009237241 212
325 3300005840 Ga0068870_10119999 Ga0068870_101199992 212
326 3300006881 Ga0068865_100119183 Ga0068865_1001191833 212
327 3300009098 Ga0105245_11189369 Ga0105245_111893691 212
328 3300009148 Ga0105243_10099044 Ga0105243_100990442 212
329 3300009176 Ga0105242_10066636 Ga0105242_100666362 212
330 3300009177 Ga0105248_10195387 Ga0105248_101953872 212
331 3300011119 Ga0105246_10107064 Ga0105246_101070642 212
332 3300025906 Ga0207699_10051256 Ga0207699_100512562 212
333 3300025934 Ga0207686_10116973 Ga0207686_101169732 212
334 3300025941 Ga0207711_10163777 Ga0207711_101637773 212
335 3300026075 Ga0207708_10343186 Ga0207708_103431862 212
336 3300039437 Ga0436365_0445685 Ga0436365_0445685_921_1643 212
337 3300046472 Ga0495580_0102675 Ga0495580_0102675_268_1098 212
338 3300005340 Ga0070689_100292229 Ga0070689_1002922292 213
339 3300005842 Ga0068858_100103781 Ga0068858_1001037812 213
340 3300009177 Ga0105248_10019484 Ga0105248_100194848 213
341 3300025941 Ga0207711_10114600 Ga0207711_101146002 213
342 3300026035 Ga0207703_10084692 Ga0207703_100846922 213
343 3300028381 Ga0268264_10513666 Ga0268264_105136662 213
344 3300005841 Ga0068863_100385027 Ga0068863_1003850271 214
345 3300009177 Ga0105248_10426604 Ga0105248_104266042 214
346 3300025925 Ga0207650_10664645 Ga0207650_106646451 214
347 3300025941 Ga0207711_10210583 Ga0207711_102105832 214
348 3300026088 Ga0207641_10838227 Ga0207641_108382272 214
349 3300048912 Ga0496109_0549333 Ga0496109_0549333_296_976 214
350 3300048913 Ga0496110_0218120 Ga0496110_0218120_624_1304 214
351 3300021388 Ga0213875_10002156 Ga0213875_1000215613 215
352 3300021388 Ga0213875_10014422 Ga0213875_100144222 215
353 3300037853 Ga0436364_0123092 Ga0436364_0123092_5168_5899 215
354 3300037853 Ga0436364_0812157 Ga0436364_0812157_1093_1827 215
355 3300005434 Ga0070709_10126986 Ga0070709_101269863 217
356 3300005436 Ga0070713_100181999 Ga0070713_1001819993 217
357 3300006028 Ga0070717_10120167 Ga0070717_101201671 217
358 3300005518 Ga0070699_100052080 Ga0070699_1000520802 218
359 3300005545 Ga0070695_100057161 Ga0070695_1000571612 218
360 3300005546 Ga0070696_100003726 Ga0070696_1000037265 218
361 3300009174 Ga0105241_10830927 Ga0105241_108309271 218
362 3300006028 Ga0070717_10012251 Ga0070717_100122511 219
363 3300004799 Ga0058863_10007773 Ga0058863_100077732 220
364 3300004800 Ga0058861_11572783 Ga0058861_115727832 220
365 3300004803 Ga0058862_12654812 Ga0058862_126548122 220
366 3300005434 Ga0070709_10151731 Ga0070709_101517312 220
367 3300005530 Ga0070679_100066080 Ga0070679_1000660802 220
368 3300005536 Ga0070697_100091005 Ga0070697_1000910051 220
369 3300005545 Ga0070695_100101575 Ga0070695_1001015752 220
370 3300006173 Ga0070716_100033760 Ga0070716_1000337603 220
371 3300006914 Ga0075436_100027824 Ga0075436_1000278242 220
372 3300009174 Ga0105241_10266108 Ga0105241_102661082 220
373 3300025906 Ga0207699_10138236 Ga0207699_101382362 220
374 3300035111 Ga0373923_0011897 Ga0373923_0011897_192_950 220
375 3300035119 Ga0373956_0133425 Ga0373956_0133425_145_903 220
376 3300035120 Ga0373957_0066925 Ga0373957_0066925_24_782 220
377 3300035172 Ga0373955_0044339 Ga0373955_0044339_766_1431 220
378 3300035692 Ga0373935_0017968 Ga0373935_0017968_1985_2743 220
379 3300035695 Ga0373927_0008027 Ga0373927_0008027_29_787 220
380 3300035724 Ga0373933_0119582 Ga0373933_0119582_671_1336 220
381 3300035725 Ga0373947_0023313 Ga0373947_0023313_145_903 220
382 3300036401 Ga0373937_0034059 Ga0373937_0034059_945_1703 220
383 3300036401 Ga0373937_0088547 Ga0373937_0088547_22_687 220
384 3300037068 Ga0373925_0023441 Ga0373925_0023441_3020_3778 220
385 3300037068 Ga0373925_0476651 Ga0373925_0476651_148_813 220
386 3300046472 Ga0495580_0002878 Ga0495580_0002878_3222_3980 220
387 3300046516 Ga0495628_0205771 Ga0495628_0205771_342_1100 220
388 3300046531 Ga0495665_0034125 Ga0495665_0034125_1882_2640 220
389 3300046559 Ga0495667_0029952 Ga0495667_0029952_1748_2506 220
390 3300046663 Ga0495635_0084003 Ga0495635_0084003_1362_2120 220
391 3300047319 Ga0495674_0498032 Ga0495674_0498032_202_867 220
392 3300047673 Ga0495593_0136463 Ga0495593_0136463_30_788 220
393 3300050514 nmdc:mga08x19_24850_c1 nmdc:mga08x19_24850_c1_2823_3485 220

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08281

Sigma70_r4_2

Sigma-70, region 4

173

225

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hug-assembly6.cif.gz_M crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.9276 143 209
5fgm-assembly1.cif.gz_A streptomyces coelicolor sigr region 4 0.9048 154 206
6jhe-assembly1.cif.gz_A crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna 0.9019 159 205
3hug-assembly6.cif.gz_A crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.8827 135 209
3hug-assembly2.cif.gz_E crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.8703 143 212
ID Description Score Start End Superfamily
3hugO00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.937 145 209 1.10.10.10
3hugG00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9145 142 209 1.10.10.10
4mexF03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9049 140 201 1.10.10.10
3vepH00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9046 155 205 1.10.10.10
3vepE00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9031 155 205 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2G1ZUJ5-F1-model_v4 RNA polymerase sigma factor 70 region 4 type 2 domain-containing protein 0.8061 127 218 GO:0003677
GO:0006352
GO:0016987
AF-A0A7W0ZGU0-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.7709 129 217 GO:0003677
GO:0006352
GO:0016987
AF-A0A7W0ZGU0-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.7558 129 217 GO:0003677
GO:0006352
GO:0016987
AF-A0A7V3C665-F1-model_v4 RNA polymerase sigma factor 70 region 4 type 2 domain-containing protein 0.7239 117 213 GO:0003677
GO:0006352
GO:0016987
AF-A0A2G1ZUJ5-F1-model_v4 RNA polymerase sigma factor 70 region 4 type 2 domain-containing protein 0.6766 127 218 GO:0003677
GO:0006352
GO:0016987

Feature Viewer

pLDDT pTM Quality
75.36 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map