F432294

General Info

Members Datasets Scaffolds Average Seq Length
392 223 784 350

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10050585|Ga0114129_100505854
Length 357
Sequence MDNIMSSLLTDSLQPDQTFTRSFALGLGLTNECNLACSFCYRDPDRVDRLTLEQVKSVMTRLPVHSVNLGTGENGMHPEFLAILNYLRKEPVKLTITSNGHSIAILDDEHVRAFHDAEFSLDYPTEAEQDEQRGAGNWKLIHEQAARCRRLGVPVTIIAVMMKSNYAKLAEVARVAKKFDAPLRVNVYQSVRTDLFALTYEEYWEGFRRLFAATDVIAIGEPLVRALTGFPAPETACGGCGVATVRVTPRATTQPCVYWPGAGGALADLLSAGEEIVKTPSFAAARILPEACQPCEFRAVCRGGCAGRRMLHGALDEPDPYCPIIRGDRPRLEIRMAAARDLPKVGSACTTVVIARE

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
104 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
192 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
193 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
223 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0.51
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.51
Nodule 0.26
Rhizoplane 4.59
Rhizosphere 94.39
Stem 0
Stem Tuber 0
Unclassified 10.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10050585 3300009147 Bacteria 5837
2 MBSR1b_contig_11138974 2162886012 Bacteria 2678
3 JGI24749J21850_1004230 3300002076 Bacteria 2006
4 Ga0065715_10092414 3300005293 Bacteria 5131
5 Ga0070658_10041393 3300005327 Bacteria 3717
6 Ga0070676_10036299 3300005328 Bacteria 2839
7 Ga0070683_100049047 3300005329 Bacteria 3904
8 Ga0070683_100102857 3300005329 Bacteria 2691
9 Ga0070690_100016640 3300005330 Bacteria 4409
10 Ga0068869_100058560 3300005334 Bacteria 2817
11 Ga0070666_10035307 3300005335 Bacteria 3316
12 Ga0070680_100029366 3300005336 Bacteria 4416
13 Ga0070680_100064883 3300005336 Bacteria 2993
14 Ga0070680_100134529 3300005336 Bacteria 2070
15 Ga0068868_100086971 3300005338 Bacteria 2513
16 Ga0070689_100083306 3300005340 Bacteria 2513
17 Ga0070687_100060857 3300005343 Bacteria 1993
18 Ga0070661_100004828 3300005344 Bacteria 9279
19 Ga0070661_100020662 3300005344 Bacteria 4696
20 Ga0070692_10000442 3300005345 Bacteria 12631
21 Ga0070668_100061577 3300005347 Bacteria 2907
22 Ga0070669_100007961 3300005353 Bacteria 7570
23 Ga0070675_100051449 3300005354 Bacteria 3385
24 Ga0070674_100022583 3300005356 Bacteria 4060
25 Ga0070688_100031832 3300005365 Bacteria 3175
26 Ga0070703_10031868 3300005406 Bacteria 1597
27 Ga0070709_10016852 3300005434 Bacteria 4180
28 Ga0070709_10033591 3300005434 Bacteria 3104
29 Ga0070709_10160957 3300005434 Unclassified 1561
30 Ga0070714_100000802 3300005435 Bacteria 22244
31 Ga0070714_100183504 3300005435 Unclassified 1905
32 Ga0070713_100000509 3300005436 Bacteria 24860
33 Ga0070713_100000646 3300005436 Bacteria 22257
34 Ga0070713_100042774 3300005436 Bacteria 3700
35 Ga0070713_100073981 3300005436 Bacteria 2885
36 Ga0070713_100111701 3300005436 Unclassified 2384
37 Ga0070713_100408423 3300005436 Bacteria 1269
38 Ga0070710_10000598 3300005437 Bacteria 17193
39 Ga0070710_10015754 3300005437 Unclassified 3833
40 Ga0070710_10114973 3300005437 Bacteria 1621
41 Ga0070701_10021041 3300005438 Bacteria 3107
42 Ga0070711_100007854 3300005439 Bacteria 6502
43 Ga0070711_100013424 3300005439 Bacteria 5145
44 Ga0070711_100023052 3300005439 Bacteria 4043
45 Ga0070705_100015101 3300005440 Bacteria 3984
46 Ga0070708_100017749 3300005445 Bacteria 5942
47 Ga0070708_100049795 3300005445 Bacteria 3707
48 Ga0070708_100117214 3300005445 Bacteria 2452
49 Ga0070663_100056941 3300005455 Bacteria 2802
50 Ga0070678_100004888 3300005456 Bacteria 7662
51 Ga0070662_100009850 3300005457 Bacteria 6263
52 Ga0070681_10013120 3300005458 Bacteria 8231
53 Ga0070681_10065115 3300005458 Bacteria 3614
54 Ga0070681_10213712 3300005458 Bacteria 1845
55 Ga0070685_10007147 3300005466 Bacteria 5702
56 Ga0070706_100008707 3300005467 Bacteria 9458
57 Ga0070707_100048311 3300005468 Bacteria 4077
58 Ga0070707_100112399 3300005468 Bacteria 2642
59 Ga0070707_100121543 3300005468 Bacteria 2536
60 Ga0070707_100221569 3300005468 Bacteria 1842
61 Ga0070698_100114954 3300005471 Bacteria 2655
62 Ga0070699_100002801 3300005518 Bacteria 15557
63 Ga0070699_100003733 3300005518 Bacteria 13445
64 Ga0070679_100076228 3300005530 Unclassified 3343
65 Ga0070679_100129082 3300005530 Unclassified 2509
66 Ga0070684_100028623 3300005535 Bacteria 4714
67 Ga0070684_100087711 3300005535 Bacteria 2763
68 Ga0070684_100166574 3300005535 Bacteria 2000
69 Ga0070684_100334403 3300005535 Unclassified 1392
70 Ga0070697_100005219 3300005536 Bacteria 9978
71 Ga0070697_100010233 3300005536 Bacteria 7309
72 Ga0070697_100014475 3300005536 Bacteria 6196
73 Ga0070697_100026945 3300005536 Bacteria 4596
74 Ga0070697_100062467 3300005536 Bacteria 3040
75 Ga0070697_100082596 3300005536 Bacteria 2648
76 Ga0070697_100100079 3300005536 Bacteria 2407
77 Ga0070697_100149931 3300005536 Bacteria 1965
78 Ga0068853_100036182 3300005539 Bacteria 4196
79 Ga0070672_100015810 3300005543 Bacteria 5388
80 Ga0070695_100001166 3300005545 Bacteria 14425
81 Ga0070693_100090869 3300005547 Unclassified 1840
82 Ga0070704_100069840 3300005549 Bacteria 2547
83 Ga0070704_100083790 3300005549 Bacteria 2355
84 Ga0068855_100020476 3300005563 Bacteria 7931
85 Ga0070664_100008524 3300005564 Bacteria 8289
86 Ga0070664_100041317 3300005564 Bacteria 3891
87 Ga0068857_100005936 3300005577 Bacteria 10427
88 Ga0068857_100045059 3300005577 Bacteria 3912
89 Ga0068854_100011931 3300005578 Bacteria 5678
90 Ga0068856_100001532 3300005614 Bacteria 24221
91 Ga0068856_100041128 3300005614 Unclassified 4541
92 Ga0068856_100044226 3300005614 Bacteria 4382
93 Ga0070702_100023103 3300005615 Bacteria 3299
94 Ga0068852_100237740 3300005616 Bacteria 1739
95 Ga0068864_100094913 3300005618 Bacteria 2637
96 Ga0068866_10012310 3300005718 Bacteria 3726
97 Ga0068861_100032548 3300005719 Bacteria 3839
98 Ga0068851_10014356 3300005834 Bacteria 3760
99 Ga0068870_10009855 3300005840 Bacteria 4362
100 Ga0068863_100026229 3300005841 Bacteria 5561
101 Ga0068863_100061050 3300005841 Bacteria 3564
102 Ga0068863_100299297 3300005841 Unclassified 1560
103 Ga0068860_100056544 3300005843 Bacteria 3729
104 Ga0081455_10000413 3300005937 Bacteria 56249
105 Ga0081455_10000896 3300005937 Bacteria 38413
106 Ga0081540_1000214 3300005983 Bacteria 61107
107 Ga0081540_1000220 3300005983 Bacteria 60652
108 Ga0081540_1000377 3300005983 Bacteria 44639
109 Ga0081540_1001528 3300005983 Bacteria 19885
110 Ga0081539_10002102 3300005985 Bacteria 29663
111 Ga0081539_10014505 3300005985 Bacteria 5822
112 Ga0075363_100045125 3300006048 Bacteria 2337
113 Ga0070715_10025553 3300006163 Bacteria 2341
114 Ga0070716_100001240 3300006173 Bacteria 11249
115 Ga0070716_100002081 3300006173 Bacteria 9175
116 Ga0070716_100031330 3300006173 Unclassified 2892
117 Ga0070716_100098916 3300006173 Bacteria 1783
118 Ga0070716_100100773 3300006173 Bacteria 1770
119 Ga0070716_100124489 3300006173 Bacteria 1619
120 Ga0070716_100202774 3300006173 Unclassified 1320
121 Ga0070712_100000134 3300006175 Bacteria 38860
122 Ga0070712_100008549 3300006175 Bacteria 6440
123 Ga0070712_100032797 3300006175 Bacteria 3509
124 Ga0070712_100041067 3300006175 Bacteria 3174
125 Ga0097621_100004245 3300006237 Bacteria 9958
126 Ga0068871_100009393 3300006358 Bacteria 7084
127 Ga0068871_100094553 3300006358 Bacteria 2495
128 Ga0075428_100209573 3300006844 Bacteria 2106
129 Ga0075431_100114136 3300006847 Bacteria 2789
130 Ga0075433_10004547 3300006852 Bacteria 10818
131 Ga0075433_10139064 3300006852 Bacteria 2158
132 Ga0075434_100000235 3300006871 Bacteria 38289
133 Ga0075434_100006014 3300006871 Bacteria 11103
134 Ga0075434_100067732 3300006871 Bacteria 3556
135 Ga0075434_100474945 3300006871 Bacteria 1271
136 Ga0075436_100001458 3300006914 Bacteria 16083
137 Ga0075436_100036394 3300006914 Bacteria 3397
138 Ga0075436_100152995 3300006914 Bacteria 1624
139 Ga0075435_100003821 3300007076 Bacteria 10277
140 Ga0099794_10000033 3300007265 Bacteria 57721
141 Ga0099794_10000922 3300007265 Bacteria 9922
142 Ga0099794_10017484 3300007265 Bacteria 3197
143 Ga0105240_10048726 3300009093 Bacteria 5352
144 Ga0105245_10016953 3300009098 Bacteria 6360
145 Ga0105247_10008282 3300009101 Bacteria 6342
146 Ga0114129_10006148 3300009147 Bacteria 17029
147 Ga0114129_10415772 3300009147 Bacteria 1770
148 Ga0105243_10005625 3300009148 Bacteria 9759
149 Ga0105241_10003663 3300009174 Bacteria 11413
150 Ga0105241_10019407 3300009174 Bacteria 5012
151 Ga0105242_10007918 3300009176 Bacteria 8180
152 Ga0105242_10029312 3300009176 Bacteria 4389
153 Ga0105248_10449792 3300009177 Bacteria 1452
154 Ga0105237_10019946 3300009545 Bacteria 6921
155 Ga0105237_10060749 3300009545 Bacteria 3779
156 Ga0105238_10018812 3300009551 Bacteria 7032
157 Ga0105238_10173476 3300009551 Unclassified 2133
158 Ga0105249_10039376 3300009553 Bacteria 4291
159 Ga0105239_10039543 3300010375 Bacteria 5167
160 Ga0105239_10509143 3300010375 Bacteria 1369
161 Ga0105246_10003169 3300011119 Bacteria 9993
162 Ga0157373_10008576 3300013100 Bacteria 7593
163 Ga0157371_10011090 3300013102 Bacteria 6978
164 Ga0157370_10106223 3300013104 Unclassified 2628
165 Ga0157369_10029591 3300013105 Bacteria 6051
166 Ga0157369_10043435 3300013105 Bacteria 4899
167 Ga0157369_10069989 3300013105 Unclassified 3769
168 Ga0157374_10033535 3300013296 Bacteria 4684
169 Ga0157374_10076099 3300013296 Bacteria 3173
170 Ga0157378_10003381 3300013297 Bacteria 14183
171 Ga0157378_10028655 3300013297 Bacteria 4915
172 Ga0163162_10109029 3300013306 Bacteria 2865
173 Ga0163162_10354760 3300013306 Bacteria 1599
174 Ga0157372_10000992 3300013307 Bacteria 31047
175 Ga0157372_10049782 3300013307 Bacteria 4660
176 Ga0163163_10049124 3300014325 Bacteria 4150
177 Ga0157377_10001805 3300014745 Bacteria 9328
178 Ga0157379_10003566 3300014968 Bacteria 13181
179 Ga0157379_10016645 3300014968 Bacteria 6465
180 Ga0157376_10002140 3300014969 Bacteria 13309
181 Ga0157376_10004186 3300014969 Bacteria 10011
182 Ga0157376_10012122 3300014969 Bacteria 6385
183 Ga0163161_10010057 3300017792 Bacteria 6549
184 Ga0224572_1001484 3300024225 Bacteria 3491
185 Ga0228598_1008111 3300024227 Unclassified 2128
186 Ga0207697_10000498 3300025315 Bacteria 22072
187 Ga0207653_10028153 3300025885 Bacteria 1806
188 Ga0207682_10001642 3300025893 Bacteria 10254
189 Ga0207692_10000340 3300025898 Bacteria 16225
190 Ga0207692_10000820 3300025898 Bacteria 11129
191 Ga0207710_10008398 3300025900 Bacteria 4355
192 Ga0207688_10000572 3300025901 Bacteria 18079
193 Ga0207680_10111894 3300025903 Bacteria 1772
194 Ga0207647_10000888 3300025904 Bacteria 23203
195 Ga0207685_10000118 3300025905 Bacteria 11921
196 Ga0207699_10001629 3300025906 Bacteria 10643
197 Ga0207699_10003637 3300025906 Bacteria 7368
198 Ga0207699_10007961 3300025906 Bacteria 5202
199 Ga0207699_10046519 3300025906 Bacteria 2538
200 Ga0207645_10010112 3300025907 Bacteria 6493
201 Ga0207643_10000024 3300025908 Bacteria 103214
202 Ga0207705_10045059 3300025909 Bacteria 3170
203 Ga0207684_10000057 3300025910 Bacteria 211445
204 Ga0207684_10000973 3300025910 Bacteria 32084
205 Ga0207654_10018965 3300025911 Bacteria 3619
206 Ga0207654_10113748 3300025911 Unclassified 1688
207 Ga0207707_10010495 3300025912 Bacteria 8039
208 Ga0207695_10042899 3300025913 Bacteria 4825
209 Ga0207671_10011447 3300025914 Bacteria 7222
210 Ga0207671_10028800 3300025914 Bacteria 4149
211 Ga0207693_10000051 3300025915 Bacteria 99220
212 Ga0207693_10003027 3300025915 Bacteria 14526
213 Ga0207693_10015301 3300025915 Bacteria 6156
214 Ga0207693_10032918 3300025915 Bacteria 4091
215 Ga0207693_10051689 3300025915 Bacteria 3224
216 Ga0207693_10212978 3300025915 Unclassified 1519
217 Ga0207663_10000328 3300025916 Bacteria 20830
218 Ga0207663_10005543 3300025916 Bacteria 6369
219 Ga0207663_10055134 3300025916 Bacteria 2493
220 Ga0207660_10073793 3300025917 Bacteria 2488
221 Ga0207662_10000499 3300025918 Bacteria 17531
222 Ga0207657_10000115 3300025919 Bacteria 79117
223 Ga0207649_10053424 3300025920 Bacteria 2511
224 Ga0207652_10065192 3300025921 Unclassified 3153
225 Ga0207652_10086674 3300025921 Unclassified 2746
226 Ga0207646_10000037 3300025922 Bacteria 196362
227 Ga0207646_10011738 3300025922 Bacteria 8468
228 Ga0207646_10027328 3300025922 Bacteria 5204
229 Ga0207646_10039090 3300025922 Unclassified 4269
230 Ga0207646_10226612 3300025922 Unclassified 1688
231 Ga0207681_10006516 3300025923 Bacteria 7166
232 Ga0207694_10039874 3300025924 Bacteria 3615
233 Ga0207650_10007543 3300025925 Bacteria 7417
234 Ga0207659_10022783 3300025926 Bacteria 4173
235 Ga0207687_10000141 3300025927 Bacteria 48006
236 Ga0207687_10031487 3300025927 Bacteria 3585
237 Ga0207700_10002753 3300025928 Bacteria 10131
238 Ga0207700_10003738 3300025928 Bacteria 8882
239 Ga0207700_10039317 3300025928 Bacteria 3443
240 Ga0207700_10059897 3300025928 Unclassified 2881
241 Ga0207700_10211034 3300025928 Unclassified 1641
242 Ga0207664_10003239 3300025929 Bacteria 10816
243 Ga0207664_10170635 3300025929 Bacteria 1862
244 Ga0207664_10197952 3300025929 Unclassified 1733
245 Ga0207664_10280174 3300025929 Bacteria 1463
246 Ga0207644_10009480 3300025931 Bacteria 6395
247 Ga0207690_10006275 3300025932 Bacteria 7041
248 Ga0207706_10003073 3300025933 Bacteria 16051
249 Ga0207709_10011276 3300025935 Bacteria 4930
250 Ga0207670_10058925 3300025936 Bacteria 2610
251 Ga0207704_10001072 3300025938 Bacteria 12170
252 Ga0207665_10002841 3300025939 Bacteria 11622
253 Ga0207665_10003709 3300025939 Bacteria 10199
254 Ga0207665_10003782 3300025939 Bacteria 10111
255 Ga0207665_10045253 3300025939 Bacteria 2947
256 Ga0207665_10055012 3300025939 Bacteria 2684
257 Ga0207665_10139069 3300025939 Bacteria 1730
258 Ga0207691_10021585 3300025940 Bacteria 6079
259 Ga0207711_10063491 3300025941 Bacteria 3188
260 Ga0207689_10000471 3300025942 Bacteria 37824
261 Ga0207661_10028374 3300025944 Bacteria 4285
262 Ga0207661_10049101 3300025944 Bacteria 3357
263 Ga0207661_10058882 3300025944 Bacteria 3093
264 Ga0207679_10000456 3300025945 Bacteria 28835
265 Ga0207667_10058796 3300025949 Bacteria 4030
266 Ga0207651_10023742 3300025960 Bacteria 3779
267 Ga0207668_10026673 3300025972 Bacteria 3754
268 Ga0207640_10006740 3300025981 Bacteria 6316
269 Ga0207658_10024572 3300025986 Bacteria 4216
270 Ga0207703_10024363 3300026035 Bacteria 4762
271 Ga0207703_10038527 3300026035 Bacteria 3815
272 Ga0207678_10011783 3300026067 Bacteria 7678
273 Ga0207678_10014940 3300026067 Bacteria 6831
274 Ga0207708_10043579 3300026075 Bacteria 3419
275 Ga0207702_10027074 3300026078 Bacteria 4760
276 Ga0207702_10339305 3300026078 Bacteria 1435
277 Ga0207702_10490863 3300026078 Bacteria 1196
278 Ga0207641_10029640 3300026088 Bacteria 4526
279 Ga0207641_10192859 3300026088 Bacteria 1874
280 Ga0207648_10034096 3300026089 Bacteria 4489
281 Ga0207676_10011240 3300026095 Bacteria 6395
282 Ga0207674_10001162 3300026116 Bacteria 34157
283 Ga0207674_10011063 3300026116 Bacteria 10146
284 Ga0207675_100001572 3300026118 Bacteria 22828
285 Ga0207683_10004611 3300026121 Bacteria 11875
286 Ga0207698_10007753 3300026142 Bacteria 6742
287 Ga0209588_1000006 3300027671 Bacteria 184445
288 Ga0209588_1010025 3300027671 Bacteria 2842
289 Ga0268266_10022738 3300028379 Bacteria 5336
290 Ga0268265_10019604 3300028380 Bacteria 4704
291 Ga0268264_10023850 3300028381 Bacteria 4990
292 Ga0265762_1001037 3300030760 Bacteria 4994
293 Ga0265760_10001276 3300031090 Bacteria 7364
294 Ga0307405_10085911 3300031731 Unclassified 2070
295 Ga0373943_0050299 3300035170 Bacteria 2048
296 Ga0373955_0003819 3300035172 Bacteria 6636
297 Ga0373931_0029503 3300035691 Bacteria 2817
298 Ga0373935_0000269 3300035692 Bacteria 25655
299 Ga0373935_0105236 3300035692 Unclassified 1866
300 Ga0373927_0005951 3300035695 Bacteria 8352
301 Ga0373927_0154610 3300035695 Unclassified 1502
302 Ga0373947_0000632 3300035725 Bacteria 20796
303 Ga0373947_0056184 3300035725 Bacteria 2379
304 Ga0373947_0075958 3300035725 Bacteria 2070
305 Ga0373925_0006247 3300037068 Bacteria 8786
306 Ga0373925_0010629 3300037068 Bacteria 6675
307 Ga0373925_0119592 3300037068 Bacteria 2044
308 Ga0395898_0100275 3300037466 Bacteria 2781
309 Ga0395898_0120950 3300037466 Bacteria 2508
310 Ga0395905_0309583 3300037471 Unclassified 1468
311 Ga0436361_0427309 3300039447 Bacteria 2901
312 Ga0436363_1146914 3300039450 Bacteria 1629
313 Ga0451576_0041059 3300045051 Bacteria 4892
314 Ga0495603_0095616 3300046455 Bacteria 1736
315 Ga0495580_0015431 3300046472 Bacteria 5760
316 Ga0495580_0045734 3300046472 Bacteria 3108
317 Ga0495594_0060321 3300046499 Bacteria 2098
318 Ga0495630_0007052 3300046517 Bacteria 8008
319 Ga0495630_0041191 3300046517 Unclassified 3449
320 Ga0495665_0025233 3300046531 Bacteria 3193
321 Ga0495665_0125562 3300046531 Bacteria 1344
322 Ga0495587_0146321 3300046536 Bacteria 1347
323 Ga0495623_0015107 3300046679 Bacteria 4992
324 Ga0495604_0004693 3300047317 Bacteria 10839
325 Ga0495636_0022579 3300047318 Bacteria 2545
326 Ga0495674_0256512 3300047319 Bacteria 1438
327 Ga0495602_0128624 3300048088 Unclassified 2024
328 Ga0496102_0003254 3300048905 Bacteria 13781
329 Ga0496102_0063640 3300048905 Bacteria 3378
330 Ga0496102_0089004 3300048905 Bacteria 2855
331 Ga0496104_0134182 3300048907 Bacteria 2378
332 Ga0496104_0208622 3300048907 Unclassified 1865
333 Ga0496104_0220884 3300048907 Unclassified 1807
334 Ga0496104_0324231 3300048907 Unclassified 1453
335 Ga0496107_0062998 3300048910 Bacteria 2687
336 Ga0496107_0157526 3300048910 Bacteria 1682
337 Ga0496108_0082502 3300048911 Bacteria 2726
338 Ga0496109_0031769 3300048912 Bacteria 4741
339 Ga0496110_0121788 3300048913 Bacteria 2351
340 Ga0496112_0006548 3300048915 Bacteria 10248
341 Ga0496112_0008145 3300048915 Bacteria 9365
342 Ga0496112_0013319 3300048915 Bacteria 7591
343 Ga0496112_0039392 3300048915 Bacteria 4619
344 Ga0496113_0015306 3300048916 Bacteria 5268
345 Ga0496113_0277944 3300048916 Unclassified 1339
346 Ga0501039_0108393 3300049575 Bacteria 2171
347 Ga0501040_0075399 3300049576 Bacteria 2331
348 Ga0501046_0042599 3300049580 Bacteria 3619
349 Ga0501072_0146449 3300049588 Bacteria 1883
350 Ga0501075_0004943 3300049591 Bacteria 9091
351 Ga0501075_0211566 3300049591 Bacteria 1479
352 Ga0501076_0068992 3300049592 Bacteria 2825
353 Ga0501076_0103981 3300049592 Unclassified 2291
354 Ga0501076_0105398 3300049592 Bacteria 2275
355 Ga0501079_0018271 3300049741 Bacteria 5357
356 Ga0501079_0043493 3300049741 Bacteria 3467
357 Ga0501079_0148878 3300049741 Unclassified 1825
358 Ga0501080_0057302 3300049742 Bacteria 3628
359 Ga0501080_0068733 3300049742 Bacteria 3295
360 Ga0501081_0036163 3300049743 Bacteria 3366
361 Ga0501081_0124132 3300049743 Bacteria 1841
362 Ga0501081_0154872 3300049743 Bacteria 1648
363 Ga0501045_0067414 3300049824 Bacteria 2628
364 Ga0501045_0085442 3300049824 Bacteria 2329
365 Ga0501045_0304323 3300049824 Bacteria 1186
366 nmdc:mga0yw44_21817_c1 3300050492 Unclassified 3580
367 nmdc:mga05p37_196360_c1 3300050507 Bacteria 2447
368 nmdc:mga05p37_44296_c2 3300050507 Bacteria 3744
369 nmdc:mga05p37_474991_c1 3300050507 Bacteria 1442
370 nmdc:mga0n895_455623_c1 3300050512 Bacteria 1291
371 nmdc:mga0n895_863_c1 3300050512 Bacteria 21786
372 nmdc:mga0rr50_1609_c1 3300050513 Bacteria 12424
373 nmdc:mga0rr50_18895_c1 3300050513 Bacteria 4641
374 nmdc:mga0rr50_76077_c1 3300050513 Bacteria 2576
375 nmdc:mga08x19_12233_c1 3300050514 Bacteria 5166
376 nmdc:mga08x19_198696_c1 3300050514 Bacteria 1374
377 nmdc:mga08x19_22_c1 3300050514 Bacteria 297462
378 nmdc:mga08x19_43_c1 3300050514 Bacteria 148391
379 nmdc:mga0a205_449_c1 3300050515 Bacteria 31835
380 Ga0501084_0016837 3300054114 Bacteria 6074
381 Ga0501084_0039860 3300054114 Bacteria 3928
382 Ga0501084_0108707 3300054114 Unclassified 2330
383 Ga0501084_0233686 3300054114 Bacteria 1552
384 Ga0501082_0006722 3300060353 Bacteria 9945
385 Ga0501082_0029289 3300060353 Bacteria 4742
386 Ga0501082_0364114 3300060353 Bacteria 1261
387 Ga0530510_0020143 3300061734 Bacteria 4742
388 Ga0530510_0038451 3300061734 Bacteria 3454
389 Ga0530510_0040246 3300061734 Bacteria 3373
390 Ga0530510_0064943 3300061734 Unclassified 2644
391 Ga0530510_0342760 3300061734 Bacteria 1122
392 643601160 643348564 Bacteria 8839022
393 Ga0114129_10050585
394 MBSR1b_contig_11138974
395 JGI24749J21850_1004230
396 Ga0065715_10092414
397 Ga0070658_10041393
398 Ga0070676_10036299
399 Ga0070683_100049047
400 Ga0070683_100102857
401 Ga0070690_100016640
402 Ga0068869_100058560
403 Ga0070666_10035307
404 Ga0070680_100029366
405 Ga0070680_100064883
406 Ga0070680_100134529
407 Ga0068868_100086971
408 Ga0070689_100083306
409 Ga0070687_100060857
410 Ga0070661_100004828
411 Ga0070661_100020662
412 Ga0070692_10000442
413 Ga0070668_100061577
414 Ga0070669_100007961
415 Ga0070675_100051449
416 Ga0070674_100022583
417 Ga0070688_100031832
418 Ga0070703_10031868
419 Ga0070709_10016852
420 Ga0070709_10033591
421 Ga0070709_10160957
422 Ga0070714_100000802
423 Ga0070714_100183504
424 Ga0070713_100000509
425 Ga0070713_100000646
426 Ga0070713_100042774
427 Ga0070713_100073981
428 Ga0070713_100111701
429 Ga0070713_100408423
430 Ga0070710_10000598
431 Ga0070710_10015754
432 Ga0070710_10114973
433 Ga0070701_10021041
434 Ga0070711_100007854
435 Ga0070711_100013424
436 Ga0070711_100023052
437 Ga0070705_100015101
438 Ga0070708_100017749
439 Ga0070708_100049795
440 Ga0070708_100117214
441 Ga0070663_100056941
442 Ga0070678_100004888
443 Ga0070662_100009850
444 Ga0070681_10013120
445 Ga0070681_10065115
446 Ga0070681_10213712
447 Ga0070685_10007147
448 Ga0070706_100008707
449 Ga0070707_100048311
450 Ga0070707_100112399
451 Ga0070707_100121543
452 Ga0070707_100221569
453 Ga0070698_100114954
454 Ga0070699_100002801
455 Ga0070699_100003733
456 Ga0070679_100076228
457 Ga0070679_100129082
458 Ga0070684_100028623
459 Ga0070684_100087711
460 Ga0070684_100166574
461 Ga0070684_100334403
462 Ga0070697_100005219
463 Ga0070697_100010233
464 Ga0070697_100014475
465 Ga0070697_100026945
466 Ga0070697_100062467
467 Ga0070697_100082596
468 Ga0070697_100100079
469 Ga0070697_100149931
470 Ga0068853_100036182
471 Ga0070672_100015810
472 Ga0070695_100001166
473 Ga0070693_100090869
474 Ga0070704_100069840
475 Ga0070704_100083790
476 Ga0068855_100020476
477 Ga0070664_100008524
478 Ga0070664_100041317
479 Ga0068857_100005936
480 Ga0068857_100045059
481 Ga0068854_100011931
482 Ga0068856_100001532
483 Ga0068856_100041128
484 Ga0068856_100044226
485 Ga0070702_100023103
486 Ga0068852_100237740
487 Ga0068864_100094913
488 Ga0068866_10012310
489 Ga0068861_100032548
490 Ga0068851_10014356
491 Ga0068870_10009855
492 Ga0068863_100026229
493 Ga0068863_100061050
494 Ga0068863_100299297
495 Ga0068860_100056544
496 Ga0081455_10000413
497 Ga0081455_10000896
498 Ga0081540_1000214
499 Ga0081540_1000220
500 Ga0081540_1000377
501 Ga0081540_1001528
502 Ga0081539_10002102
503 Ga0081539_10014505
504 Ga0075363_100045125
505 Ga0070715_10025553
506 Ga0070716_100001240
507 Ga0070716_100002081
508 Ga0070716_100031330
509 Ga0070716_100098916
510 Ga0070716_100100773
511 Ga0070716_100124489
512 Ga0070716_100202774
513 Ga0070712_100000134
514 Ga0070712_100008549
515 Ga0070712_100032797
516 Ga0070712_100041067
517 Ga0097621_100004245
518 Ga0068871_100009393
519 Ga0068871_100094553
520 Ga0075428_100209573
521 Ga0075431_100114136
522 Ga0075433_10004547
523 Ga0075433_10139064
524 Ga0075434_100000235
525 Ga0075434_100006014
526 Ga0075434_100067732
527 Ga0075434_100474945
528 Ga0075436_100001458
529 Ga0075436_100036394
530 Ga0075436_100152995
531 Ga0075435_100003821
532 Ga0099794_10000033
533 Ga0099794_10000922
534 Ga0099794_10017484
535 Ga0105240_10048726
536 Ga0105245_10016953
537 Ga0105247_10008282
538 Ga0114129_10006148
539 Ga0114129_10415772
540 Ga0105243_10005625
541 Ga0105241_10003663
542 Ga0105241_10019407
543 Ga0105242_10007918
544 Ga0105242_10029312
545 Ga0105248_10449792
546 Ga0105237_10019946
547 Ga0105237_10060749
548 Ga0105238_10018812
549 Ga0105238_10173476
550 Ga0105249_10039376
551 Ga0105239_10039543
552 Ga0105239_10509143
553 Ga0105246_10003169
554 Ga0157373_10008576
555 Ga0157371_10011090
556 Ga0157370_10106223
557 Ga0157369_10029591
558 Ga0157369_10043435
559 Ga0157369_10069989
560 Ga0157374_10033535
561 Ga0157374_10076099
562 Ga0157378_10003381
563 Ga0157378_10028655
564 Ga0163162_10109029
565 Ga0163162_10354760
566 Ga0157372_10000992
567 Ga0157372_10049782
568 Ga0163163_10049124
569 Ga0157377_10001805
570 Ga0157379_10003566
571 Ga0157379_10016645
572 Ga0157376_10002140
573 Ga0157376_10004186
574 Ga0157376_10012122
575 Ga0163161_10010057
576 Ga0224572_1001484
577 Ga0228598_1008111
578 Ga0207697_10000498
579 Ga0207653_10028153
580 Ga0207682_10001642
581 Ga0207692_10000340
582 Ga0207692_10000820
583 Ga0207710_10008398
584 Ga0207688_10000572
585 Ga0207680_10111894
586 Ga0207647_10000888
587 Ga0207685_10000118
588 Ga0207699_10001629
589 Ga0207699_10003637
590 Ga0207699_10007961
591 Ga0207699_10046519
592 Ga0207645_10010112
593 Ga0207643_10000024
594 Ga0207705_10045059
595 Ga0207684_10000057
596 Ga0207684_10000973
597 Ga0207654_10018965
598 Ga0207654_10113748
599 Ga0207707_10010495
600 Ga0207695_10042899
601 Ga0207671_10011447
602 Ga0207671_10028800
603 Ga0207693_10000051
604 Ga0207693_10003027
605 Ga0207693_10015301
606 Ga0207693_10032918
607 Ga0207693_10051689
608 Ga0207693_10212978
609 Ga0207663_10000328
610 Ga0207663_10005543
611 Ga0207663_10055134
612 Ga0207660_10073793
613 Ga0207662_10000499
614 Ga0207657_10000115
615 Ga0207649_10053424
616 Ga0207652_10065192
617 Ga0207652_10086674
618 Ga0207646_10000037
619 Ga0207646_10011738
620 Ga0207646_10027328
621 Ga0207646_10039090
622 Ga0207646_10226612
623 Ga0207681_10006516
624 Ga0207694_10039874
625 Ga0207650_10007543
626 Ga0207659_10022783
627 Ga0207687_10000141
628 Ga0207687_10031487
629 Ga0207700_10002753
630 Ga0207700_10003738
631 Ga0207700_10039317
632 Ga0207700_10059897
633 Ga0207700_10211034
634 Ga0207664_10003239
635 Ga0207664_10170635
636 Ga0207664_10197952
637 Ga0207664_10280174
638 Ga0207644_10009480
639 Ga0207690_10006275
640 Ga0207706_10003073
641 Ga0207709_10011276
642 Ga0207670_10058925
643 Ga0207704_10001072
644 Ga0207665_10002841
645 Ga0207665_10003709
646 Ga0207665_10003782
647 Ga0207665_10045253
648 Ga0207665_10055012
649 Ga0207665_10139069
650 Ga0207691_10021585
651 Ga0207711_10063491
652 Ga0207689_10000471
653 Ga0207661_10028374
654 Ga0207661_10049101
655 Ga0207661_10058882
656 Ga0207679_10000456
657 Ga0207667_10058796
658 Ga0207651_10023742
659 Ga0207668_10026673
660 Ga0207640_10006740
661 Ga0207658_10024572
662 Ga0207703_10024363
663 Ga0207703_10038527
664 Ga0207678_10011783
665 Ga0207678_10014940
666 Ga0207708_10043579
667 Ga0207702_10027074
668 Ga0207702_10339305
669 Ga0207702_10490863
670 Ga0207641_10029640
671 Ga0207641_10192859
672 Ga0207648_10034096
673 Ga0207676_10011240
674 Ga0207674_10001162
675 Ga0207674_10011063
676 Ga0207675_100001572
677 Ga0207683_10004611
678 Ga0207698_10007753
679 Ga0209588_1000006
680 Ga0209588_1010025
681 Ga0268266_10022738
682 Ga0268265_10019604
683 Ga0268264_10023850
684 Ga0265762_1001037
685 Ga0265760_10001276
686 Ga0307405_10085911
687 Ga0373943_0050299
688 Ga0373955_0003819
689 Ga0373931_0029503
690 Ga0373935_0000269
691 Ga0373935_0105236
692 Ga0373927_0005951
693 Ga0373927_0154610
694 Ga0373947_0000632
695 Ga0373947_0056184
696 Ga0373947_0075958
697 Ga0373925_0006247
698 Ga0373925_0010629
699 Ga0373925_0119592
700 Ga0395898_0100275
701 Ga0395898_0120950
702 Ga0395905_0309583
703 Ga0436361_0427309
704 Ga0436363_1146914
705 Ga0451576_0041059
706 Ga0495603_0095616
707 Ga0495580_0015431
708 Ga0495580_0045734
709 Ga0495594_0060321
710 Ga0495630_0007052
711 Ga0495630_0041191
712 Ga0495665_0025233
713 Ga0495665_0125562
714 Ga0495587_0146321
715 Ga0495623_0015107
716 Ga0495604_0004693
717 Ga0495636_0022579
718 Ga0495674_0256512
719 Ga0495602_0128624
720 Ga0496102_0003254
721 Ga0496102_0063640
722 Ga0496102_0089004
723 Ga0496104_0134182
724 Ga0496104_0208622
725 Ga0496104_0220884
726 Ga0496104_0324231
727 Ga0496107_0062998
728 Ga0496107_0157526
729 Ga0496108_0082502
730 Ga0496109_0031769
731 Ga0496110_0121788
732 Ga0496112_0006548
733 Ga0496112_0008145
734 Ga0496112_0013319
735 Ga0496112_0039392
736 Ga0496113_0015306
737 Ga0496113_0277944
738 Ga0501039_0108393
739 Ga0501040_0075399
740 Ga0501046_0042599
741 Ga0501072_0146449
742 Ga0501075_0004943
743 Ga0501075_0211566
744 Ga0501076_0068992
745 Ga0501076_0103981
746 Ga0501076_0105398
747 Ga0501079_0018271
748 Ga0501079_0043493
749 Ga0501079_0148878
750 Ga0501080_0057302
751 Ga0501080_0068733
752 Ga0501081_0036163
753 Ga0501081_0124132
754 Ga0501081_0154872
755 Ga0501045_0067414
756 Ga0501045_0085442
757 Ga0501045_0304323
758 nmdc:mga0yw44_21817_c1
759 nmdc:mga05p37_196360_c1
760 nmdc:mga05p37_44296_c2
761 nmdc:mga05p37_474991_c1
762 nmdc:mga0n895_455623_c1
763 nmdc:mga0n895_863_c1
764 nmdc:mga0rr50_1609_c1
765 nmdc:mga0rr50_18895_c1
766 nmdc:mga0rr50_76077_c1
767 nmdc:mga08x19_12233_c1
768 nmdc:mga08x19_198696_c1
769 nmdc:mga08x19_22_c1
770 nmdc:mga08x19_43_c1
771 nmdc:mga0a205_449_c1
772 Ga0501084_0016837
773 Ga0501084_0039860
774 Ga0501084_0108707
775 Ga0501084_0233686
776 Ga0501082_0006722
777 Ga0501082_0029289
778 Ga0501082_0364114
779 Ga0530510_0020143
780 Ga0530510_0038451
781 Ga0530510_0040246
782 Ga0530510_0064943
783 Ga0530510_0342760
784 643601160

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

27

176

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vsm-assembly1.cif.gz_A crystal structure of viperin with bound [4fe-4s] cluster, 5'-deoxyadenosine, and l-methionine 0.7732 19 205
7n7i-assembly3.cif.gz_C x-ray crystal structure of viperin-like enzyme from trichoderma virens 0.7702 18 208
7n7h-assembly1.cif.gz_A x-ray crystal structure of viperin-like enzyme from nematostella vectensis 0.7671 18 202
6q2q-assembly1.cif.gz_A crystal structure of mouse viperin bound to uridine triphosphate and s-adenosylhomocysteine 0.7527 18 204
7bi7-assembly2.cif.gz_B an unexpected p-cluster like intermediate en route to the nitrogenase femo-co 0.7381 15 200
ID Description Score Start End Superfamily
af_Q8CBB9_70_328_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7845 18 204 3.20.20.70
af_P9WJ79_7_303_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7575 18 275 3.20.20.70
af_O33183_77_264_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7574 21 183 3.20.20.70
af_F1QSJ9_161_335_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7401 60 93 3.40.50.410
af_Q59026_29_239_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7376 22 207 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2V8XD78-F1-model_v4 Radical SAM protein 0.967 18 348 GO:0003824
GO:0046872
GO:0051536
AF-A0A1F7LU02-F1-model_v4 4Fe4S-binding SPASM domain-containing protein 0.9604 138 348
AF-A0A6J4YBR8-F1-model_v4 Radical SAM core domain-containing protein 0.9524 18 348 GO:0003824
GO:0046872
GO:0051536
AF-A0A831Y9N4-F1-model_v4 Radical SAM protein 0.9515 17 348 GO:0003824
GO:0046872
GO:0051536
AF-A0A1F7LU02-F1-model_v4 4Fe4S-binding SPASM domain-containing protein 0.9515 138 348

Map